—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Police Law Enforcement ↔ relates to ↔ Legal

23 Wikipedia bridge articles confirmed in both vertical ledgers. 303 deterministic cross-vertical edges. 8,465 external source links harvested. Every edge provenance-stamped. Every claim auditable.

23 QID Bridge Articles
303 Cross Edges
8,465 External Sources
361 Wikipedia Articles
25 🌲 Evergreen
161 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Police Law Enforcement
× Legal
QID Bridge Articles
23
confirmed Wikipedia overlap
Total Cross Edges
303
External Sources Harvested
8,465
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  20 shared tokens
QID Bridge Titles (20)
IdahoProbable causeIdaho LegislatureDomestic violenceProbationIdaho Supreme CourtTreasure ValleyBoise State UniversitySixth Amendment to the United States ConstitutionParoleIdentity theftFifth Amendment to the United States ConstitutionFourth Amendment to the United States ConstitutionNampa, IdahoAda County, IdahoCriminal recordBoise, IdahoGarden City, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationcourtcriminalgovernmentadalargesttechnologyoffenselocalriverwashingtonwesternpolicepropertyrequirementdistrictamongcases
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:48:22 UTC
Content Hash
8baa567eb2904fb8
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
23 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in police_law_enforcement (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (20): "agricultural", "associated", "boise", "death", "eastern", "idaho", "land", "largest", "national", "organized", "pacific", "population", "products", "river", "separate", "technology", "territory", "union", "washington", "western". | EXACT TITLE in police_law_enforcement: "Idaho". | EXACT TITLE in legal: "Idaho".
agriculturalassociatedboisedeatheasternidaholandlargestnationalorganizedpacificpopulationproductsriverseparatetechnologyterritoryunionwashingtonwestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
P
Q2624821 EXACT TITLE 1.000
QID OVERLAP: Q2624821 in police_law_enforcement (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (15): "conduct", "court", "criminal", "facts", "immigration", "knowledge", "legal", "offense", "police", "power", "property", "prosecution", "required", "requirement", "search". | EXACT TITLE in police_law_enforcement: "Probable cause".
conductcourtcriminalfactsimmigrationknowledgelegaloffensepolicepowerpropertyprosecutionrequiredrequirementsearch
r, the grand jury uses the probable cause standard to determine whether or not to issue a criminal indictment. The principle behind the probable cause standard is to limit the power of authorities to conduct unlawful search and seizure of person and property, and to promote formal, forensic procedures for gathering lawful evidence for the prosecution of the arrested criminal. In the case of Berger v. New York (1967), the Supreme Court said that the purpose of the probable-cause requirement of the Fourth Amendment is to keep the state out of Constitutionally protected areas until the state has reason to believe that a specific crime is being committed or has been committed. The term of criminal law, the probable cause standard is stipulated in the text of the Fourth Amendment to the U.S.
Probationers and parolees In early cases in the United States, the Supreme Court held that when a person is on probation, the standard required for a search to be lawful is lowered from "probable cause" to "reasonable grounds" or "reasonable suspicion". Specifically, the degree of individualized suspicion required of a search was a determination of when there is a sufficiently high probability that criminal conduct is occurring to make the intrusion on the individual's privacy interest reasonable. The Supreme Court held in United States v. Knights: Although the Fourth Amendment ordinarily requires the degree of probability embodied in the term "probable cause," a lesser degree satisfies the Constitution when the balance of governmental and private interests makes such a standard reasonable ... When an officer has reasonable suspicion that a probationer subject to a search condition is engaged in criminal activity, there is enough likelihood that criminal conduct is occurring that an intrusion on the probationer's significantly diminished privacy interests is reasonable. Later, in Samson v.
Although the Fourth Amendment ordinarily requires the degree of probability embodied in the term "probable cause," a lesser degree satisfies the Constitution when the balance of governmental and private interests makes such a standard reasonable ... When an officer has reasonable suspicion that a probationer subject to a search condition is engaged in criminal activity, there is enough likelihood that criminal conduct is occurring that an intrusion on the probationer's significantly diminished privacy interests is reasonable. Later, in Samson v.
Idaho Legislature
Q4256974 EXACT TITLE 1.000
QID OVERLAP: Q4256974 in police_law_enforcement (tier:branch) and legal (tier:evergreen). | SHARED TOKENS (15): "boise", "branch", "data", "district", "districts", "government", "house", "idaho", "legislative", "legislature", "members", "population", "residents", "single", "washington". | EXACT TITLE in legal: "Idaho Legislature".
boisebranchdatadistrictdistrictsgovernmenthouseidaholegislativelegislaturememberspopulationresidentssinglewashington
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
The Idaho Legislature is the legislative branch of the government of the U.S. state of Idaho and is bicameral, consisting of the upper chamber of the Idaho Senate and the lower chamber of the Idaho House of Representatives. The state of Idaho is divided into 35 legislative districts, which each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Domestic violence
Q156537 EXACT TITLE 1.000
QID OVERLAP: Q156537 in police_law_enforcement (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (26): "among", "cases", "child", "context", "death", "domestic", "established", "experience", "family", "financial", "forms", "life", "members", "office", "organization", "partners", "physical", "power", "range", "rates".... | EXACT TITLE in police_law_enforcement: "Domestic violence". | EXACT TITLE in legal: "Domestic violence".
amongcaseschildcontextdeathdomesticestablishedexperiencefamilyfinancialformslifemembersofficeorganizationpartnersphysicalpowerrangeratesrelationshipsresourcessexualtechnologyvictimsviolence
correlation between a country's level of gender inequality and rates of domestic violence, where countries with less gender equality experience higher rates of domestic violence. Domestic violence is among the most underreported crimes worldwide for both men and women. Domestic violence often occurs when the abuser believes that they are entitled to it, or that it is acceptable, justified, or unlikely to be reported. It may produce an intergenerational cycle of violence in children and other family members, who may feel that such violence is acceptable or condoned. Many people do not recognize themselves as abusers or victims, because they may consider their experiences as family conflicts that had gotten out of control. Awareness, perception, definition and documentation of domestic violence differs widely from country to country. Additionally, domestic violence often happens in the context of forced or child marriages. In abusive relationships, there may be a cycle of abuse during which tensions rise and an act of violence is committed, followed by a period of reconciliation and calm. The victims may be trapped in domestically violent situations through isolation, power and control, traumatic bonding to the abuser, cultural acceptance, lack of financial resources, fear, and shame, or to protect children. As a result of abuse, victims may experience physical disabilities, dysregulated aggression, chronic health problems, mental illness, limited finances, and a poor ability to create healthy relationships. Victims may experience severe psychological disorders, such as post-traumatic stress disorder (PTSD).
Economic abuse (or financial abuse) is a form of abuse when one intimate partner has control over the other partner's access to economic resources. Marital assets are used as a means of control. Economic abuse may involve preventing a spouse from resource acquisition, limiting what the victim may use, or by otherwise exploiting economic resources of the victim. Economic abuse diminishes the victim's capacity to support themselves, increasing dependence on the perpetrator, including reduced access to education, employment, career advancement, and asset acquisition. Forcing or pressuring a family member to sign documents, to sell things, or to change a will are forms of economic abuse. A victim may be put on an allowance, allowing close monitoring of how much money is spent, preventing spending without the perpetrator's consent, leading to the accumulation of debt or depletion of the victim's savings. Disagreements about money spent can result in retaliation with additional physical, sexual or emotional abuse. In parts of the world where women depend on husbands' income in order to survive (due to lack of opportunities for female employment and lack of state welfare) economic abuse can have very severe consequences. Abusive relations have been associated with malnutrition among both mothers and children. In India, for example, the withholding of food is a documented form of family abuse. Contributing factors One of the most important factors in domestic violence is a belief that abuse, whether physical or verbal, is acceptable. Other risk factors include substance abuse, lack of education, mental health problems, lack of coping skills, childhood abuse, and excessive dependence on the abuser. An overriding motive for committing acts of domestic and interpersonal violence in a relationship is to establish and maintain relationships based on power and control over victims. Batterers' morality is out of step with the law and society's standards. Research shows the key issue for perpetrators of abuse is their conscious and deliberate decision to offend in the pursuit of self-gratification. Men who perpetrate violence have specific characteristics: they are narcissistic, they willfully lack empathy, and they choose to treat their needs as more important than others.
Lenore E. Walker presented the model of a cycle of abuse which consists of four phases. First, there is a buildup to abuse when tension rises until a domestic violence incident ensues. During the reconciliation stage, the abuser may be kind and loving and then there is a period of calm. When the situation is calm, the abused person may be hopeful that the situation will change. Then, tensions begin to build, and the cycle starts again. Intergenerational violence A common aspect among abusers is that they witnessed abuse in their childhood. They were participants in a chain of intergenerational cycles of domestic violence. That does not mean, conversely, that if a child witnesses or is subject to violence that they will become abusers. Understanding and breaking the intergenerational abuse patterns may do more to reduce domestic violence than other remedies for managing the abuse. Responses that focus on children suggest that experiences throughout life influence an individual's propensity to engage in family violence (either as a victim or as a perpetrator). Researchers supporting this theory suggest it is useful to think of three sources of domestic violence: childhood socialization, previous experiences in couple relationships during adolescence, and levels of strain in a person's current life. People who observe their parents abusing each other, or who were themselves abused may incorporate abuse into their behaviour within relationships that they establish as adults. Research indicates that the more children are physically punished, the more likely they will be as adults to act violently towards family members, including intimate partners. People who are spanked more as children are more likely as adults to approve of hitting a partner, and also experience more marital conflict and feelings of anger in general. A number of studies have found physical punishment to be associated with "higher levels of aggression against parents, siblings, peers and spouses", even when controlling for other factors. While these associations do not prove a causal relationship, a number of longitudinal studies suggest that the experience of physical punishment does have a direct causal effect on later aggressive behaviors. Such research has shown that corporal punishment of children (e.g. smacking, slapping, or spanking) predicts weaker internalisation of values such as empathy, altruism, and resistance to temptation, along with more antisocial behavior, including dating violence. In some patrilineal societies around the world, a young bride moves with the family of her husband. As a new girl in the home, she starts as having the lowest (or among the lowest) position in the family, is often subjected to violence and abuse, and is, in particular, strongly controlled by the parents-in-law: with the arrival of the daughter-in-law in the family, the mother-in-law's status is elevated and she now has (often for the first time in her life) substantial power over someone else, and "this family system itself tends to produce a cycle of violence in which the formerly abused bride becomes the abusing mother-in-law to her new daughter-in-law".
P
Q13961 EXACT TITLE 1.000
QID OVERLAP: Q13961 in police_law_enforcement (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (22): "applies", "child", "community", "contact", "court", "courts", "criminal", "domestic", "drug", "firearms", "jurisdiction", "maintain", "offense", "officer", "orders", "pay", "permit", "program", "required", "sexual".... | EXACT TITLE in police_law_enforcement: "Probation".
applieschildcommunitycontactcourtcourtscriminaldomesticdrugfirearmsjurisdictionmaintainoffenseofficerorderspaypermitprogramrequiredsexualvictimsviolence
Probation in criminal law is a period of supervision over an offender, ordered by the court often in lieu of incarceration. In some jurisdictions, the term probation applies only to community sentences (alternatives to incarceration), such as suspended sentences. In others, probation also includes supervision of those conditionally released from prison on parole. An offender on probation is ordered to follow certain conditions set forth by the court, often under the supervision of a probation officer. During the period of probation, an offender faces the threat of being incarcerated if found breaking the rules set by the court or probation officer. Offenders are ordinarily required to maintain law-abiding behavior, and may be ordered to refrain from possession of firearms, remain employed, participate in an educational program, abide by a curfew, live at a directed place, obey the orders of the probation officer, or not leave the jurisdiction. The probationer might be ordered as well to refrain from contact with the victims (such as a former partner in a domestic violence case), with potential victims of similar crimes (such as minors, if the instant offense involves child sexual abuse), or with known criminals, particularly co-defendants. Additionally, offenders can be subject to refraining from the use or possession of alcohol and other drugs and may be ordered to submit to alcohol/drug tests or participate in alcohol/drug psychological treatment. Offenders on probation might be fitted with an electronic tag (or monitor), which signals their movement to officials.
ered as well to refrain from contact with the victims (such as a former partner in a domestic violence case), with potential victims of similar crimes (such as minors, if the instant offense involves child sexual abuse), or with known criminals, particularly co-defendants. Additionally, offenders can be subject to refraining from the use or possession of alcohol and other drugs and may be ordered to submit to alcohol/drug tests or participate in alcohol/drug psychological treatment. Offenders on probation might be fitted with an electronic tag (or monitor), which signals their movement to officials.
Probation first developed in the United States when John Augustus, a Boston cobbler, persuaded a judge in the Boston Police Court in 1841 to give him custody of a convicted offender, a "drunkard", for a brief period and to help the man to appear rehabilitated by the time of sentencing. Even earlier, the practice of suspending a sentence was used as early as 1830 in Boston, Massachusetts, and became widespread in U.S. courts, although there was no statutory provision for such a practice. At first, judges, most notably Peter Oxenbridge Thatcher of Boston, used "release on recognizance" or bail and simply refrained from taking any further action. In 1878, the mayor of Boston hired a former police officer, the ironically named "Captain Savage", to become what many recognize as the first official probation officer. By the mid-19th century, however, many Federal Courts were using a judicial reprieve to suspend sentences and this posed a legal question. In 1916, the United States Supreme Court, in Ex parte United States Petitioner Mandamus Judge Killets (also known as the Killets Case), held that Federal Judge Killets was without power to suspend a sentence indefinitely. This decision led to the passing of the National Probation Act of 1925, thereby, allowing courts to suspend the imposition of incarceration and place an offender on probation. Massachusetts developed the first statewide probation system in 1878, and by 1920, 21 other states had followed suit. With the passage of the National Probation Act on March 5, 1925, signed by President Calvin Coolidge, the U.S. Federal Probation Service was established. At the state level, pursuant to the Crime Control and Consent Act of 1936, a group of states entered into an agreement wherein they would supervise probationers and parolees who resided in each other's jurisdictions on each other's behalf. Known as the Interstate Compact For the Supervision of Parolees and Probationers, this agreement was originally signed by 25 states in 1937. By 1951, all the states in the United States of America had a working probation system and ratified the Interstate Compact Agreement. In 1959, the new states of Alaska and Hawaii, the Commonwealth of Puerto Rico, and the territories of the Virgin Islands, Guam, and American Samoa ratified the act as well. Probation in child support in the United States When child support nonpayment was criminalized in the early 20th century, probation was the primary punishment levied on nonsupporters. Those in favor of criminalizing nonsupport wanted a penalty that "would maximize deterrence, preserve the family (at least in a financial sense), and lighten the burden on charities and the state to support women and children." When New York authorized probation as a punishment in 1901, the New York City magistrates cited four benefits to probation as opposed to incarceration: "(1) 'Punishment without disgrace, and effective without producing embitterment, resentment or demoralization,' (2) judicial discretion to make the punishment fit the crime, (3) '[p]unishment that is borne solely by the guilty and displacing a system that frequently involved the innocent and helpless,' and (4) punishment attended by increased revenue to the City and by a saving in expense.'" The existence of probation officers in child support cases made it so the state was involved in family life in previously unprecedented ways. Probation officers would often attempt to reconcile separated couples, encourage husbands to drink less alcohol, and teach wives housekeeping skills. Employing probation in nonsupport cases also led to more revenue captured by nonsupporting spouses.
Idaho Supreme Court
Q5987471 EXACT TITLE 0.950
QID OVERLAP: Q5987471 in police_law_enforcement (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (5): "chief", "court", "courts", "idaho", "justice". | URL->A (1): http://www.isc.idaho.gov/. | URL->B (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
chiefcourtcourtsidahojustice
The Idaho Supreme Court is the state supreme court of Idaho and is composed of the chief justice and four associate justices. The decisions of the Idaho Supreme Court are binding on all other Idaho state courts.
. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
Women on the Supreme Court The first female justice on the Idaho Supreme Court was Linda Copple Trout, appointed in 1992 by Governor Cecil Andrus and elected in 1996 and 2002. She remains as the state's only female chief justice (1997–2004). The second female justice was Cathy Silak, appointed by Andrus in 1993 and elected in 1994. She lost her reelection bid in 2000 to Dan Eismann and became the first incumbent justice from the court to be defeated since 1944. After Trout's retirement in 2007, no women were on the court until the election of Robyn Brody in 2016 to a vacant seat, the first by a female; she is the only justice on the current court not first appointed. Colleen Zahn joined the court in 2021, appointed by Governor Brad Little; Brody and Zahn ran unopposed in 2022.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in police_law_enforcement (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (12): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in police_law_enforcement: "Treasure Valley". | EXACT TITLE in legal: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Boise State University
Q891082 EXACT TITLE 0.940
QID OVERLAP: Q891082 in police_law_enforcement (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (12): "among", "boise", "business", "college", "education", "idaho", "independent", "program", "public", "school", "total", "university". | EXACT TITLE in police_law_enforcement: "Boise State University".
amongboisebusinesscollegeeducationidahoindependentprogrampublicschooltotaluniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Sixth Amendment to the United States Constitution
Q246624 QID OVERLAP 0.800
QID OVERLAP: Q246624 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (16): "applies", "assistance", "attorney", "cases", "community", "court", "criminal", "defender", "district", "government", "offenses", "prosecutions", "public", "requirement", "requires", "rights".
appliesassistanceattorneycasescommunitycourtcriminaldefenderdistrictgovernmentoffensesprosecutionspublicrequirementrequiresrights
s alleged to have been committed. Under the impartial jury requirement, jurors must remain objective, and the jury must consist of a representative cross-section of the community. The right to a jury applies only to offenses in which the penalty is imprisonment for longer than six months. In Barker v. Wingo, the Supreme Court articulated a balancing test to determine whether a defendant's right to a speedy trial had been violated. It has additionally held that the requirement of a public trial is not absolute and that both the government and the defendant can in some cases request a closed trial. The Sixth Amendment requires that criminal defendants be given notice of the nature and cause of accusations against them. The amendment's Confrontation Clause gives criminal defendants the right to confront and cross-examine witnesses, while the Compulsory Process Clause gives criminal defendants the right to call their own witnesses and, in some cases, compel witnesses to testify. The Assistance of Counsel Clause grants criminal defendants the right to be assisted by counsel. In Gideon v. Wainwright (1963) and subsequent cases, the Supreme Court held that a public defender must be provided to criminal defendants unable to afford an attorney in all state court trials where the defendant faces the possibility of imprisonment.
Criminal defendants have the right to a speedy trial. In Barker v. Wingo, 407 U.S. 514 (1972), the Supreme Court laid down a four-part case-by-case balancing test for determining whether the defendant's speedy trial right has been violated. The four factors are: Length of delay. The Court did not explicitly rule that any absolute time limit applies. However, it gave the example that the delay for "ordinary street crime is considerably less than for a serious, complex conspiracy charge." Reason for the delay. The prosecution may not excessively delay the trial for its own advantage, but a trial may be delayed to secure the presence of an absent witness or other practical considerations (e.g., change of venue). Time and manner in which the defendant has asserted his right. If a defendant agrees to the delay when it works to his own benefit, he cannot later claim he has been unduly delayed. Degree of prejudice to the defendant which the delay has caused. In Strunk v. United States, 412 U.S. 434 (1973), the Supreme Court ruled that if the reviewing court finds that a defendant's right to a speedy trial was violated, then the indictment must be dismissed and any conviction overturned. The Court held that, since the delayed trial is the state action which violates the defendant's rights, no other remedy would be appropriate.
Sentencing In Apprendi v. New Jersey, 530 U.S. 466 (2000), and Blakely v. Washington, 542 U.S. 296 (2004), the Supreme Court ruled that a criminal defendant has a right to a jury trial not only on the question of guilt or innocence, but also regarding any fact used to increase the defendant's sentence beyond the maximum otherwise allowed by statutes or sentencing guidelines. In Alleyne v. United States, 570 U.S. 99 (2013), the Court expanded on Apprendi and Blakely by ruling that a defendant's right to a jury applies to any fact that would increase a defendant's sentence beyond the minimum otherwise required by statute. In United States v. Haymond, 588 U.S.
Parole
Q5357120 EXACT TITLE 0.800
QID OVERLAP: Q5357120 in police_law_enforcement (tier:evergreen) and legal (tier:berry). | SHARED TOKENS (5): "associated", "form", "outside", "serving", "system". | EXACT TITLE in police_law_enforcement: "Parole".
associatedformoutsideservingsystem
in the United States, people may shorten their time on parole through earned compliance credits. Originating from the French word parole ('speech, spoken words' but also 'promise'), the term became associated during the Middle Ages with the release of prisoners who gave their word. This differs greatly from pardon, amnesty or commutation of sentence in that parolees are still considered to be serving their sentences, and may be returned to prison if they violate the conditions of their parole.
Parole, also known as provisional release, supervised release, or being on paper, is a form of early release of a prison inmate where the prisoner agrees to abide by behavioral conditions, including checking in with their designated parole officers, or else they may be rearrested and returned to prison. Parole is not an additional sentence; rather it is a system that allows inmates to finish their original sentence outside of prison under supervision. In some jurisdictions in the United States, people may shorten their time on parole through earned compliance credits. Originating from the French word parole ('speech, spoken words' but also 'promise'), the term became associated during the Middle Ages with the release of prisoners who gave their word. This differs greatly from pardon, amnesty or commutation of sentence in that parolees are still considered to be serving their sentences, and may be returned to prison if they violate the conditions of their parole.
History The practice of paroling enemy troops began thousands of years ago, at least as early as the time of Carthage. Parole allowed the prisoners' captors to avoid the burdens of having to feed and care for them while still avoiding having the prisoners rejoin their old ranks once released; it could also allow the captors to recover their own men in a prisoner exchange. Hugo Grotius, an early international lawyer, favorably discussed prisoner of war parole. During the American Civil War, both the Dix–Hill Cartel and the Lieber Code set out rules regarding prisoner of war parole. Francis Lieber's thoughts on parole later reappeared in the Declaration of Brussels of 1874, the Hague Convention, and the Geneva Convention Relative to the Treatment of Prisoners of War. Alexander Maconochie, a Scottish geographer and captain in the Royal Navy, introduced the modern idea of parole when, in 1840, he was appointed superintendent of the British penal colonies in Norfolk Island, Australia. He developed a plan to prepare them for eventual return to society that involved three grades. The first two consisted of promotions earned through good behaviour, labour, and study. The third grade in the system involved conditional liberty outside of prison while obeying rules. A violation would return them to prison and they would start all over again through the ranks of the three-grade process. He reformed its ticket of leave system, instituting what many consider to be the world's first parole system. Prisoners served indeterminate sentences from which they could be released early if they showed evidence of rehabilitation through participation in a graded classification system based on a unit of exchange called a mark. Prisoners earned marks through good behavior, lost them through bad behavior, and could spend them on passage to higher classification statuses ultimately conveying freedom.
Identity theft
Q471880 QID OVERLAP 0.800
QID OVERLAP: Q471880 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (22): "access", "actions", "benefits", "chief", "data", "date", "financial", "full", "government", "largest", "office", "officer", "online", "program", "records", "report", "resources", "responsible", "security", "technology"....
accessactionsbenefitschiefdatadatefinancialfullgovernmentlargestofficeofficeronlineprogramrecordsreportresourcesresponsiblesecuritytechnologyuniversityvictims
date of birth, social security number, driver's license number, bank account or credit card numbers, PINs, electronic signatures, fingerprints, passwords, or any other information that can be used to access a person's financial resources. Determining the link between data breaches and identity theft is challenging, primarily because identity theft victims often do not know how their personal information was obtained. According to a report done for the FTC, identity theft is not always detectable by the individual victims. Identity fraud is often but not necessarily the consequence of identity theft. Someone can steal or misappropriate personal information without then committing identity theft using the information about every person, such as when a major data breach occurs. A U.S. Government Accountability Office study determined that "most breaches have not resulted in detected incidents of identity theft". The report also warned that "the full extent is unknown". A later unpublished study by Carnegie Mellon University noted that "Most often, the causes of identity theft is not known" but reported that someone else concluded that "the probability of becoming a victim to identity theft as a result of a data breach is ... around only 2%". For example, in a data breach involving the theft of payment card information, involving four million records and at the time one of the largest data breaches ever, the company claimed the breach resulted in only about 1,800 instances of identity theft. An October 2010 article entitled "Cyber Crime Made Easy" explained the level to which hackers are using malicious software. As Gunter Ollmann, Chief Technology Officer of security at Microsoft, said, "Interested in credit card theft? There's an app for that." This statement summed up the ease with which these hackers are accessing all kinds of information online. The new program for infecting users' computers was called Zeus, and the program is so hacker-friendly that even an inexperienced hacker can operate it. Although the hacking program is easy to use, that fact does not diminish the devastating effects that Zeus (or other software like Zeus) can do on a computer and the user. For example, programs like Zeus can steal credit card information, important documents, and even documents necessary for homeland security. If a hacker were to gain this information, it would mean nationwide identity theft or even a possible terrorist attack.
s Gunter Ollmann, Chief Technology Officer of security at Microsoft, said, "Interested in credit card theft? There's an app for that." This statement summed up the ease with which these hackers are accessing all kinds of information online. The new program for infecting users' computers was called Zeus, and the program is so hacker-friendly that even an inexperienced hacker can operate it. Although the hacking program is easy to use, that fact does not diminish the devastating effects that Zeus (or other software like Zeus) can do on a computer and the user. For example, programs like Zeus can steal credit card information, important documents, and even documents necessary for homeland security. If a hacker were to gain this information, it would mean nationwide identity theft or even a possible terrorist attack.
Identity protection by organizations In their May 1998 testimony before the United States Senate, the Federal Trade Commission (FTC) discussed the sale of Social Security numbers and other personal identifiers by credit-raters and data miners. The FTC agreed to the industry's self-regulating principles restricting access to information on credit reports. According to the industry, the restrictions vary according to the category of customer. Credit reporting agencies gather and disclose personal and credit information to a wide business client base. Poor stewardship of personal data by organizations, resulting in unauthorized access to sensitive data, can expose individuals to the risk of identity theft. The Privacy Rights Clearinghouse has documented over 900 individual data breaches by US companies and government agencies since January 2005, which together have involved over 200 million total records containing sensitive personal information, many containing social security numbers.
Fifth Amendment to the United States Constitution
Q240340 QID OVERLAP 0.800
QID OVERLAP: Q240340 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (20): "applies", "compensation", "constitutional", "court", "criminal", "custody", "federal", "felonies", "government", "life", "local", "offense", "police", "property", "protection", "public", "requirement", "requires", "rights", "serve".
appliescompensationconstitutionalcourtcriminalcustodyfederalfeloniesgovernmentlifelocaloffensepolicepropertyprotectionpublicrequirementrequiresrightsserve
dment, the Fifth Amendment includes a due process clause stating that no person shall "be deprived of life, liberty, or property, without due process of law". The Fifth Amendment's Due Process Clause applies to the federal government, while the Fourteenth Amendment's Due Process Clause applies to state governments (and by extension, local governments). The Supreme Court has interpreted the Fifth Amendment's Due Process Clause to provide two main protections: procedural due process, which requires government officials to follow fair procedures before depriving a person of life, liberty, or property, and substantive due process, which protects certain fundamental rights from government interference.
be deprived of life, liberty, or property, without due process of law". The Fifth Amendment's Due Process Clause applies to the federal government, while the Fourteenth Amendment's Due Process Clause applies to state governments (and by extension, local governments). The Supreme Court has interpreted the Fifth Amendment's Due Process Clause to provide two main protections: procedural due process, which requires government officials to follow fair procedures before depriving a person of life, liberty, or property, and substantive due process, which protects certain fundamental rights from government interference.
Currently, federal law permits the trial of misdemeanors without indictments. Additionally, in trials of non-capital felonies, the prosecution may proceed without indictments if the defendants waive their Fifth Amendment right. Grand jury indictments may be amended by the prosecution only in limited circumstances. In Ex Parte Bain, 121 U.S. 1 (1887), the Supreme Court held that the indictment could not be changed at all by the prosecution. United States v. Miller, 471 U.S. 130 (1985) partly reversed Ex parte Bain; now, an indictment's scope may be narrowed by the prosecution. Thus, lesser included charges may be dropped, but new charges may not be added. The Grand Jury Clause of the Fifth Amendment does not protect those serving in the armed forces, whether during wartime or peacetime. Members of the state militia called up to serve with federal forces are not protected under the clause either. In O'Callahan v. Parker, 395 U.S. 258 (1969), the Supreme Court held that only charges relating to service may be brought against members of the militia without indictments. As a decision, O'Callahan, however, lived for a limited duration and was more a reflection of Justice William O. Douglas's distrust of presidential power and anger at the Vietnam Conflict. O'Callahan was overturned in 1987, when the Court held that members of the militia in actual service may be tried for any offense without indictments. The grand jury indictment clause of the Fifth Amendment has not been incorporated under the Fourteenth Amendment. This means the grand jury requirement applies only to felony charges in the federal court system. While many states do employ grand juries, no defendant has a Fifth Amendment right to a grand jury for criminal charges in state court.
Fourth Amendment to the United States Constitution
Q231304 QID OVERLAP 0.780
QID OVERLAP: Q231304 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (14): "address", "court", "criminal", "established", "federal", "government", "history", "issues", "legal", "local", "physical", "property", "rights", "search".
addresscourtcriminalestablishedfederalgovernmenthistoryissueslegallocalphysicalpropertyrightssearch
tant or not). Fourth Amendment case law deals with three main issues: what government activities are "searches" and "seizures", whether a particular search and/or seizure was unreasonable, and how to address violations of Fourth Amendment rights. Early court decisions limited the amendment's scope to physical intrusion of property or persons, but with Katz v. United States (1967), the Supreme Court held that its protections extend to intrusions on the privacy of individuals as well as to physical locations. A warrant is needed for most search and seizure activities, but the Court has carved out a series of exceptions for consent searches, motor vehicle searches, evidence in plain view, exigent circumstances, border searches, and other situations. The exclusionary rule is one way the amendment is enforced. Established in Weeks v. United States (1914), this rule holds that evidence obtained as a result of a Fourth Amendment violation is generally inadmissible at criminal trials. Evidence discovered as a later result of an illegal search may also be inadmissible as "fruit of the poisonous tree". The exception is if it inevitably would have been discovered by legal means. The Fourth Amendment was introduced in Congress in 1789 by James Madison, along with the other amendments in the Bill of Rights, in response to Anti-Federalist objections to the new Constitution. Congress submitted the amendment to the states on September 28, 1789. By December 15, 1791, the necessary three-fourths of the states had ratified it. On March 1, 1792, Secretary of State Thomas Jefferson announced that it was officially part of the Constitution. Because the Bill of Rights did not initially apply to state or local governments, and federal criminal investigations were less common in the first century of the nation's history, there is little significant case law for the Fourth Amendment before the 20th century. The amendment was held to apply to state and local governments in Mapp v.
Fourth Amendment case law deals with three central issues: what government activities constitute "search" and "seizure;" what constitutes probable cause for these actions; how violations of Fourth Amendment rights should be addressed. The text of the amendment is brief, and most of the law determining what constitutes an unlawful search and seizure is found in court rulings. The brief definitions of the terms "search" and "seizure" was concisely summarized in United States v.
to address violations of Fourth Amendment rights. Early court decisions limited the amendment's scope to physical intrusion of property or persons, but with Katz v. United States (1967), the Supreme Court held that its protections extend to intrusions on the privacy of individuals as well as to physical locations. A warrant is needed for most search and seizure activities, but the Court has carved out a series of exceptions for consent searches, motor vehicle searches, evidence in plain view, exigent circumstances, border searches, and other situations. The exclusionary rule is one way the amendment is enforced. Established in Weeks v. United States (1914), this rule holds that evidence obtained as a result of a Fourth Amendment violation is generally inadmissible at criminal trials. Evidence discovered as a later result of an illegal search may also be inadmissible as "fruit of the poisonous tree". The exception is if it inevitably would have been discovered by legal means. The Fourth Amendment was introduced in Congress in 1789 by James Madison, along with the other amendments in the Bill of Rights, in response to Anti-Federalist objections to the new Constitution. Congress submitted the amendment to the states on September 28, 1789. By December 15, 1791, the necessary three-fourths of the states had ratified it. On March 1, 1792, Secretary of State Thomas Jefferson announced that it was officially part of the Constitution. Because the Bill of Rights did not initially apply to state or local governments, and federal criminal investigations were less common in the first century of the nation's history, there is little significant case law for the Fourth Amendment before the 20th century. The amendment was held to apply to state and local governments in Mapp v.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "idaho", "interstate", "meridian", "nampa", "population", "principal", "student", "university", "western".
boisecanyoncollegeidahointerstatemeridiannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (11): "ada", "boise", "district", "idaho", "jurisdiction", "largest", "local", "pacific", "population", "range", "washington".
adaboisedistrictidahojurisdictionlargestlocalpacificpopulationrangewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Criminal record
Q1070100 QID OVERLAP 0.700
QID OVERLAP: Q1070100 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (10): "cases", "court", "criminal", "history", "national", "offenses", "police", "records", "resulting", "traffic".
casescourtcriminalhistorynationaloffensespolicerecordsresultingtraffic
criminal convictions history. The information included in a criminal record, and the existence of a criminal record, varies between countries and even between jurisdictions within a country. In most cases it lists all non-expunged criminal offences and may also include traffic offences such as speeding and drunk driving. In most countries, a criminal record is limited to unexpunged and unexpired actual convictions (where the individual has pleaded guilty or been found guilty by a qualified court, resulting in the entry of a conviction), while in some it can also include arrests, charges dismissed, charges pending and charges of which the individual has been acquitted. A criminal history may be relevant for international travel, and for the charging and sentencing of persons who commit additional criminal offenses. They are also used by potential employers, lenders, and others to assess a person's trustworthiness. Criminal records may also be stored on national databases or crime information centers, where they can be viewed internationally via Interpol.
a) Penal convictions for all types of offence; b) Penal convictions of guilt subjecting the convicted person to a probationary period; c) Decisions of revocation of the previous category; d) Penal decisions concerning confinement of mentally ill offenders; e) Deprivation of parental rights, and reintegration, as well as several measures regarding delinquent minors; f) Several decisions which quash prior judgements; g) Several decisions of retraction; h) Decisions that rectify or interpret the law on which the conviction has been decided; i) Decisions of rehabilitation; j) Decisions of pardon; k) Decisions of release on parole; l) Decisions from foreign jurisdictions regarding Belgian citizens; m) Sentences accompanying a main sentence, subsidiary sentences, 'security measures', and deferred sentences There is no record of dismissed cases or verdicts of not guilty. To access their own criminal record, a person can seek it from their local police authority or send a written request to the Federal Public Service Justice.
For life imprisonment without substitution or life imprisonment: 20 years For imprisonment of over 10 years: 15 years Imprisonment between 3 and 10 years: 10 years Imprisonment between of less than 3 years: 5 years All remaining cases: 2 years Canada In Canada, criminal records are stored in Criminal Records Information Management Services, a centralized database operated by the Royal Canadian Mounted Police under the Canadian Police Information Centre (CPIC) since 1972.
Boise, Idaho
Q35775 QID OVERLAP 0.700
QID OVERLAP: Q35775 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (10): "ada", "annual", "boise", "counties", "idaho", "population", "river", "technology", "treasure", "valley".
adaannualboisecountiesidahopopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Garden City, Idaho
Q1516892 QID OVERLAP 0.640
QID OVERLAP: Q1516892 in police_law_enforcement (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (7): "ada", "boise", "government", "idaho", "municipal", "population", "separate".
adaboisegovernmentidahomunicipalpopulationseparate
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "cities", "idaho", "meridian", "population".
adaamongboisecitiesidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in police_law_enforcement (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.620
QID OVERLAP: Q849592 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "college", "idaho", "population".
boisecaldwellcanyoncollegeidahopopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in police_law_enforcement (tier:branch) and legal (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Driving under the influence
Q250062 QID OVERLAP 0.560
QID OVERLAP: Q250062 in police_law_enforcement (tier:branch) and legal (tier:berry). | SHARED TOKENS (3): "drug", "offense", "operating".
drugoffenseoperating
ile intoxicated (DWI) is the crime of driving, operating, or being in control of a vehicle while one is impaired from doing so safely by the effect of either alcohol (see drunk driving) or some other drug, whether recreational or prescription (see drug-impaired driving). Multiple other terms are used for the offense in various jurisdictions. Terminology The name of the offense varies from jurisdiction to jurisdiction and from legal to colloquial terminology. In various jurisdictions the offense is termed "driving under the influence" [of alcohol or other drugs] (DUI), "driving under the influence of intoxicants" (DUII), "driving while impaired" (DWI), "impaired driving", "driving while intoxicated" (DWI), "operating while intoxicated" (OWI), "operating under the influence" (OUI), "operating [a] vehicle under the influence" (OVI), "drunk in charge" (DIC), or "over the prescribed limit" (OPL) (in the UK). Alcohol-related DUI is referred to as "drunk driving", "drunken driving", or "drinking and driving" (US), or "drink-driving" (UK/Ireland/Australia).
Terminology The name of the offense varies from jurisdiction to jurisdiction and from legal to colloquial terminology. In various jurisdictions the offense is termed "driving under the influence" [of alcohol or other drugs] (DUI), "driving under the influence of intoxicants" (DUII), "driving while impaired" (DWI), "impaired driving", "driving while intoxicated" (DWI), "operating while intoxicated" (OWI), "operating under the influence" (OUI), "operating [a] vehicle under the influence" (OVI), "drunk in charge" (DIC), or "over the prescribed limit" (OPL) (in the UK). Alcohol-related DUI is referred to as "drunk driving", "drunken driving", or "drinking and driving" (US), or "drink-driving" (UK/Ireland/Australia).
Drunk driving (or drink-driving in British English) is the act of driving under the influence of alcohol. A small increase in the blood alcohol content increases the relative risk of a motor vehicle crash. In the United States, alcohol is involved in 30% of all traffic fatalities.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
280 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP280 edges
🌲 EVERGREEN3 edges
0.630
agenciesattorneyconsumerelectedenforcementgeneralidaholegallocalofficepropertyprotectionrepresentationunion
SHARED TOKENS (14): "agencies", "attorney", "consumer", "elected", "enforcement", "general", "idaho", "legal", "local", "office", "property", "protection", "representation", "union". | URL->B (2): http://www.isb.idaho.gov/, http://www.ag.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho Attorney General".
0.630
adaboisecommercialcommissiondepartmentgeneralidahonationalofficeroperatesprotectionrightssupportwestern
SHARED TOKENS (14): "ada", "boise", "commercial", "commission", "department", "general", "idaho", "national", "officer", "operates", "protection", "rights", "support", "western". | URL->A (1): http://www.iflyboise.com/. | EXACT TITLE in police_law_enforcement: "Boise Airport".
0.610
boisecommunitydepartmentdistrictsenforcementheadquartersidahomeridianofficerofficesoperatesstandardstraining
SHARED TOKENS (13): "boise", "community", "department", "districts", "enforcement", "headquarters", "idaho", "meridian", "officer", "offices", "operates", "standards", "training". | URL->A (1): https://www.idoc.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho Department of Correction".
🌿 BRANCH160 edges
0.570
courtdepartmentenforcementidaholegislaturemunicipalordersorganizationpolicepublicstatewide
SHARED TOKENS (11): "court", "department", "enforcement", "idaho", "legislature", "municipal", "orders", "organization", "police", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho State Police".
0.500
Arbitration ↗ Q207946 EXACT TITLE
commercialconsumercontextcourtcourtsdisputesemploymententityformjudiciallocalmandatorymattersproceedingsreviewrights
SHARED TOKENS (16): "commercial", "consumer", "context", "court", "courts", "disputes", "employment", "entity", "form", "judicial", "local", "mandatory", "matters", "proceedings", "review", "rights". | EXACT TITLE in legal: "Arbitration".
0.500
Police ↗ Q35535 EXACT TITLE
associatedcivilcomplexcontextdecadesdefensedepartmentenforcementitselflegalmembersnationaloldestorganizationspolicepowerpropertyprotectionpublicsafety
SHARED TOKENS (23): "associated", "civil", "complex", "context", "decades", "defense", "department", "enforcement", "itself", "legal", "members", "national", "oldest", "organizations", "police", "power", "property", "protection", "public", "safety".... | EXACT TITLE in police_law_enforcement: "Police". | EXACT TITLE in legal: "Police".
0.500
Corporation ↗ Q167037 EXACT TITLE
businesscontextentityestablishedjurisdictionlegallegislativelegislaturelocalofficeofficerpracticepublicrecognizedregistrationservesingleworkers
SHARED TOKENS (18): "business", "context", "entity", "established", "jurisdiction", "legal", "legislative", "legislature", "local", "office", "officer", "practice", "public", "recognized", "registration", "serve", "single", "workers". | EXACT TITLE in legal: "Corporation".
0.500
civilcourtenforcementgovernsissuesjurisdictionlandlegalpropertypublicrealrelationshipsrightsseparatetrust
SHARED TOKENS (15): "civil", "court", "enforcement", "governs", "issues", "jurisdiction", "land", "legal", "property", "public", "real", "relationships", "rights", "separate", "trust". | EXACT TITLE in legal: "Property law".
0.500
adaboisecanyoncitiescountiesidaholargestmeridianmetronampapacificpopulationseattletotaltreasurevalley
SHARED TOKENS (16): "ada", "boise", "canyon", "cities", "counties", "idaho", "largest", "meridian", "metro", "nampa", "pacific", "population", "seattle", "total", "treasure", "valley". | EXACT TITLE in police_law_enforcement: "Boise metropolitan area".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetsbusinesscourtcriminalentityestablishedfederalgovernedjurisdictionlegallifeoffensespropertypublicrequiressingletrust
SHARED TOKENS (17): "assets", "business", "court", "criminal", "entity", "established", "federal", "governed", "jurisdiction", "legal", "life", "offenses", "property", "public", "requires", "single", "trust". | EXACT TITLE in police_law_enforcement: "Trust (law)". | EXACT TITLE in legal: "Trust (law)".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongclaimsdisclosureformsindustriallegalminimumnationalorganizationpropertyprotectionpublicrightstechnologytrade
SHARED TOKENS (16): "agreements", "among", "claims", "disclosure", "forms", "industrial", "legal", "minimum", "national", "organization", "property", "protection", "public", "rights", "technology", "trade". | EXACT TITLE in legal: "Patent".
0.500
authoritydatadepartmentenforcementfederalgovernmentheadquarteredlocalpartnersprimaryregulatoryresponsiblesecurityspecialistssystem
SHARED TOKENS (15): "authority", "data", "department", "enforcement", "federal", "government", "headquartered", "local", "partners", "primary", "regulatory", "responsible", "security", "specialists", "system". | EXACT TITLE in police_law_enforcement: "Transportation Security Administration".
0.500
communitydepartmentdomesticdrugenforcementestablishedfederalgovernmentjurisdictionjusticeleadnationaloperationsprotectionreportsresponsible
SHARED TOKENS (16): "community", "department", "domestic", "drug", "enforcement", "established", "federal", "government", "jurisdiction", "justice", "lead", "national", "operations", "protection", "reports", "responsible". | EXACT TITLE in police_law_enforcement: "Drug Enforcement Administration".
0.500
Complaint ↗ Q836925 EXACT TITLE
associatedauthoritycasescivilcourtcourtscriminaldefensefactsfederalgovernjusticelegallitigationmisdemeanorpolicepowerprosecutorstatutessupport
SHARED TOKENS (20): "associated", "authority", "cases", "civil", "court", "courts", "criminal", "defense", "facts", "federal", "govern", "justice", "legal", "litigation", "misdemeanor", "police", "power", "prosecutor", "statutes", "support". | EXACT TITLE in police_law_enforcement: "Complaint".
0.500
casesclaimsfactsfamilylandlegalpropertypublicrealregistrationrequiredrightsservesstatutestitle
SHARED TOKENS (15): "cases", "claims", "facts", "family", "land", "legal", "property", "public", "real", "registration", "required", "rights", "serves", "statutes", "title". | EXACT TITLE in police_law_enforcement: "Title (property)". | EXACT TITLE in legal: "Title (property)".
0.500
assetscannotcaseschildcommissioncomplexcriminaldatadeathdepartmentfamilylegalnationalorganizationspolicepostresulting
SHARED TOKENS (17): "assets", "cannot", "cases", "child", "commission", "complex", "criminal", "data", "death", "department", "family", "legal", "national", "organizations", "police", "post", "resulting". | EXACT TITLE in police_law_enforcement: "Missing person".
0.500
businesscommercialcommunityconductdeathemployeesenvironmentfinancialgovernancegovernslegalmarketmattersorganizationspracticerelationsrightssystem
SHARED TOKENS (18): "business", "commercial", "community", "conduct", "death", "employees", "environment", "financial", "governance", "governs", "legal", "market", "matters", "organizations", "practice", "relations", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.500
analysiscasescivilcriminaldatadefenseemployeesfinancialfirearmsfirmsgovernedgovernmentlegalprosecutionstandardssupportwork
SHARED TOKENS (17): "analysis", "cases", "civil", "criminal", "data", "defense", "employees", "financial", "firearms", "firms", "governed", "government", "legal", "prosecution", "standards", "support", "work". | EXACT TITLE in police_law_enforcement: "Forensic science".
0.500
appellateauthoritycannotcasescivilcourtcourtsdisputesestablishedfactsfinalissuesitselfjurisdictionlegalpowerproceedingsreviewsystem
SHARED TOKENS (19): "appellate", "authority", "cannot", "cases", "civil", "court", "courts", "disputes", "established", "facts", "final", "issues", "itself", "jurisdiction", "legal", "power", "proceedings", "review", "system". | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
beyondconsumerdefensedepartmentemploymentfeegrowthimmigrationknowledgeleadminimumphysicalprogramregulationrequiredrequiressecurityspecialtytotalwage
SHARED TOKENS (21): "beyond", "consumer", "defense", "department", "employment", "fee", "growth", "immigration", "knowledge", "lead", "minimum", "physical", "program", "regulation", "required", "requires", "security", "specialty", "total", "wage".... | EXACT TITLE in legal: "H-1B visa".
0.500
agenciesaidcontactdepartmentemployeeslifemedicalmembersprimarypublicresourcesretainsearchsupporttraining
SHARED TOKENS (15): "agencies", "aid", "contact", "department", "employees", "life", "medical", "members", "primary", "public", "resources", "retain", "search", "support", "training". | EXACT TITLE in police_law_enforcement: "Emergency medical services".
0.500
Assault ↗ Q365680 EXACT TITLE
civilcontactcriminaldeathlegalmisdemeanoroffenseoffensesofficerphysicalpoliceprosecutionrangeseparatesexualsinglesystemviolence
SHARED TOKENS (18): "civil", "contact", "criminal", "death", "legal", "misdemeanor", "offense", "offenses", "officer", "physical", "police", "prosecution", "range", "separate", "sexual", "single", "system", "violence". | EXACT TITLE in police_law_enforcement: "Assault". | EXACT TITLE in legal: "Assault".
0.500
Lawyer ↗ Q40348 EXACT TITLE
educationinterestsjurisdictionknowledgelawyerslegalmatterspracticeprofessionalrangerequiredrightssystemtrainingwork
SHARED TOKENS (15): "education", "interests", "jurisdiction", "knowledge", "lawyers", "legal", "matters", "practice", "professional", "range", "required", "rights", "system", "training", "work". | EXACT TITLE in police_law_enforcement: "Lawyer". | EXACT TITLE in legal: "Lawyer".
0.500
annualcriminaldepartmentemployeesenforcementfederalfirearmsinterstatejusticelicensinglocaloffensesoperatesproductsproject
SHARED TOKENS (15): "annual", "criminal", "department", "employees", "enforcement", "federal", "firearms", "interstate", "justice", "licensing", "local", "offenses", "operates", "products", "project". | EXACT TITLE in police_law_enforcement: "Bureau of Alcohol, Tobacco, Firearms and Explosives".
0.500
annualassociationboisebusinesscollegeeducationemploymentestablishedexpansionfullidaholegislaturenewsprogrampropertypublicreportresourcesschooltechnology
SHARED TOKENS (21): "annual", "association", "boise", "business", "college", "education", "employment", "established", "expansion", "full", "idaho", "legislature", "news", "program", "property", "public", "report", "resources", "school", "technology".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
Cybercrime ↗ Q29137 EXACT TITLE
accessactionscriminaldatafinancialnetworkonlineorganizationsorganizedprosecutionrangerealreportreportssystem
SHARED TOKENS (15): "access", "actions", "criminal", "data", "financial", "network", "online", "organizations", "organized", "prosecution", "range", "real", "report", "reports", "system". | EXACT TITLE in police_law_enforcement: "Cybercrime".
0.500
Court ↗ Q41487 EXACT TITLE
administrativeappellateauthoritycivilcourtcourtscriminaldisputesentityestablishedgovernmentjudicialjurisdictionjusticelegallegislaturematterspower
SHARED TOKENS (18): "administrative", "appellate", "authority", "civil", "court", "courts", "criminal", "disputes", "entity", "established", "government", "judicial", "jurisdiction", "justice", "legal", "legislature", "matters", "power". | EXACT TITLE in police_law_enforcement: "Court". | EXACT TITLE in legal: "Court".
0.500
agreementscommercialdecadesenforcementformformslaborlegalnationalorganizationsrightssexualsingletradevictims
SHARED TOKENS (15): "agreements", "commercial", "decades", "enforcement", "form", "forms", "labor", "legal", "national", "organizations", "rights", "sexual", "single", "trade", "victims". | EXACT TITLE in police_law_enforcement: "Human trafficking".
0.500
agenciesattorneyauthoritycitiescollectioncommunityconductcriminaldepartmentdomesticenforcementestablishedfederalgeneralgovernmentheadquartersjurisdictionjusticelegalnational
SHARED TOKENS (32): "agencies", "attorney", "authority", "cities", "collection", "community", "conduct", "criminal", "department", "domestic", "enforcement", "established", "federal", "general", "government", "headquarters", "jurisdiction", "justice", "legal", "national".... | EXACT TITLE in police_law_enforcement: "Federal Bureau of Investigation".
0.500
Mediation ↗ Q223871 EXACT TITLE
agreementsamongassistanceauthoritycivilcommercialdisputesformformsindependentinterestsissueslegallicensingpracticeprofessionaltraining
SHARED TOKENS (17): "agreements", "among", "assistance", "authority", "civil", "commercial", "disputes", "form", "forms", "independent", "interests", "issues", "legal", "licensing", "practice", "professional", "training". | EXACT TITLE in legal: "Mediation".
0.500
amongbenefitscompensationemployeesemploymentformgeneralinsurancemandatorymedicaloutsidesecuritysystemwageworkers
SHARED TOKENS (15): "among", "benefits", "compensation", "employees", "employment", "form", "general", "insurance", "mandatory", "medical", "outside", "security", "system", "wage", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.500
Snake River ↗ EXACT TITLE
agenciescanyoncommercialconstructiondecadeseasternhistoryidaholargelargestnationalpacificpublicriverterritorytribalvalleywashingtonwestern
SHARED TOKENS (19): "agencies", "canyon", "commercial", "construction", "decades", "eastern", "history", "idaho", "large", "largest", "national", "pacific", "public", "river", "territory", "tribal", "valley", "washington", "western". | EXACT TITLE in legal: "Snake River".
0.500
agenciesattorneychilddepartmentenforcementfederaljusticelocalnationalnetworkofficeorganizedprogramresourcessexualtechnologyvictims
SHARED TOKENS (17): "agencies", "attorney", "child", "department", "enforcement", "federal", "justice", "local", "national", "network", "office", "organized", "program", "resources", "sexual", "technology", "victims". | EXACT TITLE in police_law_enforcement: "Internet Crimes Against Children Task Force".
0.500
Contract ↗ Q93288 EXACT TITLE
adoptionagreementsbusinesscivilcodecommercialdatedoctrineenforcementframeworkgeneralgovernedindependentjudiciallegallitigationnationalpracticerightstrade
SHARED TOKENS (20): "adoption", "agreements", "business", "civil", "code", "commercial", "date", "doctrine", "enforcement", "framework", "general", "governed", "independent", "judicial", "legal", "litigation", "national", "practice", "rights", "trade". | EXACT TITLE in police_law_enforcement: "Contract". | EXACT TITLE in legal: "Contract".
0.500
agenciesagreementsbranchcompensationdevelopmentenforcementenvironmentgrowthissuesjudicialjurisdictionlegalnationalorganizationsprotectionregulatoryresourceresourcesrightssafety
SHARED TOKENS (22): "agencies", "agreements", "branch", "compensation", "development", "enforcement", "environment", "growth", "issues", "judicial", "jurisdiction", "legal", "national", "organizations", "protection", "regulatory", "resource", "resources", "rights", "safety".... | EXACT TITLE in legal: "Environmental law".
0.500
adoptionappliesassetsbranchbusinesscivilcodecommercialconductconsumerdistrictdrugemploymentfinancefinancialfoodframeworkgeneralgoverninsurance
SHARED TOKENS (44): "adoption", "applies", "assets", "branch", "business", "civil", "code", "commercial", "conduct", "consumer", "district", "drug", "employment", "finance", "financial", "food", "framework", "general", "govern", "insurance".... | EXACT TITLE in legal: "Commercial law".
0.500
assetsassistanceattorneycivilcourtcriminaldepartmentdistrictdistrictsenforcementestablishedfederalgeneralgovernmenthistoryjudicialjusticenationalofficeoperates
SHARED TOKENS (28): "assets", "assistance", "attorney", "civil", "court", "criminal", "department", "district", "districts", "enforcement", "established", "federal", "general", "government", "history", "judicial", "justice", "national", "office", "operates".... | EXACT TITLE in police_law_enforcement: "United States Marshals Service".
0.500
adaboisecanyoncollegecommunitycountiesdevelopmenteasterneducationelectedgovernedidaholargenampapopulationprimarypublicresidentssouthweststudent
SHARED TOKENS (23): "ada", "boise", "canyon", "college", "community", "counties", "development", "eastern", "education", "elected", "governed", "idaho", "large", "nampa", "population", "primary", "public", "residents", "southwest", "student".... | EXACT TITLE in police_law_enforcement: "College of Western Idaho".
0.500
aidassistancecannotcasescourtcriminaldefenderestablishedfederalfullgovernmentlawyerslegalofficepublicrepresentationrequires
SHARED TOKENS (17): "aid", "assistance", "cannot", "cases", "court", "criminal", "defender", "established", "federal", "full", "government", "lawyers", "legal", "office", "public", "representation", "requires". | EXACT TITLE in police_law_enforcement: "Public defender". | EXACT TITLE in legal: "Public defender".
0.500
caseschildcivilcollectioncouncilcustodydevelopmentenforcementfamilyfinancialjurisdictionmaintenanceminimumpayprimaryrecognizedrequiredrequiresreviewrights
SHARED TOKENS (23): "cases", "child", "civil", "collection", "council", "custody", "development", "enforcement", "family", "financial", "jurisdiction", "maintenance", "minimum", "pay", "primary", "recognized", "required", "requires", "review", "rights".... | EXACT TITLE in legal: "Child support".
0.480
Divorce ↗ Q93190 EXACT TITLE
accessauthoritychildcivilcourtcustodyissueslegalpropertyrequiredrequiressexualsupportunion
SHARED TOKENS (14): "access", "authority", "child", "civil", "court", "custody", "issues", "legal", "property", "required", "requires", "sexual", "support", "union". | EXACT TITLE in legal: "Divorce".
0.480
agenciescourtscriminaldefensegovernmentinstitutionsjusticelawyerspoliceprimaryprosecutionsupportsystemvictims
SHARED TOKENS (14): "agencies", "courts", "criminal", "defense", "government", "institutions", "justice", "lawyers", "police", "primary", "prosecution", "support", "system", "victims". | EXACT TITLE in police_law_enforcement: "Criminal justice".
0.480
amongcommissiondevelopmentestatefinancialgovernmentlegalnationalpropertyrealrightssubdivisionsystemunified
SHARED TOKENS (14): "among", "commission", "development", "estate", "financial", "government", "legal", "national", "property", "real", "rights", "subdivision", "system", "unified". | EXACT TITLE in legal: "Real estate transaction".
0.480
Zoning ↗ Q702232 EXACT TITLE
developmentformgoverngovernmentgrowthindustriallandland-uselocalplanningpropertyregulatoryscalesingle
SHARED TOKENS (14): "development", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "planning", "property", "regulatory", "scale", "single". | EXACT TITLE in police_law_enforcement: "Zoning". | EXACT TITLE in legal: "Zoning".
0.480
Clery Act ↗ Q5131951 EXACT TITLE
aidcivilcodedepartmentdisclosureeducationfederalfinancialinstitutionsrequiressafetysecuritystudentuniversity
SHARED TOKENS (14): "aid", "civil", "code", "department", "disclosure", "education", "federal", "financial", "institutions", "requires", "safety", "security", "student", "university". | EXACT TITLE in police_law_enforcement: "Clery Act".
0.480
agenciesconductdepartmentsemploymentenforcementindependentoversightpolicepublicresponsiblereviewsearchsexualsystem
SHARED TOKENS (14): "agencies", "conduct", "departments", "employment", "enforcement", "independent", "oversight", "police", "public", "responsible", "review", "search", "sexual", "system". | EXACT TITLE in police_law_enforcement: "Police accountability".
0.480
compensationdevelopmentexpandedfeefinalfullgovernmentlandlegalpowerpropertypublictitletotal
SHARED TOKENS (14): "compensation", "development", "expanded", "fee", "final", "full", "government", "land", "legal", "power", "property", "public", "title", "total". | EXACT TITLE in legal: "Eminent domain".
0.480
agenciesauthoritycivilcodedistrictenforcementgovernmentlocalmunicipalofficerpoliceregionalsystemwork
SHARED TOKENS (14): "agencies", "authority", "civil", "code", "district", "enforcement", "government", "local", "municipal", "officer", "police", "regional", "system", "work". | EXACT TITLE in police_law_enforcement: "Code enforcement".
0.470
appellateboisecourtidaholegislatureoperations
SHARED TOKENS (6): "appellate", "boise", "court", "idaho", "legislature", "operations". | URL->B (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.460
attorneysdevelopmentdistricteducationlawyerslegalmaintainmandatoryminimumoutsidepracticeprofessionalrequired
SHARED TOKENS (13): "attorneys", "development", "district", "education", "lawyers", "legal", "maintain", "mandatory", "minimum", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.460
accessadoptionchildcontactcustodydeathfamilyhouseinterestslegalphysicalproceedingsrights
SHARED TOKENS (13): "access", "adoption", "child", "contact", "custody", "death", "family", "house", "interests", "legal", "physical", "proceedings", "rights". | EXACT TITLE in legal: "Child custody".
0.460
Green card ↗ Q6676995 EXACT TITLE
amongattorneycasescriminalfederalformgeneralimmigrationproceedingsregistrationresidentsserveworkers
SHARED TOKENS (13): "among", "attorney", "cases", "criminal", "federal", "form", "general", "immigration", "proceedings", "registration", "residents", "serve", "workers". | EXACT TITLE in legal: "Green card".
0.460
civilcourtcourtsdecadesdisclosureestablishedfederalfilesformprocessingrequiredstandardssystem
SHARED TOKENS (13): "civil", "court", "courts", "decades", "disclosure", "established", "federal", "files", "form", "processing", "required", "standards", "system". | EXACT TITLE in police_law_enforcement: "Digital evidence".
0.460
Real estate ↗ Q684740 EXACT TITLE
businesscommercialentityestategeneralgovernmentlandlegalpropertypublicrealresourceswater
SHARED TOKENS (13): "business", "commercial", "entity", "estate", "general", "government", "land", "legal", "property", "public", "real", "resources", "water". | EXACT TITLE in police_law_enforcement: "Real estate". | EXACT TITLE in legal: "Real estate".
0.460
authoritycasesconstitutionalfederalgovernmentlandlegislativelegislaturepopulationpowerrightsstatutesstatutory
SHARED TOKENS (13): "authority", "cases", "constitutional", "federal", "government", "land", "legislative", "legislature", "population", "power", "rights", "statutes", "statutory". | EXACT TITLE in legal: "Constitutional law".
0.450
agenciescommissioncourtscriminaldepartmentsenforcementfederaljudicialjusticelocalmaintenanceofficesoperatesorderspolicepropertyprotectionpublicreferralsafety
SHARED TOKENS (23): "agencies", "commission", "courts", "criminal", "departments", "enforcement", "federal", "judicial", "justice", "local", "maintenance", "offices", "operates", "orders", "police", "property", "protection", "public", "referral", "safety".... | URL->A (1): https://www.irs.gov/compliance/criminal-investigation.
0.440
Law firm ↗ Q613142 EXACT TITLE
assistancebusinesscasescivilcriminalentitylawyerslegalmatterspracticeprimaryrights
SHARED TOKENS (12): "assistance", "business", "cases", "civil", "criminal", "entity", "lawyers", "legal", "matters", "practice", "primary", "rights". | EXACT TITLE in legal: "Law firm".
0.440
agreementsbenefitscasescivildeathestategovernlegalpropertyrightssupportunion
SHARED TOKENS (12): "agreements", "benefits", "cases", "civil", "death", "estate", "govern", "legal", "property", "rights", "support", "union". | EXACT TITLE in legal: "Prenuptial agreement".
0.440
Probate ↗ Q6500369 EXACT TITLE
assetsclaimscourtcourtsdeathestatejudicialjurisdictionlegalpowerpropertypublic
SHARED TOKENS (12): "assets", "claims", "court", "courts", "death", "estate", "judicial", "jurisdiction", "legal", "power", "property", "public". | EXACT TITLE in legal: "Probate".
0.440
Arrest ↗ Q1403016 EXACT TITLE
casescourtcriminalcustodyenforcementjusticelegalpolicepowerprotectionrequirementsystem
SHARED TOKENS (12): "cases", "court", "criminal", "custody", "enforcement", "justice", "legal", "police", "power", "protection", "requirement", "system". | EXACT TITLE in police_law_enforcement: "Arrest".
0.420
Magistrate ↗ Q4594605 EXACT TITLE
administerscasescivilcourtcriminalgovernmentjudiciallocalmattersofficerresponsible
SHARED TOKENS (11): "administers", "cases", "civil", "court", "criminal", "government", "judicial", "local", "matters", "officer", "responsible". | EXACT TITLE in police_law_enforcement: "Magistrate".
0.420
actionscoversformsonlinepropertyrangereportsafetysecuritysinglevictims
SHARED TOKENS (11): "actions", "covers", "forms", "online", "property", "range", "report", "safety", "security", "single", "victims". | EXACT TITLE in police_law_enforcement: "Internet fraud".
0.420
appellatecasescivilcourtcriminalgeneraljudiciallegalreviewsinglesystem
SHARED TOKENS (11): "appellate", "cases", "civil", "court", "criminal", "general", "judicial", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.420
changescitiesexperiencefamilyformgovernmenthouselegalprimarypublicwork
SHARED TOKENS (11): "changes", "cities", "experience", "family", "form", "government", "house", "legal", "primary", "public", "work". | EXACT TITLE in police_law_enforcement: "Homelessness".
0.400
civilcommissioncompensationconductcriminalestablishedjurisdictionlegislaturepropertysafety
SHARED TOKENS (10): "civil", "commission", "compensation", "conduct", "criminal", "established", "jurisdiction", "legislature", "property", "safety". | EXACT TITLE in police_law_enforcement: "Criminal law".
0.400
SWAT ↗ Q324563 EXACT TITLE
amongannualenforcementfirearmsinterestspoliceschoolsearchservespecial
SHARED TOKENS (10): "among", "annual", "enforcement", "firearms", "interests", "police", "school", "search", "serve", "special". | EXACT TITLE in police_law_enforcement: "SWAT".
0.400
administrativeagenciesenforcementgovernmentlegallocalmunicipalpolicereportsubdivision
SHARED TOKENS (10): "administrative", "agencies", "enforcement", "government", "legal", "local", "municipal", "police", "report", "subdivision". | EXACT TITLE in police_law_enforcement: "Municipal police".
0.380
Immigration law ↗ EXACT TITLE
governmentimmigrationlegalmaintainmattersnationalregulaterightsstatutes
SHARED TOKENS (9): "government", "immigration", "legal", "maintain", "matters", "national", "regulate", "rights", "statutes". | EXACT TITLE in legal: "Immigration law".
0.380
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivildeathlegalpracticepropertyrightsstatutory
SHARED TOKENS (9): "among", "assets", "civil", "death", "legal", "practice", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.380
Tort ↗ Q158970 EXACT TITLE
actionscivilcodecriminalestablishedlegalprosecutionresultingseparate
SHARED TOKENS (9): "actions", "civil", "code", "criminal", "established", "legal", "prosecution", "resulting", "separate". | EXACT TITLE in police_law_enforcement: "Tort".
0.380
Prison ↗ Q40357 EXACT TITLE
authorityformshousejailjusticelargeprimaryservesystem
SHARED TOKENS (9): "authority", "forms", "house", "jail", "justice", "large", "primary", "serve", "system". | EXACT TITLE in police_law_enforcement: "Prison".
0.380
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjurisdictionlegalprofessionalschoolsystemuniversity
SHARED TOKENS (9): "college", "department", "education", "jurisdiction", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.380
constructiondateitselflabornamespropertyrealsecuritytitle
SHARED TOKENS (9): "construction", "date", "itself", "labor", "names", "property", "real", "security", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.380
Evidence ↗ Q1347572 EXACT TITLE
accessassociatedclaimseventsexperiencegeneralknowledgephysicalserve
SHARED TOKENS (9): "access", "associated", "claims", "events", "experience", "general", "knowledge", "physical", "serve". | EXACT TITLE in police_law_enforcement: "Evidence".
0.380
addresscommunityjailofficephysicalpublicrangesafetysystem
SHARED TOKENS (9): "address", "community", "jail", "office", "physical", "public", "range", "safety", "system". | EXACT TITLE in police_law_enforcement: "911 (emergency telephone number)".
0.380
activecriminaldrugissuesjurisdictionorganizationssafetystrongviolence
SHARED TOKENS (9): "active", "criminal", "drug", "issues", "jurisdiction", "organizations", "safety", "strong", "violence". | EXACT TITLE in police_law_enforcement: "Violent crime".
0.380
appellatecivilcourtcourtsfinaljurisdictionlegalreviewsingle
SHARED TOKENS (9): "appellate", "civil", "court", "courts", "final", "jurisdiction", "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.380
amongappliesbackgroundcriminaleducationemploymenthistorysearchsecurity
SHARED TOKENS (9): "among", "applies", "background", "criminal", "education", "employment", "history", "search", "security". | EXACT TITLE in police_law_enforcement: "Background check".
0.380
Creditor ↗ Q157165 EXACT TITLE
assetscourtfinancialgeneralgovernmentorganizationpaypropertysecurity
SHARED TOKENS (9): "assets", "court", "financial", "general", "government", "organization", "pay", "property", "security". | EXACT TITLE in legal: "Creditor".
0.360
communitycriminalmembersorganizedreportresidentssafetysecurity
SHARED TOKENS (8): "community", "criminal", "members", "organized", "report", "residents", "safety", "security". | EXACT TITLE in police_law_enforcement: "Neighborhood watch".
0.360
casesconductentityinjurylegallifemedicalproperty
SHARED TOKENS (8): "cases", "conduct", "entity", "injury", "legal", "life", "medical", "property". | EXACT TITLE in legal: "Personal injury".
0.360
assetscomplexdeathestatelegallifeplanningproperty
SHARED TOKENS (8): "assets", "complex", "death", "estate", "legal", "life", "planning", "property". | EXACT TITLE in legal: "Estate planning".
0.360
cannotdeathinjurylegalmedicalprofessionalrecognizedstandards
SHARED TOKENS (8): "cannot", "death", "injury", "legal", "medical", "professional", "recognized", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.360
datamaintainmaintenancepermitpublicresourcessafetysystem
SHARED TOKENS (8): "data", "maintain", "maintenance", "permit", "public", "resources", "safety", "system". | EXACT TITLE in police_law_enforcement: "Computer-aided dispatch".
0.360
Fraud ↗ Q28813 EXACT TITLE
benefitscasescivilcompensationcriminalitselflegalproperty
SHARED TOKENS (8): "benefits", "cases", "civil", "compensation", "criminal", "itself", "legal", "property". | EXACT TITLE in police_law_enforcement: "Fraud".
0.340
casescivilcommunityestatepropertyseparatesystem
SHARED TOKENS (7): "cases", "civil", "community", "estate", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.340
activecommunitycomplexdepartmentsissuesprofessionalwork
SHARED TOKENS (7): "active", "community", "complex", "departments", "issues", "professional", "work". | EXACT TITLE in police_law_enforcement: "Supportive housing".
0.340
Adoption ↗ Q180472 EXACT TITLE
adoptionchildgovernedlegalrequiresrightsstatutes
SHARED TOKENS (7): "adoption", "child", "governed", "legal", "requires", "rights", "statutes". | EXACT TITLE in police_law_enforcement: "Adoption". | EXACT TITLE in legal: "Adoption".
0.340
Felony ↗ Q178844 EXACT TITLE
civilcourtfelonieslandmisdemeanoroffenseoffenses
SHARED TOKENS (7): "civil", "court", "felonies", "land", "misdemeanor", "offense", "offenses". | EXACT TITLE in legal: "Felony".
0.340
landlegalprimarypropertyrightsstrongtrade
SHARED TOKENS (7): "land", "legal", "primary", "property", "rights", "strong", "trade". | EXACT TITLE in legal: "Intellectual property".
0.340
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentindustriallandlayerleadwater
SHARED TOKENS (7): "beyond", "environment", "industrial", "land", "layer", "lead", "water". | EXACT TITLE in legal: "Aquifer".
0.340
Jury ↗ Q837675 EXACT TITLE
bodiescivilcourtlegalprofessionalsinglesystem
SHARED TOKENS (7): "bodies", "civil", "court", "legal", "professional", "single", "system". | EXACT TITLE in police_law_enforcement: "Jury". | EXACT TITLE in legal: "Jury".
0.340
Annexation ↗ Q194465 EXACT TITLE
actionsbodieslegalphysicalrecognizedterritorytitle
SHARED TOKENS (7): "actions", "bodies", "legal", "physical", "recognized", "territory", "title". | EXACT TITLE in legal: "Annexation".
0.340
agenciesanalysisdataenforcementpolicereportresources
SHARED TOKENS (7): "agencies", "analysis", "data", "enforcement", "police", "report", "resources". | EXACT TITLE in police_law_enforcement: "Crime analysis".
0.340
enforcementjurisdictionmunicipalnationalorganizedpoliceregional
SHARED TOKENS (7): "enforcement", "jurisdiction", "municipal", "national", "organized", "police", "regional". | EXACT TITLE in police_law_enforcement: "State police".
0.320
Partnership ↗ Q728646 EXACT TITLE
businessgovernedinterestsorganizationorganizationspartners
SHARED TOKENS (6): "business", "governed", "interests", "organization", "organizations", "partners". | EXACT TITLE in police_law_enforcement: "Partnership".
0.320
Pro bono ↗ Q127537 EXACT TITLE
communitylegalprofessionalpublicspecialistwork
SHARED TOKENS (6): "community", "legal", "professional", "public", "specialist", "work". | EXACT TITLE in legal: "Pro bono".
0.320
Dispatcher ↗ Q570755 EXACT TITLE
departmentsmedicaloperationsorganizationspolicepublic
SHARED TOKENS (6): "departments", "medical", "operations", "organizations", "police", "public". | EXACT TITLE in police_law_enforcement: "Dispatcher".
0.320
agenciesconductgovernmentjurisdictionpublicrecords
SHARED TOKENS (6): "agencies", "conduct", "government", "jurisdiction", "public", "records". | EXACT TITLE in police_law_enforcement: "Public records".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalboiseidahorangeriverwestern
SHARED TOKENS (6): "agricultural", "boise", "idaho", "range", "river", "western". | EXACT TITLE in police_law_enforcement: "Boise River".
0.300
Security guard ↗ Q856887 KW CROSS HIGH
actionsagenciesassetsauthoritycriminaldepartmentsexperiencegovernedgovernmentjurisdictionlegallocalmedicalofficerorganizationorganizationspermitspolicepropertyrange
SHARED TOKENS (21): "actions", "agencies", "assets", "authority", "criminal", "departments", "experience", "governed", "government", "jurisdiction", "legal", "local", "medical", "officer", "organization", "organizations", "permits", "police", "property", "range"....
0.300
Homicide ↗ Q149086 EXACT TITLE
deathhomicidelegalrequiressystem
SHARED TOKENS (5): "death", "homicide", "legal", "requires", "system". | EXACT TITLE in police_law_enforcement: "Homicide". | EXACT TITLE in legal: "Homicide".
0.300
authoritychangescivilconstitutionalcourtcourtsenforcementfederaloffensesofficepowerprotectionreportsrightsservestatutes
SHARED TOKENS (16): "authority", "changes", "civil", "constitutional", "court", "courts", "enforcement", "federal", "offenses", "office", "power", "protection", "reports", "rights", "serve", "statutes".
0.300
amongcannotcasescourtcourtsdisputesgenerallegallitigationproceedingspublicrangerequiredsystemtrust
SHARED TOKENS (15): "among", "cannot", "cases", "court", "courts", "disputes", "general", "legal", "litigation", "proceedings", "public", "range", "required", "system", "trust".
0.300
Organized crime ↗ Q46952 KW CROSS HIGH
associationbusinesscasescommunityconductcriminaldecadesdemanddepartmentdevelopmentdrugeducationenforcementfamilyfinancialfirearmsformformsgovernanceinstitutions
SHARED TOKENS (39): "association", "business", "cases", "community", "conduct", "criminal", "decades", "demand", "department", "development", "drug", "education", "enforcement", "family", "financial", "firearms", "form", "forms", "governance", "institutions"....
0.300
actionsamongcriminalhomicidelegal
SHARED TOKENS (5): "actions", "among", "criminal", "homicide", "legal". | EXACT TITLE in legal: "Manslaughter".
0.300
adjudicationadministrativeagenciesbodiesbranchchangescivilcourtseducationenforcementenvironmentexpandedgovernmentimmigrationitselfjudiciallegallegislativeorderspublic
SHARED TOKENS (25): "adjudication", "administrative", "agencies", "bodies", "branch", "changes", "civil", "courts", "education", "enforcement", "environment", "expanded", "government", "immigration", "itself", "judicial", "legal", "legislative", "orders", "public"....
0.300
actionscivilconductcriminaldepartmentdomesticenforcementfederalimmigrationlargestlegalmetronationalofficeofficesoperationspoliceprimaryprincipalprofessional
SHARED TOKENS (27): "actions", "civil", "conduct", "criminal", "department", "domestic", "enforcement", "federal", "immigration", "largest", "legal", "metro", "national", "office", "offices", "operations", "police", "primary", "principal", "professional"....
0.300
annualbusinessconductdevelopmentemployeesentityfinancefinancialfirmsformfundgrowthhistoryinstitutionalmarketoperatingoperationspublicratesscale
SHARED TOKENS (24): "annual", "business", "conduct", "development", "employees", "entity", "finance", "financial", "firms", "form", "fund", "growth", "history", "institutional", "market", "operating", "operations", "public", "rates", "scale"....
0.300
agreementsbenefitschangescompensationemployeesemploymentinterestsorganizationpayregulaterightssafetysecuritysingletradetrainingunionwageworkworkers
SHARED TOKENS (20): "agreements", "benefits", "changes", "compensation", "employees", "employment", "interests", "organization", "pay", "regulate", "rights", "safety", "security", "single", "trade", "training", "union", "wage", "work", "workers".
0.300
agriculturalcontractorscourtdomesticemployeesestablishedfederalgovernmentindependentlabormembersnationalorganizationpowerrelationstradeworkers
SHARED TOKENS (17): "agricultural", "contractors", "court", "domestic", "employees", "established", "federal", "government", "independent", "labor", "members", "national", "organization", "power", "relations", "trade", "workers".
0.300
assistancecasescitiescourtcourtscriminaldepartmentdistrictdrugenforcementestablishedfederalimmigrationjusticelocalnationalofficeofficerpoliceprogram
SHARED TOKENS (23): "assistance", "cases", "cities", "court", "courts", "criminal", "department", "district", "drug", "enforcement", "established", "federal", "immigration", "justice", "local", "national", "office", "officer", "police", "program"....
0.300
administrativeassociationcivilformjusticelegallifeorganizationsphysicalpressprotectionrelationsrightssafetysystem
SHARED TOKENS (15): "administrative", "association", "civil", "form", "justice", "legal", "life", "organizations", "physical", "press", "protection", "relations", "rights", "safety", "system".
0.300
accessagenciesanalysiscasescriminaldataenforcementfamilyleadlegalorganizationpopulationpowerpracticeprojectpublictechnologytotalvictimswork
SHARED TOKENS (20): "access", "agencies", "analysis", "cases", "criminal", "data", "enforcement", "family", "lead", "legal", "organization", "population", "power", "practice", "project", "public", "technology", "total", "victims", "work".
0.300
associationauthoritychangescitiescommunitydevelopmentdistrictslandland-usephysicalplanningprojectregionalregulateregulationresourceswater
SHARED TOKENS (17): "association", "authority", "changes", "cities", "community", "development", "districts", "land", "land-use", "physical", "planning", "project", "regional", "regulate", "regulation", "resources", "water".
0.300
Police academy ↗ Q277845 KW CROSS HIGH
agenciesamongbackgroundcertifycollegeconductcriminaldepartmentenforcementjurisdictionlegalmedicalofficerphysicalpoliceprogramrangerequiredschoolspecial
SHARED TOKENS (22): "agencies", "among", "background", "certify", "college", "conduct", "criminal", "department", "enforcement", "jurisdiction", "legal", "medical", "officer", "physical", "police", "program", "range", "required", "school", "special"....
0.300
authoritycasescivilcollegeconductcourtdoctrineeducationenforcementfederalgovernmenthouseissuesjurisdictionlifepopulationpowerpropertyprotectionpublic
SHARED TOKENS (25): "authority", "cases", "civil", "college", "conduct", "court", "doctrine", "education", "enforcement", "federal", "government", "house", "issues", "jurisdiction", "life", "population", "power", "property", "protection", "public"....
0.300
assetsbusinesscommissiondepartmententityfederalgovernedgovernmentinterestsjusticelegalmarketoperatingoperationsorganizationregulatoryrequiresreviewsingletrade
SHARED TOKENS (21): "assets", "business", "commission", "department", "entity", "federal", "governed", "government", "interests", "justice", "legal", "market", "operating", "operations", "organization", "regulatory", "requires", "review", "single", "trade"....
0.300
advocacyagenciesassistanceassociatedchangescommunitycourtcriminaldomesticgeneralimmigrationjusticeknowledgelegalnationalprogramresourcesrightssexualsupport
SHARED TOKENS (23): "advocacy", "agencies", "assistance", "associated", "changes", "community", "court", "criminal", "domestic", "general", "immigration", "justice", "knowledge", "legal", "national", "program", "resources", "rights", "sexual", "support"....
0.300
agreementsconstitutionalcontextcourtemployeesemploymentfederalfeegeneralgovernmentlaborlocalmemberspaypublicrepresentationrequiredsecuritystatutesunion
SHARED TOKENS (21): "agreements", "constitutional", "context", "court", "employees", "employment", "federal", "fee", "general", "government", "labor", "local", "members", "pay", "public", "representation", "required", "security", "statutes", "union"....
0.300
attorneyboisecasescivilclaimscourtcriminaldistrictfederalgovernmentidahojurisdictionlitigationnationaloffice
SHARED TOKENS (15): "attorney", "boise", "cases", "civil", "claims", "court", "criminal", "district", "federal", "government", "idaho", "jurisdiction", "litigation", "national", "office".
0.300
agenciesamongcasesdomesticenforcementestablishedexperienceformsgovernmenthomicidehousejurisdictionlifemetronationaloffensesorganizationspopulationprosecutionpublic
SHARED TOKENS (28): "agencies", "among", "cases", "domestic", "enforcement", "established", "experience", "forms", "government", "homicide", "house", "jurisdiction", "life", "metro", "national", "offenses", "organizations", "population", "prosecution", "public"....
0.300
actionsactivecaseschildcivilcommunitycourtformsgovernmentminimumoldestpermitspracticepublicrequiresrights
SHARED TOKENS (16): "actions", "active", "cases", "child", "civil", "community", "court", "forms", "government", "minimum", "oldest", "permits", "practice", "public", "requires", "rights".
0.300
adabusinesschangescivilcouncilemployeesfinalhouseinterestsnationalprotectionpublicrequiresrightssexual
SHARED TOKENS (15): "ada", "business", "changes", "civil", "council", "employees", "final", "house", "interests", "national", "protection", "public", "requires", "rights", "sexual".
0.300
agenciescommunityenforcemententityfinancialformformsgovernancegovernmenthealthcarejurisdictionmembersoversightpolicepublicrecordsretainreviewsupportwork
SHARED TOKENS (20): "agencies", "community", "enforcement", "entity", "financial", "form", "forms", "governance", "government", "healthcare", "jurisdiction", "members", "oversight", "police", "public", "records", "retain", "review", "support", "work".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
alongsideassociationcasescivilconstitutionalcourtscriminaldepartmenteducationfederallegallitigationmattersnationalofficepracticeprofessionalpropertyprosecutingpublic
SHARED TOKENS (26): "alongside", "association", "cases", "civil", "constitutional", "courts", "criminal", "department", "education", "federal", "legal", "litigation", "matters", "national", "office", "practice", "professional", "property", "prosecuting", "public"....
0.300
U visa ↗ Q17086349 KW CROSS HIGH
agenciescasescriminaldomesticenforcementfamilygovernmentimmediatememberspermitsphysicalprosecutionprotectionservesexualvictimsviolence
SHARED TOKENS (17): "agencies", "cases", "criminal", "domestic", "enforcement", "family", "government", "immediate", "members", "permits", "physical", "prosecution", "protection", "serve", "sexual", "victims", "violence".
0.300
agenciesattorneyattorneyscivilcriminaldatedepartmentdistrictsdomesticdrugenforcementenvironmentfederalfirearmsgeneralgovernmentheadquarteredjudicialjusticelawyers
SHARED TOKENS (30): "agencies", "attorney", "attorneys", "civil", "criminal", "date", "department", "districts", "domestic", "drug", "enforcement", "environment", "federal", "firearms", "general", "government", "headquartered", "judicial", "justice", "lawyers"....
0.300
accessagreementsattorneybusinesscannotcasescommunitycompensationdisclosuredisputesemployeesemploymenteventsknowledgelegalprogramrequiredsingletrade
SHARED TOKENS (19): "access", "agreements", "attorney", "business", "cannot", "cases", "community", "compensation", "disclosure", "disputes", "employees", "employment", "events", "knowledge", "legal", "program", "required", "single", "trade".
0.300
agenciescivilcouncildefensedepartmentdepartmentsemployeesfederalhouseimmigrationjusticeoperationspublicresponsiblesecurity
SHARED TOKENS (15): "agencies", "civil", "council", "defense", "department", "departments", "employees", "federal", "house", "immigration", "justice", "operations", "public", "responsible", "security".
0.300
activeadministrativeappellatecasescourtcourthousecourtscoveringdistrictdistrictseasternfederalhandlesheadquarteredidahojudicialjurisdictionlargestlawyerspacific
SHARED TOKENS (25): "active", "administrative", "appellate", "cases", "court", "courthouse", "courts", "covering", "district", "districts", "eastern", "federal", "handles", "headquartered", "idaho", "judicial", "jurisdiction", "largest", "lawyers", "pacific"....
0.300
Labour law ↗ Q628967 KW CROSS HIGH
agenciescasescodecontractorsemployeesemploymentgoverngovernmentjudiciallaborlegislatureminimumregulatoryrightsstandardstradeunionworkworkers
SHARED TOKENS (19): "agencies", "cases", "code", "contractors", "employees", "employment", "govern", "government", "judicial", "labor", "legislature", "minimum", "regulatory", "rights", "standards", "trade", "union", "work", "workers".
0.300
domesticenforcementinitiatedofficerviolence
SHARED TOKENS (5): "domestic", "enforcement", "initiated", "officer", "violence". | EXACT TITLE in police_law_enforcement: "Crisis negotiation".
0.300
actionscodeemployeesemploymentenvironmentformgenerallegalorganizationsphysicalprofessionalrelationshipssexualvictimswork
SHARED TOKENS (15): "actions", "code", "employees", "employment", "environment", "form", "general", "legal", "organizations", "physical", "professional", "relationships", "sexual", "victims", "work".
0.300
druggovernmentnationalsingletraffic
SHARED TOKENS (5): "drug", "government", "national", "single", "traffic". | EXACT TITLE in police_law_enforcement: "Controlled substance".
0.300
appliescivilconstitutionalcourteducationfederalgovernmentitselfjurisdictionjusticelargelocalprimaryprotectionrequiresrights
SHARED TOKENS (16): "applies", "civil", "constitutional", "court", "education", "federal", "government", "itself", "jurisdiction", "justice", "large", "local", "primary", "protection", "requires", "rights".
0.300
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesappliesbodiesconstitutionalcourtsdeathgovernmentjusticelandlegalpowerproceedingsrequirementrightsstatutorytrade
SHARED TOKENS (17): "administrative", "agencies", "applies", "bodies", "constitutional", "courts", "death", "government", "justice", "land", "legal", "power", "proceedings", "requirement", "rights", "statutory", "trade".
0.300
accessaddresscriminalenforcementfullgovernmentlistedoffensespublicregistrationrequiredresponsibleschoolsexualsystem
SHARED TOKENS (15): "access", "address", "criminal", "enforcement", "full", "government", "listed", "offenses", "public", "registration", "required", "responsible", "school", "sexual", "system".
0.300
Trademark ↗ Q167270 KW CROSS HIGH
agenciesagreementsassociatedenforcementjurisdictionlegalminimumofficeprimaryproductspropertyprotectionregistrationrightssourcesstandardstradeunion
SHARED TOKENS (18): "agencies", "agreements", "associated", "enforcement", "jurisdiction", "legal", "minimum", "office", "primary", "products", "property", "protection", "registration", "rights", "sources", "standards", "trade", "union".
0.300
Foreclosure ↗ Q231710 KW CROSS HIGH
associationattorneycannotcontractorscourtcourtsfeefeeshouselegalpayprincipalpropertyrealsecuritystatutorytitletrust
SHARED TOKENS (18): "association", "attorney", "cannot", "contractors", "court", "courts", "fee", "fees", "house", "legal", "pay", "principal", "property", "real", "security", "statutory", "title", "trust".
0.300
associateddeathdepartmentsenvironmentfinancialgovernmenthomicideinjurynationalorganizationspresspropertyrateratestrafficunion
SHARED TOKENS (16): "associated", "death", "departments", "environment", "financial", "government", "homicide", "injury", "national", "organizations", "press", "property", "rate", "rates", "traffic", "union".
0.300
associationbusinessentityformgovernedlegalmedicaloperatingoperationsorganizationorganizedphysicalprimaryprofessionalrequiredrightssingle
SHARED TOKENS (17): "association", "business", "entity", "form", "governed", "legal", "medical", "operating", "operations", "organization", "organized", "physical", "primary", "professional", "required", "rights", "single".
0.300
activeassociationcasescommercialcommunitycontextdecadesdevelopmentestateformgoverngovernedgovernsgrowthindustrialjurisdictionlandlargelegallife
SHARED TOKENS (32): "active", "association", "cases", "commercial", "community", "context", "decades", "development", "estate", "form", "govern", "governed", "governs", "growth", "industrial", "jurisdiction", "land", "large", "legal", "life"....
0.300
activeappellatecannotcaseschaptercodecourtcourtsdistrictdistrictsfederalgoverngovernmenthandlesinterestsitselfjudicialjurisdictionmattersproceedings
SHARED TOKENS (21): "active", "appellate", "cannot", "cases", "chapter", "code", "court", "courts", "district", "districts", "federal", "govern", "government", "handles", "interests", "itself", "judicial", "jurisdiction", "matters", "proceedings"....
0.300
analysisassociatedcivilcourtscriminaldefensefullinitiatedjurisdictionlegallegislativenamesproceedingspropertyrequiresstatutesstatutory
SHARED TOKENS (17): "analysis", "associated", "civil", "courts", "criminal", "defense", "full", "initiated", "jurisdiction", "legal", "legislative", "names", "proceedings", "property", "requires", "statutes", "statutory".
0.300
cardschapterclaimscodecourtcourtsfinancialformgeneralpaypowerprioritypropertyprotectionstatutesstatutorytitle
SHARED TOKENS (17): "cards", "chapter", "claims", "code", "court", "courts", "financial", "form", "general", "pay", "power", "priority", "property", "protection", "statutes", "statutory", "title".
0.300
activeadministrativeagenciesannualappellatecasescitiescourtcourtscoversdistrictestablishedfederalfinaljurisdictionlargelegalnationalorganizedpopulation
SHARED TOKENS (26): "active", "administrative", "agencies", "annual", "appellate", "cases", "cities", "court", "courts", "covers", "district", "established", "federal", "final", "jurisdiction", "large", "legal", "national", "organized", "population"....
0.300
knowledgelegalminimumnationalorganization
SHARED TOKENS (5): "knowledge", "legal", "minimum", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.300
associationattorneysbusinesscasescouncilcourtgeneraljurisdictionlawyerslegalmandatorymembersorganizationsorganizedphysicalpracticeprofessionalpublicregulationresponsible
SHARED TOKENS (22): "association", "attorneys", "business", "cases", "council", "court", "general", "jurisdiction", "lawyers", "legal", "mandatory", "members", "organizations", "organized", "physical", "practice", "professional", "public", "regulation", "responsible"....
0.300
businesscasescommercialdefenseestatefeefinancialformgeneralindependentinstitutionalinsuranceinterestslandlargelegallifeoutsidepropertyrate
SHARED TOKENS (27): "business", "cases", "commercial", "defense", "estate", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "interests", "land", "large", "legal", "life", "outside", "property", "rate"....
0.300
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementsauthoritycasescivilcourtscriminaldefensefinalformsjudicialjusticelegallocaloffensepracticeprosecutionprosecutorpublicresourcesserves
SHARED TOKENS (21): "agreements", "authority", "cases", "civil", "courts", "criminal", "defense", "final", "forms", "judicial", "justice", "legal", "local", "offense", "practice", "prosecution", "prosecutor", "public", "resources", "serves"....
0.300
Grand jury ↗ Q1323789 KW CROSS HIGH
casescivilconductcourtcourtscriminalindependentjurisdictionlargelegalmattersmembersoffensephysicalproceedingsprosecutionprosecutionspublicrequiredreview
SHARED TOKENS (23): "cases", "civil", "conduct", "court", "courts", "criminal", "independent", "jurisdiction", "large", "legal", "matters", "members", "offense", "physical", "proceedings", "prosecution", "prosecutions", "public", "required", "review"....
0.300
aidassistancebenefitsentityfederalfinancialformgeneralgovernmentlocalorganizationorganizationsoutsidepropertypublicsupport
SHARED TOKENS (16): "aid", "assistance", "benefits", "entity", "federal", "financial", "form", "general", "government", "local", "organization", "organizations", "outside", "property", "public", "support".
0.300
analysiscasescivilcourtcriminalcustodydrugfoodhistorylegallitigationphysicalproductsrecordsrequiredtechnology
SHARED TOKENS (16): "analysis", "cases", "civil", "court", "criminal", "custody", "drug", "food", "history", "legal", "litigation", "physical", "products", "records", "required", "technology".
0.300
agenciesauthoritydrugfoodgovernmenthealthcareindependentjurisdictionlicensingofficeproductsregulationregulatoryresponsiblesafetystandards
SHARED TOKENS (16): "agencies", "authority", "drug", "food", "government", "healthcare", "independent", "jurisdiction", "licensing", "office", "products", "regulation", "regulatory", "responsible", "safety", "standards".
0.300
Use of force ↗ Q971119 KW CROSS HIGH
civilcodecontextcriminaldeathenforcementhomicidejurisdictionlegalphysicalpolicerecognizedrequiredrightssecurity
SHARED TOKENS (15): "civil", "code", "context", "criminal", "death", "enforcement", "homicide", "jurisdiction", "legal", "physical", "police", "recognized", "required", "rights", "security".
0.300
actionsaddressclaimsdisclosureemploymentenforcementfinancialgovernmentinstitutionsissuesorganizationorganizationsprotectionpublicregulatereportresourcesvictimswork
SHARED TOKENS (19): "actions", "address", "claims", "disclosure", "employment", "enforcement", "financial", "government", "institutions", "issues", "organization", "organizations", "protection", "public", "regulate", "report", "resources", "victims", "work".
0.300
actionsappliesauthoritycasescivilconstitutionalcourtcourtsdoctrineemployeesenforcementfinancialgovernmentitselflegallitigationoutsidepoliceprosecutionprosecutor
SHARED TOKENS (23): "actions", "applies", "authority", "cases", "civil", "constitutional", "court", "courts", "doctrine", "employees", "enforcement", "financial", "government", "itself", "legal", "litigation", "outside", "police", "prosecution", "prosecutor"....
0.300
adoptionauthoritycasescodeconsumercourtcourtsdistrictfederalgovernedgovernsjudicialjurisdictionpropertyprotectionrightstitle
SHARED TOKENS (17): "adoption", "authority", "cases", "code", "consumer", "court", "courts", "district", "federal", "governed", "governs", "judicial", "jurisdiction", "property", "protection", "rights", "title".
0.300
Lawsuit ↗ Q697327 KW CROSS HIGH
actionsattorneysbusinesscivilclaimscourtcriminaldisputesissueslegallitigationordersorganizationspublicrequired
SHARED TOKENS (15): "actions", "attorneys", "business", "civil", "claims", "court", "criminal", "disputes", "issues", "legal", "litigation", "orders", "organizations", "public", "required".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
actionsadministrativeanalysisassistanceassociationattorneybodiesbusinesscasesconductcourtcourtsdepartmentseducationentityenvironmentestablishedexperiencefamilyforms
SHARED TOKENS (44): "actions", "administrative", "analysis", "assistance", "association", "attorney", "bodies", "business", "cases", "conduct", "court", "courts", "departments", "education", "entity", "environment", "established", "experience", "family", "forms"....
0.300
agreementscommunityconstitutionalfoodformformslegalnationaloffenseorganizationspowerprotectionpublicrecognizedrightssecurityspecialtrade
SHARED TOKENS (18): "agreements", "community", "constitutional", "food", "form", "forms", "legal", "national", "offense", "organizations", "power", "protection", "public", "recognized", "rights", "security", "special", "trade".
0.300
Probate court ↗ Q7246899 KW CROSS HIGH
actionsassetsauthoritycasescountiescourtcourtsdistrictestateissuesjudicialjurisdictionlegislativematterspropertystatutory
SHARED TOKENS (16): "actions", "assets", "authority", "cases", "counties", "court", "courts", "district", "estate", "issues", "judicial", "jurisdiction", "legislative", "matters", "property", "statutory".
🫐 BERRY117 edges
0.280
Family court ↗ Q82749 KW CROSS HIGH
addresscaseschangeschildcourtcourtsdomesticfamilylegalmattersordersrelationshipssupportsystem
SHARED TOKENS (14): "address", "cases", "changes", "child", "court", "courts", "domestic", "family", "legal", "matters", "orders", "relationships", "support", "system".
0.280
casescivilcourtcourthousecourtscoverscriminaldisputesdistrictdistrictsfederaljudicialjurisdictionresidents
SHARED TOKENS (14): "cases", "civil", "court", "courthouse", "courts", "covers", "criminal", "disputes", "district", "districts", "federal", "judicial", "jurisdiction", "residents".
0.280
agenciesauthoritycommissioncommissionerscoverscriminalfederalfinanciallitigationorganizationsprimaryregulationregulatorysecurity
SHARED TOKENS (14): "agencies", "authority", "commission", "commissioners", "covers", "criminal", "federal", "financial", "litigation", "organizations", "primary", "regulation", "regulatory", "security".
0.280
agenciesappliesassociationcasescivilconstitutionalcourtexpandedfinanceformsgovernmentpressrightsschool
SHARED TOKENS (14): "agencies", "applies", "association", "cases", "civil", "constitutional", "court", "expanded", "finance", "forms", "government", "press", "rights", "school".
0.280
Family law ↗ Q384014 EXACT TITLE
domesticfamilymattersrelations
SHARED TOKENS (4): "domestic", "family", "matters", "relations". | EXACT TITLE in legal: "Family law".
0.280
agreementsamongbusinesscasescourtscoversemployeeslaborlegalmarketsupportsystemtradeworkers
SHARED TOKENS (14): "agreements", "among", "business", "cases", "courts", "covers", "employees", "labor", "legal", "market", "support", "system", "trade", "workers".
0.280
agenciescasesemployeesenforcementfederalgeneralmedicalpolicerangesafetysecuritysupportsystemtraffic
SHARED TOKENS (14): "agencies", "cases", "employees", "enforcement", "federal", "general", "medical", "police", "range", "safety", "security", "support", "system", "traffic".
0.280
administrativeauthoritycriminalenforcementlegallifeofficerpolicepropertyprosecutionpublicsafetysecurityseparate
SHARED TOKENS (14): "administrative", "authority", "criminal", "enforcement", "legal", "life", "officer", "police", "property", "prosecution", "public", "safety", "security", "separate".
0.280
benefitsdefenseeducationentityfeesfinancialgovernmenthealthcareinstitutionsitselflegislativelegislatureprogramrequires
SHARED TOKENS (14): "benefits", "defense", "education", "entity", "fees", "financial", "government", "healthcare", "institutions", "itself", "legislative", "legislature", "program", "requires".
0.280
childcoversdepartmentdomesticelectedemployeesfamilyhourlabormedicalpublicwageworkworkers
SHARED TOKENS (14): "child", "covers", "department", "domestic", "elected", "employees", "family", "hour", "labor", "medical", "public", "wage", "work", "workers".
0.280
departmentdistrictenforcementenvironmentissuesjusticelocalofficerpoliceresourceresponsiblesafetyschoolwork
SHARED TOKENS (14): "department", "district", "enforcement", "environment", "issues", "justice", "local", "officer", "police", "resource", "responsible", "safety", "school", "work".
0.280
legalphysicalriverwater
SHARED TOKENS (4): "legal", "physical", "river", "water". | EXACT TITLE in legal: "Water right".
0.280
administrativecannotcivilclaimscommissionemploymentestablishedfederalgovernmentnationalpracticerightssexualvictims
SHARED TOKENS (14): "administrative", "cannot", "civil", "claims", "commission", "employment", "established", "federal", "government", "national", "practice", "rights", "sexual", "victims".
0.280
actionsagenciesauthoritycouncilcourtsenvironmentestablishedfederalfinalgovernmentnationalreportsrequirementrequires
SHARED TOKENS (14): "actions", "agencies", "authority", "council", "courts", "environment", "established", "federal", "final", "government", "national", "reports", "requirement", "requires".
0.270
branchconstitutionalelectedgovernmentidahooffice
SHARED TOKENS (6): "branch", "constitutional", "elected", "government", "idaho", "office". | URL->B (1): https://sos.idaho.gov/.
0.260
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotcourtcriticalfamilyinterestslegallifemedicalprofessionalpropertypublicserve
SHARED TOKENS (13): "authority", "cannot", "court", "critical", "family", "interests", "legal", "life", "medical", "professional", "property", "public", "serve".
0.260
Criminology ↗ Q161733 KW CROSS HIGH
agenciesbodiescriminalenforcementinstitutionsinterestsjudicialjusticelegallegislativepublicsystemworkers
SHARED TOKENS (13): "agencies", "bodies", "criminal", "enforcement", "institutions", "interests", "judicial", "justice", "legal", "legislative", "public", "system", "workers".
0.260
authoritydistrictdistrictsentitygovernmentlargelegislaturelocalorganizedpowerpublicsubdivisionwater
SHARED TOKENS (13): "authority", "district", "districts", "entity", "government", "large", "legislature", "local", "organized", "power", "public", "subdivision", "water".
0.260
actionsaidcannotcivilconductcourtcriminalenforcementissuesofficerpolicepropertysearch
SHARED TOKENS (13): "actions", "aid", "cannot", "civil", "conduct", "court", "criminal", "enforcement", "issues", "officer", "police", "property", "search".
0.260
assistancecannotcasescourtcriminalcustodygovernmenthousejaillargepublicreviewsystem
SHARED TOKENS (13): "assistance", "cannot", "cases", "court", "criminal", "custody", "government", "house", "jail", "large", "public", "review", "system".
0.260
chiefdepartmentselectedenforcementeventsofficesoperatingorderspoliceprotectionpublicresponsiblesecurity
SHARED TOKENS (13): "chief", "departments", "elected", "enforcement", "events", "offices", "operating", "orders", "police", "protection", "public", "responsible", "security".
0.260
cannotcasesconductcourtcriminaldisputesinsurancejusticelegalpublicratespecialsystem
SHARED TOKENS (13): "cannot", "cases", "conduct", "court", "criminal", "disputes", "insurance", "justice", "legal", "public", "rate", "special", "system".
0.260
amongannualchangesclaimscourtsgovernmenthistorylegaloutsideprogramratesrepresentationtotal
SHARED TOKENS (13): "among", "annual", "changes", "claims", "courts", "government", "history", "legal", "outside", "program", "rates", "representation", "total".
0.260
agenciesanalysisenforcement
SHARED TOKENS (3): "agencies", "analysis", "enforcement". | EXACT TITLE in police_law_enforcement: "Crime mapping".
0.260
populationrecreationwork
SHARED TOKENS (3): "population", "recreation", "work". | EXACT TITLE in police_law_enforcement: "Animal control".
0.260
agenciescollectiondataenforcementformgovernmentissuesnamespoliceratesregistrationtechnologytraffic
SHARED TOKENS (13): "agencies", "collection", "data", "enforcement", "form", "government", "issues", "names", "police", "rates", "registration", "technology", "traffic".
0.260
Rape kit ↗ Q7293902 KW CROSS HIGH
aidassistancecasescollectioncriminalmedicaloffenseorganizationphysicalpoliceprosecutionsexualvictims
SHARED TOKENS (13): "aid", "assistance", "cases", "collection", "criminal", "medical", "offense", "organization", "physical", "police", "prosecution", "sexual", "victims".
0.260
publicsafetyseparate
SHARED TOKENS (3): "public", "safety", "separate". | EXACT TITLE in police_law_enforcement: "Bomb disposal".
0.260
Road transport ↗ KW CROSS HIGH
developmentfoodformsfulllargelicensinglocalsafetyseparatespecialspecialisttrafficvolume
SHARED TOKENS (13): "development", "food", "forms", "full", "large", "licensing", "local", "safety", "separate", "special", "specialist", "traffic", "volume".
0.260
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesschangesdevelopmentexpansionfinancefinancialfirmsfundgeneralpressproductspublic
SHARED TOKENS (13): "active", "business", "changes", "development", "expansion", "finance", "financial", "firms", "fund", "general", "press", "products", "public".
0.260
Beneficiary ↗ Q2596417 KW CROSS HIGH
aidassetsbenefitscontextdeathdevelopmententityfinanceinsurancelegallifeprimarytrust
SHARED TOKENS (13): "aid", "assets", "benefits", "context", "death", "development", "entity", "finance", "insurance", "legal", "life", "primary", "trust".
0.260
agenciesemploymentenforcementformsgovernmentjurisdictionlegalorganizedpolicepowerresourcesresponsiblerights
SHARED TOKENS (13): "agencies", "employment", "enforcement", "forms", "government", "jurisdiction", "legal", "organized", "police", "power", "resources", "responsible", "rights".
0.240
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetsbusinesscommercialdisclosureformslegalmaintainpropertyregistrationtrade
SHARED TOKENS (12): "agreements", "among", "assets", "business", "commercial", "disclosure", "forms", "legal", "maintain", "property", "registration", "trade".
0.240
activeaidanalysiscontextdeathdrugexpandedformlegalmedicalphysicalsearch
SHARED TOKENS (12): "active", "aid", "analysis", "context", "death", "drug", "expanded", "form", "legal", "medical", "physical", "search".
0.240
Civil liberties ↗ Q29556 KW CROSS HIGH
authoritycivilgovernmentjudiciallifepowerpresspropertyprotectionrightssecuritywork
SHARED TOKENS (12): "authority", "civil", "government", "judicial", "life", "power", "press", "property", "protection", "rights", "security", "work".
0.240
addressassistancechangesfederalformmaintainphysicalprimaryprotectionresourcewaterworks
SHARED TOKENS (12): "address", "assistance", "changes", "federal", "form", "maintain", "physical", "primary", "protection", "resource", "water", "works".
0.240
bodiesbranchcivilenforcementformmembersorderspolicepracticepublicrecognizedserve
SHARED TOKENS (12): "bodies", "branch", "civil", "enforcement", "form", "members", "orders", "police", "practice", "public", "recognized", "serve".
0.240
authorityconstructiongovernmentgrowthlocalorganizationorganizationsproducespublicregulatetradeworks
SHARED TOKENS (12): "authority", "construction", "government", "growth", "local", "organization", "organizations", "produces", "public", "regulate", "trade", "works".
0.240
appliescannotcasescourtcourtsfactsformfullissuesordersrealsupport
SHARED TOKENS (12): "applies", "cannot", "cases", "court", "courts", "facts", "form", "full", "issues", "orders", "real", "support".
0.220
Expungement ↗ Q2352928 KW CROSS HIGH
criminalenforcementfederalgeneraljurisdictionlegaloffensesproceedingspublicrecordsreview
SHARED TOKENS (11): "criminal", "enforcement", "federal", "general", "jurisdiction", "legal", "offenses", "proceedings", "public", "records", "review".
0.220
Attorney ↗ Q1289214 EXACT TITLE
attorneypower
SHARED TOKENS (2): "attorney", "power". | EXACT TITLE in police_law_enforcement: "Attorney". | EXACT TITLE in legal: "Attorney".
0.220
cannotcourtcriminalcustodyenforcementknowledgepoliceproceedingsprotectionrequiredrights
SHARED TOKENS (11): "cannot", "court", "criminal", "custody", "enforcement", "knowledge", "police", "proceedings", "protection", "required", "rights".
0.220
Overtime ↗ Q667022 KW CROSS HIGH
beyondemployeesemploymentnationalpayrateratestradeworkworkersworks
SHARED TOKENS (11): "beyond", "employees", "employment", "national", "pay", "rate", "rates", "trade", "work", "workers", "works".
0.220
analysisauthoritycommunityexpandedleadorganizationspolicepublicrequiresreviewuniversity
SHARED TOKENS (11): "analysis", "authority", "community", "expanded", "lead", "organizations", "police", "public", "requires", "review", "university".
0.220
addressagenciesauthorityenforcementjusticeofficerpolicepublicseparatetrafficwork
SHARED TOKENS (11): "address", "agencies", "authority", "enforcement", "justice", "officer", "police", "public", "separate", "traffic", "work".
0.220
Sheriff ↗ Q578478 EXACT TITLE
governmentoffice
SHARED TOKENS (2): "government", "office". | EXACT TITLE in police_law_enforcement: "Sheriff".
0.220
Theft ↗ Q2727213 EXACT TITLE
propertystatutory
SHARED TOKENS (2): "property", "statutory". | EXACT TITLE in police_law_enforcement: "Theft".
0.220
decadesdruggovernmentjudiciallargepracticeproductsregulateregulationsystemvolume
SHARED TOKENS (11): "decades", "drug", "government", "judicial", "large", "practice", "products", "regulate", "regulation", "system", "volume".
0.220
Body camera ↗ Q17020273 KW CROSS HIGH
decadesenforcementhealthcarelargemedicalpolicepublicrangesupportsystemtrust
SHARED TOKENS (11): "decades", "enforcement", "healthcare", "large", "medical", "police", "public", "range", "support", "system", "trust".
0.220
Paternity ↗ Q16881001 EXACT TITLE
childhouse
SHARED TOKENS (2): "child", "house". | EXACT TITLE in legal: "Paternity".
0.220
accessassociatedconstructiondevelopmentdoctrinegovernmentinstitutionsoversightpracticeproceedingspublic
SHARED TOKENS (11): "access", "associated", "construction", "development", "doctrine", "government", "institutions", "oversight", "practice", "proceedings", "public".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in police_law_enforcement: "Subdivision". | EXACT TITLE in legal: "Subdivision".
0.200
Sex offender ↗ Q5659979 KW CROSS HIGH
childciviljurisdictionlegalmandatoryoffensespublicregistrationsexualstatutory
SHARED TOKENS (10): "child", "civil", "jurisdiction", "legal", "mandatory", "offenses", "public", "registration", "sexual", "statutory".
0.200
Drug court ↗ Q5308883 KW CROSS HIGH
addresscourtcourtscriminaldefensedrugenforcementprosecutionpublicwork
SHARED TOKENS (10): "address", "court", "courts", "criminal", "defense", "drug", "enforcement", "prosecution", "public", "work".
0.200
Damages ↗ Q308922 KW CROSS HIGH
compensationformgeneralinjurylegalmedicalphysicalpropertyrecognizedspecial
SHARED TOKENS (10): "compensation", "form", "general", "injury", "legal", "medical", "physical", "property", "recognized", "special".
0.200
casescivilcourtenforcementformlegalpolicepropertypublicsearch
SHARED TOKENS (10): "cases", "civil", "court", "enforcement", "form", "legal", "police", "property", "public", "search".
0.200
accessdepartmentlocalmedicalnetworkpolicepublicresponsiblesafetysystem
SHARED TOKENS (10): "access", "department", "local", "medical", "network", "police", "public", "responsible", "safety", "system".
0.200
Trial court ↗ Q3125101 KW CROSS HIGH
appellateauthoritycasescourtcourtsestablishedjurisdictionmatterspowerreview
SHARED TOKENS (10): "appellate", "authority", "cases", "court", "courts", "established", "jurisdiction", "matters", "power", "review".
0.200
Debtor ↗ Q157470 KW CROSS HIGH
agreementsconsumerentityfamilyfullgovernmentlegalpaypriorityrequires
SHARED TOKENS (10): "agreements", "consumer", "entity", "family", "full", "government", "legal", "pay", "priority", "requires".
0.200
attorneyscivilcriminaldefenselawyerslegalmatterspublictradeunion
SHARED TOKENS (10): "attorneys", "civil", "criminal", "defense", "lawyers", "legal", "matters", "public", "trade", "union".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in police_law_enforcement: "Will". | EXACT TITLE in legal: "Will".
0.200
actionsattorneyformhealthcareitselfjurisdictionlegalmedicalpowersingle
SHARED TOKENS (10): "actions", "attorney", "form", "healthcare", "itself", "jurisdiction", "legal", "medical", "power", "single".
0.200
civilcourtscriminalformslandlegalpowerresponsiblesystemwater
SHARED TOKENS (10): "civil", "courts", "criminal", "forms", "land", "legal", "power", "responsible", "system", "water".
0.200
agenciesanalysisbodiescourtlayerlegaloperatingrangespecialistsstandards
SHARED TOKENS (10): "agencies", "analysis", "bodies", "court", "layer", "legal", "operating", "range", "specialists", "standards".
0.180
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualbenefitscontractorsemployeesindependentpaywagework
SHARED TOKENS (9): "among", "annual", "benefits", "contractors", "employees", "independent", "pay", "wage", "work".
0.180
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesestatefamilyformsjurisdictionmemberspropertyresultingstatutory
SHARED TOKENS (9): "applies", "estate", "family", "forms", "jurisdiction", "members", "property", "resulting", "statutory".
0.180
Police dog ↗ Q39235 KW CROSS HIGH
associatedcriminalenforcementlocalnationaloffensepolicetrainingwork
SHARED TOKENS (9): "associated", "criminal", "enforcement", "local", "national", "offense", "police", "training", "work".
0.180
amongcommissiondistrictlegaloversightpublicregulationregulatoryserves
SHARED TOKENS (9): "among", "commission", "district", "legal", "oversight", "public", "regulation", "regulatory", "serves".
0.180
Injunction ↗ Q6495575 KW CROSS HIGH
civilconductcourtcourtscriminalformfulllegalspecial
SHARED TOKENS (9): "civil", "conduct", "court", "courts", "criminal", "form", "full", "legal", "special".
0.180
attorneyattorneyscourtdoctrinefulllegaloldestprofessionalrepresentation
SHARED TOKENS (9): "attorney", "attorneys", "court", "doctrine", "full", "legal", "oldest", "professional", "representation".
0.180
addresscivilcommercialgovernedlegalpropertyrealrequiredrights
SHARED TOKENS (9): "address", "civil", "commercial", "governed", "legal", "property", "real", "required", "rights".
0.180
Campus police ↗ Q5028727 KW CROSS HIGH
associatedcollegepolicepropertypublicsafetysecurityuniversitywork
SHARED TOKENS (9): "associated", "college", "police", "property", "public", "safety", "security", "university", "work".
0.160
amongeasternlandorganizedpropertyrightssystemwater
SHARED TOKENS (8): "among", "eastern", "land", "organized", "property", "rights", "system", "water".
0.160
drugfinanciallocalmarketratesreporttotaltrade
SHARED TOKENS (8): "drug", "financial", "local", "market", "rates", "report", "total", "trade".
0.160
Deed ↗ Q705914 KW CROSS HIGH
associatedattorneylegalpracticepropertyrightsspecialtytitle
SHARED TOKENS (8): "associated", "attorney", "legal", "practice", "property", "rights", "specialty", "title".
0.160
Alimony ↗ Q368305 KW CROSS HIGH
agreementschildfamilyfinanciallegalmaintenancerequiredsupport
SHARED TOKENS (8): "agreements", "child", "family", "financial", "legal", "maintenance", "required", "support".
0.160
Star, Idaho ↗ KW CROSS HIGH
adaboisecanyondistricthouseidahopopulationschool
SHARED TOKENS (8): "ada", "boise", "canyon", "district", "house", "idaho", "population", "school".
0.160
Bail ↗ Q162351 KW CROSS HIGH
casescourtcriminalformjudicialpolicepropertyrequired
SHARED TOKENS (8): "cases", "court", "criminal", "form", "judicial", "police", "property", "required".
0.160
Dashcam ↗ Q5226605 KW CROSS HIGH
commercialdataformfullpowerrecordsregistrationtechnology
SHARED TOKENS (8): "commercial", "data", "form", "full", "power", "records", "registration", "technology".
0.160
administrativecourtfederalimmigrationlegalofficeproceedingsreview
SHARED TOKENS (8): "administrative", "court", "federal", "immigration", "legal", "office", "proceedings", "review".
0.160
agriculturaldoctrinefullindustriallegalrightssystemwater
SHARED TOKENS (8): "agricultural", "doctrine", "full", "industrial", "legal", "rights", "system", "water".
0.160
Easement ↗ Q448405 KW CROSS HIGH
accessamongitselflandpropertypublicrealrights
SHARED TOKENS (8): "access", "among", "itself", "land", "property", "public", "real", "rights".
0.160
associationaugustidaholaborlifeservingunionwestern
SHARED TOKENS (8): "association", "august", "idaho", "labor", "life", "serving", "union", "western".
0.160
Legal clinic ↗ Q1351667 KW CROSS HIGH
aidconductexperiencelawyerslegalprogramschoolwork
SHARED TOKENS (8): "aid", "conduct", "experience", "lawyers", "legal", "program", "school", "work".
0.140
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsurancepayprimaryprincipalpropertytrust
SHARED TOKENS (7): "established", "insurance", "pay", "primary", "principal", "property", "trust".
0.140
Summons ↗ Q708245 KW CROSS HIGH
administrativecourtformgovernmentjudiciallegalproceedings
SHARED TOKENS (7): "administrative", "court", "form", "government", "judicial", "legal", "proceedings".
0.140
agenciesenforcementidahojusticelocalpoliceresidents
SHARED TOKENS (7): "agencies", "enforcement", "idaho", "justice", "local", "police", "residents".
0.140
Legal ethics ↗ Q3655952 KW CROSS HIGH
conductdevelopmentitselflegalmemberspracticeprofessional
SHARED TOKENS (7): "conduct", "development", "itself", "legal", "members", "practice", "professional".
0.140
canyoneagleidahomeridiannamparivervalley
SHARED TOKENS (7): "canyon", "eagle", "idaho", "meridian", "nampa", "river", "valley".
0.140
changescommunityenforcementpolicepublicsafetysecurity
SHARED TOKENS (7): "changes", "community", "enforcement", "police", "public", "safety", "security".
0.140
Mounted police ↗ Q578015 KW CROSS HIGH
cannotdeathofficerpoliceresponsibleresultingsearch
SHARED TOKENS (7): "cannot", "death", "officer", "police", "responsible", "resulting", "search".
0.140
attorneybusinessfinancialformlegalpowerprincipal
SHARED TOKENS (7): "attorney", "business", "financial", "form", "legal", "power", "principal".
0.140
chaptercodefederalformgoverngovernstitle
SHARED TOKENS (7): "chapter", "code", "federal", "form", "govern", "governs", "title".
0.140
childcriminaljurisdictiononlinesexualstatutesstatutory
SHARED TOKENS (7): "child", "criminal", "jurisdiction", "online", "sexual", "statutes", "statutory".
0.140
analysiscourtfirearmslegalnationalspecialiststechnology
SHARED TOKENS (7): "analysis", "court", "firearms", "legal", "national", "specialists", "technology".
0.140
boisecitiesidahointerstaterangeriverserves
SHARED TOKENS (7): "boise", "cities", "idaho", "interstate", "range", "river", "serves".
0.120
Water police ↗ Q197617 KW CROSS HIGH
enforcementorganizationpoliceriverspecialtywater
SHARED TOKENS (6): "enforcement", "organization", "police", "river", "specialty", "water".
0.120
Prison officer ↗ Q311396 KW CROSS HIGH
custodyenforcementofficerregulationresponsiblesafety
SHARED TOKENS (6): "custody", "enforcement", "officer", "regulation", "responsible", "safety".
0.120
communityenforcementexpansionoperationspoliceserve
SHARED TOKENS (6): "community", "enforcement", "expansion", "operations", "police", "serve".
0.120
agenciescommercialcontractorscriminalenforcementjurisdiction
SHARED TOKENS (6): "agencies", "commercial", "contractors", "criminal", "enforcement", "jurisdiction".
0.120
accesscontactcourtcustodymattersrights
SHARED TOKENS (6): "access", "contact", "court", "custody", "matters", "rights".
0.120
Discrimination ↗ Q169207 KW CROSS HIGH
institutionslegalmembersrightssexualvictims
SHARED TOKENS (6): "institutions", "legal", "members", "rights", "sexual", "victims".
0.120
County police ↗ Q5177941 KW CROSS HIGH
enforcementjurisdictionnationalpoliceprimaryunified
SHARED TOKENS (6): "enforcement", "jurisdiction", "national", "police", "primary", "unified".
0.120
employmentimmigrationpermitprotectionsupportwork
SHARED TOKENS (6): "employment", "immigration", "permit", "protection", "support", "work".
0.120
businessentitylegalseparatetradework
SHARED TOKENS (6): "business", "entity", "legal", "separate", "trade", "work".
0.120
actionsamongconductpolicepropertysexual
SHARED TOKENS (6): "actions", "among", "conduct", "police", "property", "sexual".
0.100
Wrongful dismissal ↗ KW CROSS HIGH
employmentjurisdictionlegalpublicrights
SHARED TOKENS (5): "employment", "jurisdiction", "legal", "public", "rights".
0.100
civilcriminalfederalsourcesstatutes
SHARED TOKENS (5): "civil", "criminal", "federal", "sources", "statutes".
0.100
authorityemploymentpayrightswage
SHARED TOKENS (5): "authority", "employment", "pay", "rights", "wage".
0.100
organizedprimarysourcessystemunified
SHARED TOKENS (5): "organized", "primary", "sources", "system", "unified".
0.100
Due diligence ↗ Q794134 KW CROSS HIGH
appliesassetsbenefitsbusinesslegal
SHARED TOKENS (5): "applies", "assets", "benefits", "business", "legal".
0.100
DNA profiling ↗ Q476697 KW CROSS HIGH
analysiscriminalimmigrationmedicaluniversity
SHARED TOKENS (5): "analysis", "criminal", "immigration", "medical", "university".
0.100
Deposition ↗ Q1174534 KW CROSS HIGH
authoritycourtoutsidepoweruniversity
SHARED TOKENS (5): "authority", "court", "outside", "power", "university".
0.100
formproductspropertypublicresponsible
SHARED TOKENS (5): "form", "products", "property", "public", "responsible".
0.100
branchcivilcriminallegalproperty
SHARED TOKENS (5): "branch", "civil", "criminal", "legal", "property".
0.100
casescontextcourtlegallitigation
SHARED TOKENS (5): "cases", "context", "court", "legal", "litigation".
0.100
Negligence ↗ Q160070 KW CROSS HIGH
actionsconductinjuryphysicalproperty
SHARED TOKENS (5): "actions", "conduct", "injury", "physical", "property".
◈ Frequently Asked Questions
Police Law Enforcement × Legal — Treasure Valley
HAIKU · HIGH GATE
How does the Fourth Amendment protect Treasure Valley residents during police stops in Ada County?
The Fourth Amendment prohibits unreasonable searches and seizures, requiring Ada County police officers to establish probable cause before conducting searches during traffic stops or arrests in Boise and surrounding areas. Idaho courts, including the Idaho Supreme Court, enforce these protections through suppression of evidence obtained in violation of Fourth Amendment rights in criminal cases throughout the Treasure Valley.
What role does the Idaho Legislature play in defining criminal offenses that Nampa and Boise police enforce?
The Idaho Legislature codifies criminal offenses and penalties that shape how police departments in Nampa and Ada County conduct investigations and make arrests. Local law enforcement agencies in the Treasure Valley apply these statutes when charging individuals with crimes ranging from identity theft to domestic violence.
How does the Sixth Amendment affect criminal proceedings for suspects arrested by Treasure Valley police?
The Sixth Amendment guarantees the right to counsel for individuals arrested by Boise and Ada County police, requiring courts to provide legal representation before trial. Idaho Supreme Court rulings establish that police must inform suspects of this right during arrest procedures throughout the Treasure Valley.
What is the relationship between probation and parole supervision in Ada County criminal cases?
Idaho courts impose probation as a sentence alternative to incarceration for offenders convicted in Boise and Ada County, while parole releases prisoners early under state supervision. Both probation and parole conditions are monitored locally and enforced through the criminal justice system in the Treasure Valley.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Police Law Enforcement × Legal 23 QID bridges 303 edges 8,465 ext links 2026-07-17 22:48:22 UTC 6906a990a7bb99bc
Police Law Enforcement corridor ↗ Legal corridor ↗ Legal × Police Law Enforcement ↗ boisestandard.org/standard ↗
Parent Corridors
Police Law Enforcement × All Other Verticals