—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Nuclear Clean Energy ↔ relates to ↔ Manufacturing Food Processing

19 Wikipedia bridge articles confirmed in both vertical ledgers. 262 deterministic cross-vertical edges. 7,157 external source links harvested. Every edge provenance-stamped. Every claim auditable.

19 QID Bridge Articles
262 Cross Edges
7,157 External Sources
290 Wikipedia Articles
19 🌲 Evergreen
208 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Nuclear Clean Energy
× Manufacturing Food Processing
QID Bridge Articles
19
confirmed Wikipedia overlap
Total Cross Edges
262
External Sources Harvested
7,157
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
University of Idaho
score: 1.0000  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (19)
University of IdahoTreasure ValleySnake RiverBoise State UniversityClean Water ActSnake River PlainIdaho Department of Environmental QualityBoise RiverNampa, IdahoUnited States Environmental Protection AgencyBoise, IdahoBuilding codeOccupational Safety and Health AdministrationAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, IdahoKuna, IdahoPayette County, Idaho
Shared Semantics (20 tokens)
idahoboisemetropolitanpublicrivereastlargestresearchlocaloregonsnakewesterncanyonmajornorthwestwestenvironmentalfederalregulationsada
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:32:30 UTC
Content Hash
148546644ba95bc8
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
19 BRIDGES
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (19): "among", "approximately", "boise", "campus", "compete", "division", "established", "falls", "idaho", "operates", "production", "professional", "public", "research", "rural", "statewide", "students", "uidaho", "university". | EXACT TITLE in nuclear_clean_energy: "University of Idaho". | EXACT TITLE in manufacturing_food_processing: "University of Idaho".
amongapproximatelyboisecampuscompetedivisionestablishedfallsidahooperatesproductionprofessionalpublicresearchruralstatewidestudentsuidahouniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (16): "agricultural", "boise", "idaho", "land", "local", "metropolitan", "oregon", "owyhee", "payette", "region", "river", "rural", "snake", "treasure", "valley", "western". | EXACT TITLE in nuclear_clean_energy: "Treasure Valley". | EXACT TITLE in manufacturing_food_processing: "Treasure Valley".
agriculturalboiseidaholandlocalmetropolitanoregonowyheepayetteregionriverruralsnaketreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (48): "activities", "american", "beginning", "canyon", "central", "commercial", "constructed", "construction", "control", "covered", "developed", "east", "falls", "history", "host", "hydroelectric", "idaho", "irrigation", "large", "largest".... | EXACT TITLE in nuclear_clean_energy: "Snake River". | EXACT TITLE in manufacturing_food_processing: "Snake River".
activitiesamericanbeginningcanyoncentralcommercialconstructedconstructioncontrolcovereddevelopedeastfallshistoryhosthydroelectricidahoirrigationlargelargestlimitedmajornationalnearnorthnorthwestoregonpacificpolicyprivate+18
and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
River is a major river in the interior Pacific Northwest region of the United States. About 1,080 miles (1,740 km) long, it is the largest tributary of the Columbia River, which is the largest North American river that empties into the Pacific Ocean. Beginning in Yellowstone National Park, western Wyoming, it flows across the arid Snake River Plain of southern Idaho, the rugged Hells Canyon on the borders of Idaho, Oregon and Washington, and finally the rolling Palouse Hills of southeast Washington. It joins the Columbia River just downstream from the Tri-Cities, Washington, in the southern Columbia Basin. The river's watershed, which drains parts of six U.S. states, is situated between the Rocky Mountains to the north and east, the Great Basin to the south, and the Blue Mountains and Oregon high desert to the west. The region has a long history of volcanism; millions of years ago, Columbia River basalts covered vast areas of the western Snake River watershed, while the Snake River Plain was a product of the Yellowstone volcanic hotspot. The river was further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
as further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (23): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "health", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research", "total".... | EXACT TITLE in nuclear_clean_energy: "Boise State University". | EXACT TITLE in manufacturing_food_processing: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringhealthidahoindependentinstitutionprogramprogramspublicreportedresearchtotaluniversitiesuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (27): "act", "addressing", "administered", "chemical", "clean", "control", "directly", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "maintain", "major", "owned", "physical", "protection", "provisions".... | EXACT TITLE in manufacturing_food_processing: "Clean Water Act".
actaddressingadministeredchemicalcleancontroldirectlyengineersenvironmentalfederalformgoverninginvolvinglawmaintainmajorownedphysicalprotectionprovisionsqualityregulationsthoughtreatmentwastewaterwaterworks
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Snake River Plain
Q1396049 EXACT TITLE 0.900
QID OVERLAP: Q1396049 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (10): "agricultural", "east", "idaho", "land", "largest", "major", "northwest", "river", "snake", "southern". | EXACT TITLE in manufacturing_food_processing: "Snake River Plain".
agriculturaleastidaholandlargestmajornorthwestriversnakesouthern
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
Idaho Department of Environmental Quality
Q5987351 EXACT TITLE 0.880
QID OVERLAP: Q5987351 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (9): "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Environmental Quality". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Environmental Quality".
boisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulations
tment of Environmental Quality is the department of the Idaho state government responsible for administering state and federal environmental laws and regulations. The department's main offices are in Boise, and six regional offices are also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act.
also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act. Before 2000, DEQ in Idaho was a division of the Department of Health and Welfare. Structure and functions It is organized into five divisions: Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Boise River
Q891080 EXACT TITLE 0.860
QID OVERLAP: Q891080 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (8): "agricultural", "approximately", "boise", "highly", "idaho", "river", "snake", "western". | EXACT TITLE in manufacturing_food_processing: "Boise River".
agriculturalapproximatelyboisehighlyidahoriversnakewestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "nampa", "northwest", "principal", "second", "university", "west", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannampanorthwestprincipalseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (33): "department", "education", "energy", "engineers", "environmental", "establishing", "establishment", "federal", "federally", "financial", "government", "headquarters", "independent", "industries", "information", "laboratories", "legal", "local", "matters", "monitoring"....
departmenteducationenergyengineersenvironmentalestablishingestablishmentfederalfederallyfinancialgovernmentheadquartersindependentindustriesinformationlaboratorieslegallocalmattersmonitoringnationaloperationpermittingprogramsprotectionpublicregionalresearchspecialistsstandards+3
use and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (20): "ada", "annual", "boise", "capital", "counties", "east", "employers", "estimated", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "north", "oregon", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountieseastemployersestimatedhomeidaholocallymajormanufacturingmetropolitannorthoregonrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Building code
Q2333573 QID OVERLAP 0.800
QID OVERLAP: Q2333573 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (45): "authority", "building", "buildings", "case", "charges", "code", "codes", "compliance", "construction", "control", "departments", "design", "district", "effects", "electrical", "engineers", "environmental", "estate", "facility", "general"....
authoritybuildingbuildingscasechargescodecodescomplianceconstructioncontroldepartmentsdesigndistricteffectselectricalengineersenvironmentalestatefacilitygeneralhealthinternationaljurisdictionlawlocalmaterialsmechanicalmodelnationalplanning+15
o consider the effects of soil liquefaction in the design of new buildings. The building code becomes law of a particular jurisdiction when formally enacted by the appropriate governmental or private authority. Building codes are generally intended to be applied by architects, engineers, interior designers, constructors and regulators but are also used for various purposes by safety inspectors, environmental scientists, real estate developers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
odes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments. Building Control regularisation charges apply in case work is undertaken which should have had been inspected at the time of the work if this was not done. Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
O
Q746186 QID OVERLAP 0.800
QID OVERLAP: Q746186 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (19): "act", "conditions", "credit", "department", "education", "effects", "employment", "established", "federal", "health", "labor", "law", "occupational", "regulations", "regulatory", "safety", "sales", "standards", "training".
actconditionscreditdepartmenteducationeffectsemploymentestablishedfederalhealthlaborlawoccupationalregulationsregulatorysafetysalesstandardstraining
States Department of Labor that originally had federal visitorial powers to inspect and examine workplaces. The United States Congress established the agency under the Occupational Safety and Health Act (OSH Act), which President Richard M. Nixon signed into law on December 29, 1970. OSHA's mission is to "assure safe and healthy working conditions for working men and women by setting and enforcing standards and by providing training, outreach, education, and assistance". The agency is also charged with enforcing a variety of whistleblower statutes and regulations.
History From its creation in 1934, the Bureau of Labor Standards of the Department of Labor addressed some work safety issues. The economic boom and associated labor turnover during World War II worsened work safety in nearly all areas of the United States economy, but after 1945 accidents again declined as long-term forces reasserted themselves. Additionally, new and powerful labor unions played an increasingly important role in worker safety post-World War II. In the 1960s, increasing economic expansion again led to rising injury rates, and the resulting political pressures led Congress to establish the Occupational Safety and Health Administration (OSHA) on April 28, 1971, the date that the Occupational Health and Safety Act became effective. The new agency incorporated much of what had been the original Bureau of Labor Standards. George Guenther was appointed by Labor Secretary James D. Hodgson as the agency's first director. OSHA has run a number of training, compliance assistance, and health and safety recognition programs throughout its history. The OSHA Training Institute, which trains government and private sector health and safety personnel, began in 1972. In 1978, the agency began a grant-making program, now called the Susan Harwood Training Grant Program, to train workers and employers in reducing workplace hazards.
OSH Act coverage The OSH Act covers most private-sector employers and their workers, in addition to some public-sector employers and workers in the 50 states and certain territories and jurisdictions under federal authority. Those jurisdictions include the District of Columbia, Puerto Rico, the Virgin Islands, American Samoa, Guam, Northern Mariana Islands, Wake Island, Johnston Island, and the Outer Continental Shelf Lands as defined in the Outer Continental Shelf Lands Act. Private sector employers The OSH Act covers most private sector employers in all 50 states, the District of Columbia, and other U.S. jurisdictions—either directly through federal OSHA or through an OSHA-approved state plan. State plans are OSHA-approved job safety and health programs operated by individual states instead of federal OSHA. Federal OSHA approves and monitors all state plans and provides as much as fifty percent of the funding for each program.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in nuclear_clean_energy (tier:evergreen) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (17): "ada", "boise", "capital", "district", "east", "estimated", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "northwest", "pacific", "private", "second", "washington".
adaboisecapitaldistricteastestimatedhomeidahojurisdictionlargestlocalmetropolitannorthwestpacificprivatesecondwashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "oregon", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanoregonwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "largest", "making", "metropolitan", "nampa".
boisecaldwellcanyonestimatedidaholargestmakingmetropolitannampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "second".
adaamongboisecapitalidahomakingmeridiansecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent".
adaadditionalboiseidahokunametropolitanpercent
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Payette County, Idaho
Q491432 QID OVERLAP 0.560
QID OVERLAP: Q491432 in nuclear_clean_energy (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (3): "idaho", "largest", "payette".
idaholargestpayette
Payette County is a county located in Idaho, United States. As of the 2020 census, the population was 25,386. The county seat and largest city is Payette. Payette County is part of the Ontario micropolitan area. History The county was established in 1917, partitioned from Canyon County. It was named after the Payette River, which was named after French-Canadian François Payette.
History The county was established in 1917, partitioned from Canyon County. It was named after the Payette River, which was named after French-Canadian François Payette. Originally a fur trapper with the North West Company, Payette was the first white man in the area in 1818. Payette County is one of the few counties in Idaho to be the home to the endangered Idaho ground squirrel. Geography According to the U.S. Census Bureau, the county has a total area of 410 square miles (1,100 km2), of which 407 square miles (1,050 km2) is land and 3.4 square miles (8.8 km2) (0.8%) is water.
Geography According to the U.S. Census Bureau, the county has a total area of 410 square miles (1,100 km2), of which 407 square miles (1,050 km2) is land and 3.4 square miles (8.8 km2) (0.8%) is water.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
243 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP243 edges
🌲 EVERGREEN1 edges
0.610
activityamongcampusfallsidahomeridianpercentprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (13): "activity", "among", "campus", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "universities", "university". | URL->A (1): http://www.isu.edu/. | EXACT TITLE in nuclear_clean_energy: "Idaho State University".
🌿 BRANCH207 edges
0.590
alliancecleandifferenteducationenergyidahoidentifyorganizationpowerriversnakewaste
SHARED TOKENS (12): "alliance", "clean", "different", "education", "energy", "idaho", "identify", "organization", "power", "river", "snake", "waste". | URL->A (1): http://snakeriveralliance.org/. | EXACT TITLE in nuclear_clean_energy: "Snake River Alliance".
0.500
changingchemicaldevelopmentdistributeddistributioneconomiceconomyelectricenergygenerationheatinghistoryindustrialpowerpoweredprocessprocessesruralsourcestorage
SHARED TOKENS (23): "changing", "chemical", "development", "distributed", "distribution", "economic", "economy", "electric", "energy", "generation", "heating", "history", "industrial", "power", "powered", "process", "processes", "rural", "source", "storage".... | EXACT TITLE in nuclear_clean_energy: "Electrification".
0.500
Onion ↗ Q23485 EXACT TITLE
annualbasebecomecasecentralchemicalcontainscropestablishedfoodformgrowingmultipleplantscaleseparateservedstorage
SHARED TOKENS (18): "annual", "base", "become", "case", "central", "chemical", "contains", "crop", "established", "food", "form", "growing", "multiple", "plant", "scale", "separate", "served", "storage". | EXACT TITLE in manufacturing_food_processing: "Onion".
0.500
additionalappliesapprovalauthoritybeyondcategoryconsumerconventionalexistingexistsfoodfunctionsgovernmenthealthmanufacturingplantspracticesprocessprocessingrather
SHARED TOKENS (26): "additional", "applies", "approval", "authority", "beyond", "category", "consumer", "conventional", "existing", "exists", "food", "functions", "government", "health", "manufacturing", "plants", "practices", "process", "processing", "rather".... | EXACT TITLE in manufacturing_food_processing: "Functional food".
0.500
additionsconditionsconstructedconstructioncontroldepartmentenergyfacilityidahoinstrumentationinterestlaboratorymaterialmaterialsnationaloperatedoperationplantsprogramschedule
SHARED TOKENS (24): "additions", "conditions", "constructed", "construction", "control", "department", "energy", "facility", "idaho", "instrumentation", "interest", "laboratory", "material", "materials", "national", "operated", "operation", "plants", "program", "schedule".... | EXACT TITLE in nuclear_clean_energy: "Transient Reactor Test Facility".
0.500
Kitchen ↗ Q43164 EXACT TITLE
coldcommercialconstructiondesigndevelopedelectricequipmentestablishmentfacilitiesfoodfunctionshealthhospitalslargelargerlawmarketpreparationpublicrelated
SHARED TOKENS (27): "cold", "commercial", "construction", "design", "developed", "electric", "equipment", "establishment", "facilities", "food", "functions", "health", "hospitals", "large", "larger", "law", "market", "preparation", "public", "related".... | EXACT TITLE in manufacturing_food_processing: "Kitchen".
0.500
Wheat ↗ Q15645384 EXACT TITLE
cropdemandfoodgeneralgloballandlargermajormakingmultiplenorthproductionqualityrecordsecondsmallsource
SHARED TOKENS (17): "crop", "demand", "food", "general", "global", "land", "larger", "major", "making", "multiple", "north", "production", "quality", "record", "second", "small", "source". | EXACT TITLE in nuclear_clean_energy: "Wheat".
0.500
actactsaddauthoritycontrolfederalfoodformformedgivingimplementationlawnationalprincipalproductprovisionsregulationsrequirementssafety
SHARED TOKENS (19): "act", "acts", "add", "authority", "control", "federal", "food", "form", "formed", "giving", "implementation", "law", "national", "principal", "product", "provisions", "regulations", "requirements", "safety". | EXACT TITLE in manufacturing_food_processing: "Federal Food, Drug, and Cosmetic Act".
0.500
activitiesadvancedagriculturalagriculturebusinessescasedirectdistributioneasteffectsenvironmentalindustrialirrigationmanagementmunicipalnorthpracticeprocessrecyclingregion
SHARED TOKENS (31): "activities", "advanced", "agricultural", "agriculture", "businesses", "case", "direct", "distribution", "east", "effects", "environmental", "industrial", "irrigation", "management", "municipal", "north", "practice", "process", "recycling", "region".... | EXACT TITLE in manufacturing_food_processing: "Reclaimed water".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotcasescertificationchainchemicalconsumerconsumerscreatesdescribingdevelopedestimatedfactfoodhealthinspectionlessmanagementmarketorganizationpersons
SHARED TOKENS (29): "cannot", "cases", "certification", "chain", "chemical", "consumer", "consumers", "creates", "describing", "developed", "estimated", "fact", "food", "health", "inspection", "less", "management", "market", "organization", "persons".... | EXACT TITLE in manufacturing_food_processing: "Food safety".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowedbuildingbuildingscasecombinedeterminedevelopeddevelopmentdifferentformgovernmentindustriallandland-uselocalmunicipalityplacesplanningpolicy
SHARED TOKENS (31): "activities", "allowed", "building", "buildings", "case", "combine", "determine", "developed", "development", "different", "form", "government", "industrial", "land", "land-use", "local", "municipality", "places", "planning", "policy".... | EXACT TITLE in nuclear_clean_energy: "Zoning". | EXACT TITLE in manufacturing_food_processing: "Zoning".
0.500
activitiesactivityadministrativeassociatedassuranceconsumerscontainscontrolcorecustomercustomersdefinesdefiningdescribeddesigndevelopmentdifferentengineeringfactgoals
SHARED TOKENS (47): "activities", "activity", "administrative", "associated", "assurance", "consumers", "contains", "control", "core", "customer", "customers", "defines", "defining", "described", "design", "development", "different", "engineering", "fact", "goals".... | EXACT TITLE in nuclear_clean_energy: "Quality assurance". | EXACT TITLE in manufacturing_food_processing: "Quality assurance".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationavailabilitybuildingcleanconstructioncriticaldesigndevelopedearlyengineeringfarmingforcefunctionsgoverninghealthindustrialirrigationlandlarge
SHARED TOKENS (40): "additional", "application", "availability", "building", "clean", "construction", "critical", "design", "developed", "early", "engineering", "farming", "force", "functions", "governing", "health", "industrial", "irrigation", "land", "large".... | EXACT TITLE in nuclear_clean_energy: "Dam". | EXACT TITLE in manufacturing_food_processing: "Dam".
0.500
agriculturaldivisioneastidaholargermajornationalnearnorthpayetteriversectionsnakevalleywest
SHARED TOKENS (15): "agricultural", "division", "east", "idaho", "larger", "major", "national", "near", "north", "payette", "river", "section", "snake", "valley", "west". | EXACT TITLE in nuclear_clean_energy: "Payette River".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlyfallslandlargemajorplantspotentiallyrelatedsurfacetreatmentwater
SHARED TOKENS (15): "become", "create", "demand", "developed", "directly", "falls", "land", "large", "major", "plants", "potentially", "related", "surface", "treatment", "water". | EXACT TITLE in manufacturing_food_processing: "Stormwater".
0.500
Drought ↗ Q43059 EXACT TITLE
activityagricultureairannualavailabilitybecomebecomingclimateconditionsdirectlyeconomiceconomyeffectselectricenvironmentalexperiencefarmingfoodfuturehealth
SHARED TOKENS (37): "activity", "agriculture", "air", "annual", "availability", "become", "becoming", "climate", "conditions", "directly", "economic", "economy", "effects", "electric", "environmental", "experience", "farming", "food", "future", "health".... | EXACT TITLE in nuclear_clean_energy: "Drought".
0.500
agricultureapplicationcasesclimatecommonlyconditionscropeconomicfieldgasirrigationmanagementneednutrientpathwayspracticepracticesqualityreducingsite
SHARED TOKENS (24): "agriculture", "application", "cases", "climate", "commonly", "conditions", "crop", "economic", "field", "gas", "irrigation", "management", "need", "nutrient", "pathways", "practice", "practices", "quality", "reducing", "site".... | EXACT TITLE in manufacturing_food_processing: "Nutrient management".
0.500
businessdistributionelectricalgasgenerationhydroelectricidahooperatesoregonplantspowerregulatedriversnakesoldsouthernutility
SHARED TOKENS (17): "business", "distribution", "electrical", "gas", "generation", "hydroelectric", "idaho", "operates", "oregon", "plants", "power", "regulated", "river", "snake", "sold", "southern", "utility". | EXACT TITLE in nuclear_clean_energy: "Idaho Power".
0.500
Private label ↗ EXACT TITLE
allowedamongcaseschaincompetecontractdirectlydistinctmakesmanufacturingmultiplenationalownedprivateproductrolesoldspecificationsvalue
SHARED TOKENS (19): "allowed", "among", "cases", "chain", "compete", "contract", "directly", "distinct", "makes", "manufacturing", "multiple", "national", "owned", "private", "product", "role", "sold", "specifications", "value". | EXACT TITLE in manufacturing_food_processing: "Private label".
0.500
applicationapproximatelycommonlycurrentdepartmenteastemploysenergyengineeringenvironmentalfacilitiesfacilityfallshistoryidahoknowledgelaboratorieslaboratorylargestnational
SHARED TOKENS (28): "application", "approximately", "commonly", "current", "department", "east", "employs", "energy", "engineering", "environmental", "facilities", "facility", "falls", "history", "idaho", "knowledge", "laboratories", "laboratory", "largest", "national".... | EXACT TITLE in nuclear_clean_energy: "Idaho National Laboratory".
0.500
agreementamericanboisecenterschaincomdistributionfoodidaholargestlistoperatedoregonownedprivatelyretailsectionswashington
SHARED TOKENS (18): "agreement", "american", "boise", "centers", "chain", "com", "distribution", "food", "idaho", "largest", "list", "operated", "oregon", "owned", "privately", "retail", "sections", "washington". | EXACT TITLE in manufacturing_food_processing: "WinCo Foods".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralcommercialconnectedconsumercontrolcustomerdifferentdistributionelectricelectricalenergyfunctionsgenerationindustrialinfrastructurelargelargeroperatedowned
SHARED TOKENS (28): "approximately", "central", "commercial", "connected", "consumer", "control", "customer", "different", "distribution", "electric", "electrical", "energy", "functions", "generation", "industrial", "infrastructure", "large", "larger", "operated", "owned".... | EXACT TITLE in nuclear_clean_energy: "Substation".
0.500
activityconditionscontroldevelopedelectricalgeneralhousingindustriallargelimitedlinesmanufacturingnoiseoperationoperationsoutputprocessprocessesproducedprograms
SHARED TOKENS (25): "activity", "conditions", "control", "developed", "electrical", "general", "housing", "industrial", "large", "limited", "lines", "manufacturing", "noise", "operation", "operations", "output", "process", "processes", "produced", "programs".... | EXACT TITLE in manufacturing_food_processing: "Programmable logic controller".
0.500
apprenticeshipapprenticeshipscasescertificationcompetenceemployerfieldformallaborlicenseon-the-joboutsidepracticeprofessionalregulatedrolessystemtraining
SHARED TOKENS (18): "apprenticeship", "apprenticeships", "cases", "certification", "competence", "employer", "field", "formal", "labor", "license", "on-the-job", "outside", "practice", "professional", "regulated", "roles", "system", "training". | EXACT TITLE in nuclear_clean_energy: "Apprenticeship". | EXACT TITLE in manufacturing_food_processing: "Apprenticeship".
0.500
chainconsumerconsumerscustomersdirectdirectlydistributionfacilitiesindependentlinkedmanagementmaterialsnetworkproductstructuresupplierssupplysystemsystemsvalue
SHARED TOKENS (20): "chain", "consumer", "consumers", "customers", "direct", "directly", "distribution", "facilities", "independent", "linked", "management", "materials", "network", "product", "structure", "suppliers", "supply", "system", "systems", "value". | EXACT TITLE in nuclear_clean_energy: "Supply chain".
0.500
additionalagriculturalcontrolcurrentfoodlaboratorylicensingmanagementmanufacturingpersonnelpracticepracticesproductprovidepurposequalityregulatoryrelevantrequirementsrules
SHARED TOKENS (23): "additional", "agricultural", "control", "current", "food", "laboratory", "licensing", "management", "manufacturing", "personnel", "practice", "practices", "product", "provide", "purpose", "quality", "regulatory", "relevant", "requirements", "rules".... | EXACT TITLE in manufacturing_food_processing: "Good manufacturing practice".
0.500
airapplicationsassociatedaveragecapacityconstructioncontrolledenergyestimatedfuturegasgenerationgloballargestlessnearnetoperatedplantplants
SHARED TOKENS (31): "air", "applications", "associated", "average", "capacity", "construction", "controlled", "energy", "estimated", "future", "gas", "generation", "global", "largest", "less", "near", "net", "operated", "plant", "plants".... | EXACT TITLE in nuclear_clean_energy: "Nuclear power".
0.500
Logistics ↗ Q177777 EXACT TITLE
chainconsumptioncustomersdedicatedequipmentfacilityfieldfoodinformationlinesmanagementmaterialmaterialsmodelmovingoperationalphysicalplanningplantsproduction
SHARED TOKENS (28): "chain", "consumption", "customers", "dedicated", "equipment", "facility", "field", "food", "information", "lines", "management", "material", "materials", "model", "moving", "operational", "physical", "planning", "plants", "production".... | EXACT TITLE in manufacturing_food_processing: "Logistics".
0.500
Packaging ↗ Q207822 EXACT TITLE
americanassociatedbusinesscommunicationcontainscoordinatedcovereddescribeddistributiongoverninggovernmentindustrialinstitutionalintegratedprocessproducingprotectionregulationsseparatestorage
SHARED TOKENS (22): "american", "associated", "business", "communication", "contains", "coordinated", "covered", "described", "distribution", "governing", "government", "industrial", "institutional", "integrated", "process", "producing", "protection", "regulations", "separate", "storage".... | EXACT TITLE in manufacturing_food_processing: "Packaging".
0.500
businessescapacityconsumersconsumptioncustomercustomersdemanddirectdirectlyeconomicelectricenergygeneralimplicationlargeloadmanagementnetoperatepanels
SHARED TOKENS (36): "businesses", "capacity", "consumers", "consumption", "customer", "customers", "demand", "direct", "directly", "economic", "electric", "energy", "general", "implication", "large", "load", "management", "net", "operate", "panels".... | EXACT TITLE in nuclear_clean_energy: "Demand response".
0.500
actactivitiesapplicantsapproximatelycertificationcommonlycomplyconcentratesdecisionsdefinesdepartmentdifferentenergyenvironmentalexperiencefacilitiesfacilityformguidancehighly
SHARED TOKENS (56): "act", "activities", "applicants", "approximately", "certification", "commonly", "comply", "concentrates", "decisions", "defines", "department", "different", "energy", "environmental", "experience", "facilities", "facility", "form", "guidance", "highly".... | EXACT TITLE in nuclear_clean_energy: "Nuclear material".
0.500
agriculturalagriculturechemicalclassificationclassificationsdifferentenvironmentalfoodformformshomeindustrialmakingphysicalprocessingproductreducingrolestotalwaste
SHARED TOKENS (20): "agricultural", "agriculture", "chemical", "classification", "classifications", "different", "environmental", "food", "form", "forms", "home", "industrial", "making", "physical", "processing", "product", "reducing", "roles", "total", "waste". | EXACT TITLE in nuclear_clean_energy: "Food processing". | EXACT TITLE in manufacturing_food_processing: "Food processing".
0.500
agriculturalcentralchemicalconsumersdesigndevelopmentdirectlyearlyfieldfoodlinkedmaterialspanelspracticesprocessesprocessingproductionsafetyscopetechnology
SHARED TOKENS (21): "agricultural", "central", "chemical", "consumers", "design", "development", "directly", "early", "field", "food", "linked", "materials", "panels", "practices", "processes", "processing", "production", "safety", "scope", "technology".... | EXACT TITLE in manufacturing_food_processing: "Food science".
0.500
academicagriculturalappliesbroaderchemicalcommercializationcontroldesigndevelopmentdistributionelectricalengineeringengineersfieldfoodindustrialinstrumentationknowledgemanufacturingmaterials
SHARED TOKENS (29): "academic", "agricultural", "applies", "broader", "chemical", "commercialization", "control", "design", "development", "distribution", "electrical", "engineering", "engineers", "field", "food", "industrial", "instrumentation", "knowledge", "manufacturing", "materials".... | EXACT TITLE in manufacturing_food_processing: "Food engineering".
0.500
airamericanbecomecertificationcertifiedconsumerdesignelectricalenergyfieldformedheatinginstallationinternationaljobsknowledgelicensemaintenancemultiplenationally
SHARED TOKENS (46): "air", "american", "become", "certification", "certified", "consumer", "design", "electrical", "energy", "field", "formed", "heating", "installation", "international", "jobs", "knowledge", "license", "maintenance", "multiple", "nationally".... | EXACT TITLE in nuclear_clean_energy: "North American Board of Certified Energy Practitioners".
0.500
applicationdemonstratesdependseducationenvironmentalexperiencefacilitiesfieldgovernmenthealthknowledgemakingpowerprincipallyproducedprofessionalprotectionqualifyingregulationsrelated
SHARED TOKENS (25): "application", "demonstrates", "depends", "education", "environmental", "experience", "facilities", "field", "government", "health", "knowledge", "making", "power", "principally", "produced", "professional", "protection", "qualifying", "regulations", "related".... | EXACT TITLE in nuclear_clean_energy: "Health physics".
0.500
climatecombustiondemanddirectlydistributionelectricelectricalenergyeventuallyformsgasgenerationglobalmeansplantplantspowerprocessproducedproduction
SHARED TOKENS (27): "climate", "combustion", "demand", "directly", "distribution", "electric", "electrical", "energy", "eventually", "forms", "gas", "generation", "global", "means", "plant", "plants", "power", "process", "produced", "production".... | EXACT TITLE in nuclear_clean_energy: "Electricity generation".
0.500
activitiesagriculturalairamongapplicationchargesdevelopmentelectricenvironmentalformationhealthhistoryimpactsinvolvinglegalmaterialsnationalownershipplanningpractice
SHARED TOKENS (26): "activities", "agricultural", "air", "among", "application", "charges", "development", "electric", "environmental", "formation", "health", "history", "impacts", "involving", "legal", "materials", "national", "ownership", "planning", "practice".... | EXACT TITLE in nuclear_clean_energy: "Cloud seeding".
0.500
additionsamongcapacitycleanconstructedconstructiondemanddirectelectricalenergyenvironmentalgasgenerationglobalhydroelectriclandlargelargestlessmaking
SHARED TOKENS (38): "additions", "among", "capacity", "clean", "constructed", "construction", "demand", "direct", "electrical", "energy", "environmental", "gas", "generation", "global", "hydroelectric", "land", "large", "largest", "less", "making".... | EXACT TITLE in nuclear_clean_energy: "Hydroelectricity".
0.500
actdisposalenergyestablishedfacilitiesfunctionsgovernmenthealthlicensingmaterialsoperationsoversightpublicrecyclingregulationregulatoryrelatedrenewalsafetyspent
SHARED TOKENS (21): "act", "disposal", "energy", "established", "facilities", "functions", "government", "health", "licensing", "materials", "operations", "oversight", "public", "recycling", "regulation", "regulatory", "related", "renewal", "safety", "spent".... | EXACT TITLE in nuclear_clean_energy: "Nuclear Regulatory Commission".
0.500
addamongcapacitycentercenterscommercialconstructionconventionalcustomersdatademanddesignelectricalexternalfinancialgenerationinstallationinterestlargeless
SHARED TOKENS (37): "add", "among", "capacity", "center", "centers", "commercial", "construction", "conventional", "customers", "data", "demand", "design", "electrical", "external", "financial", "generation", "installation", "interest", "large", "less".... | EXACT TITLE in nuclear_clean_energy: "Small modular reactor".
0.500
annualchemicalconversioncurrentdedicatedenergygasgenerationglobalindustriallargelessmarketprocessproducedproducingproductproductionstoragesupply
SHARED TOKENS (22): "annual", "chemical", "conversion", "current", "dedicated", "energy", "gas", "generation", "global", "industrial", "large", "less", "market", "process", "produced", "producing", "product", "production", "storage", "supply".... | EXACT TITLE in nuclear_clean_energy: "Hydrogen production".
0.500
Cold War ↗ Q8683 EXACT TITLE
alliancecoldconventionaldirectdivisionearlyeconomicinfluenceinternationalmajornorthplanregionalsecondspacesupportthoughunionwestern
SHARED TOKENS (19): "alliance", "cold", "conventional", "direct", "division", "early", "economic", "influence", "international", "major", "north", "plan", "regional", "second", "space", "support", "though", "union", "western". | EXACT TITLE in nuclear_clean_energy: "Cold War".
0.500
Retail ↗ Q126793 EXACT TITLE
accessalongsideanalysisbroaderbusinesscapabilitiescarrycenterchaincombinecommonlycompetitionconsumerscorecreditcustomercustomersdecisionsdescribeddesign
SHARED TOKENS (56): "access", "alongside", "analysis", "broader", "business", "capabilities", "carry", "center", "chain", "combine", "commonly", "competition", "consumers", "core", "credit", "customer", "customers", "decisions", "described", "design".... | EXACT TITLE in nuclear_clean_energy: "Retail". | EXACT TITLE in manufacturing_food_processing: "Retail".
0.500
adaairbaseboisecentercommercialdepartmentfacilityfallsfieldfirefunctionsgeneralidahointernationalnationaloperatedoperatesprotectionsupport
SHARED TOKENS (22): "ada", "air", "base", "boise", "center", "commercial", "department", "facility", "falls", "field", "fire", "functions", "general", "idaho", "international", "national", "operated", "operates", "protection", "support".... | EXACT TITLE in manufacturing_food_processing: "Boise Airport".
0.500
Albertsons ↗ EXACT TITLE
acquiredacquisitionamericanboisecapitalchainconsumerscorporatecustomerdifferentearlyfederalgeneralheadquarteredidahojobslargestlesslistmanagement
SHARED TOKENS (27): "acquired", "acquisition", "american", "boise", "capital", "chain", "consumers", "corporate", "customer", "different", "early", "federal", "general", "headquartered", "idaho", "jobs", "largest", "less", "list", "management".... | EXACT TITLE in manufacturing_food_processing: "Albertsons".
0.500
airapplicationcarrycommonlyconsumptiondevelopeddirectlydistributionearlyenergyforcegasindustriallargemajormunicipaloperateoperationspercentplant
SHARED TOKENS (29): "air", "application", "carry", "commonly", "consumption", "developed", "directly", "distribution", "early", "energy", "force", "gas", "industrial", "large", "major", "municipal", "operate", "operations", "percent", "plant".... | EXACT TITLE in manufacturing_food_processing: "Compressed air".
0.500
consumptionconversioneconomyelectricalenergylessmechanicalnetoutputpowerprocessproducespurposereducingsourcetransportationwork
SHARED TOKENS (17): "consumption", "conversion", "economy", "electrical", "energy", "less", "mechanical", "net", "output", "power", "process", "produces", "purpose", "reducing", "source", "transportation", "work". | EXACT TITLE in nuclear_clean_energy: "Energy efficiency".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralconditionsconsolidationcontrolcontrolleddevelopeddirectlydischargedistributeddistributioneffectsenvironmentalfieldformimprovementsinstallation
SHARED TOKENS (47): "agricultural", "agriculture", "application", "applies", "central", "conditions", "consolidation", "control", "controlled", "developed", "directly", "discharge", "distributed", "distribution", "effects", "environmental", "field", "form", "improvements", "installation".... | EXACT TITLE in nuclear_clean_energy: "Irrigation". | EXACT TITLE in manufacturing_food_processing: "Irrigation".
0.500
chemicalconventionalcoolingdemandelectricalenergyfoodformformshydroelectriclargemultipleoperatepowerprocessproducedproductionprovidescalestorage
SHARED TOKENS (20): "chemical", "conventional", "cooling", "demand", "electrical", "energy", "food", "form", "forms", "hydroelectric", "large", "multiple", "operate", "power", "process", "produced", "production", "provide", "scale", "storage". | EXACT TITLE in nuclear_clean_energy: "Energy storage".
0.500
competencecontrolcontrolsdefinesexperienceinspectionknowledgemaintainmajormanagementpersonnelphysicalplacesprocessprocessesproductproductionqualityrecordsrelationships
SHARED TOKENS (25): "competence", "control", "controls", "defines", "experience", "inspection", "knowledge", "maintain", "major", "management", "personnel", "physical", "places", "process", "processes", "product", "production", "quality", "records", "relationships".... | EXACT TITLE in nuclear_clean_energy: "Quality control".
0.500
applicationscapacityclimatecommercialconcentratedcontinuingconversioncurrentdevelopeddirectlyeffectelectricenergygenerationglobalintegrationinternationallargelargestpanels
SHARED TOKENS (32): "applications", "capacity", "climate", "commercial", "concentrated", "continuing", "conversion", "current", "developed", "directly", "effect", "electric", "energy", "generation", "global", "integration", "international", "large", "largest", "panels".... | EXACT TITLE in nuclear_clean_energy: "Solar power".
0.500
agricultureairapplicationsaveragebuildingchainclimatecoldconditionsconsumerconsumptioncontrolledcoolingdevelopeddevelopmentdistributionearlyenergyfarmsfood
SHARED TOKENS (54): "agriculture", "air", "applications", "average", "building", "chain", "climate", "cold", "conditions", "consumer", "consumption", "controlled", "cooling", "developed", "development", "distribution", "early", "energy", "farms", "food".... | EXACT TITLE in manufacturing_food_processing: "Refrigeration".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessesdirectlyfacilityfunctionindustriallargeloadloadingmanufacturingmaterialsmovingproduction
SHARED TOKENS (16): "agriculture", "associated", "building", "buildings", "businesses", "directly", "facility", "function", "industrial", "large", "load", "loading", "manufacturing", "materials", "moving", "production". | EXACT TITLE in manufacturing_food_processing: "Warehouse".
0.500
actagricultureauthoritycommercialdepartmentfederalfoodgovernmenthealthinspectionjurisdictionpublicregulatorysafetysubjectsupply
SHARED TOKENS (16): "act", "agriculture", "authority", "commercial", "department", "federal", "food", "government", "health", "inspection", "jurisdiction", "public", "regulatory", "safety", "subject", "supply". | EXACT TITLE in manufacturing_food_processing: "Food Safety and Inspection Service".
0.500
academicadaboisecampuscanyoncareercollegecountiescreditcwidevelopmenteducationgovernedidaholargenampanorthprogramspublicreported
SHARED TOKENS (29): "academic", "ada", "boise", "campus", "canyon", "career", "college", "counties", "credit", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "north", "programs", "public", "reported".... | EXACT TITLE in nuclear_clean_energy: "College of Western Idaho". | EXACT TITLE in manufacturing_food_processing: "College of Western Idaho".
0.500
actassociatedauthoritycontrolcurrentdepartmentdirectlyfederalfieldfoodheadquartershealthlaboratorieslaboratorypublicregulatedregulationsrelatedreportssafety
SHARED TOKENS (23): "act", "associated", "authority", "control", "current", "department", "directly", "federal", "field", "food", "headquarters", "health", "laboratories", "laboratory", "public", "regulated", "regulations", "related", "reports", "safety".... | EXACT TITLE in manufacturing_food_processing: "Food and Drug Administration".
0.500
Potato ↗ Q10998 EXACT TITLE
becomecropdifferentexpansionfoodplantproductionrapidregionremainssecondshowsinglesouthernsupply
SHARED TOKENS (15): "become", "crop", "different", "expansion", "food", "plant", "production", "rapid", "region", "remains", "second", "show", "single", "southern", "supply". | EXACT TITLE in manufacturing_food_processing: "Potato".
0.500
Cheese ↗ Q10943 EXACT TITLE
activitydairydistributionexistexpertisefoodformslayermarketspaperprocessingproducedproductproductionpurchasingreceivingstoragewater
SHARED TOKENS (18): "activity", "dairy", "distribution", "exist", "expertise", "food", "forms", "layer", "markets", "paper", "processing", "produced", "product", "production", "purchasing", "receiving", "storage", "water". | EXACT TITLE in manufacturing_food_processing: "Cheese".
0.500
Data center ↗ Q671224 EXACT TITLE
academicactaloneassociatedbuildingcentercenterscleanconditionsconnectionconsumeconsumptioncontainscontrolcovereddatadefinesdemanddifferentearly
SHARED TOKENS (67): "academic", "act", "alone", "associated", "building", "center", "centers", "clean", "conditions", "connection", "consume", "consumption", "contains", "control", "covered", "data", "defines", "demand", "different", "early".... | EXACT TITLE in nuclear_clean_energy: "Data center".
0.500
analysisapplicationcontrolcreatedatadistinguisheffectsengineeringestablishevidenceformgraphhealthcareidentifyidentifyingindustrialmanufacturingoperationsplantsprocess
SHARED TOKENS (21): "analysis", "application", "control", "create", "data", "distinguish", "effects", "engineering", "establish", "evidence", "form", "graph", "healthcare", "identify", "identifying", "industrial", "manufacturing", "operations", "plants", "process".... | EXACT TITLE in manufacturing_food_processing: "Root-cause analysis".
0.500
activityadvancedapplicationsapproximatelyconditionscoolingcoredesigndifferenteastidahoindustriallaboratorymaterialsmultiplenationaloperateoperatesphysicalplants
SHARED TOKENS (33): "activity", "advanced", "applications", "approximately", "conditions", "cooling", "core", "design", "different", "east", "idaho", "industrial", "laboratory", "materials", "multiple", "national", "operate", "operates", "physical", "plants".... | EXACT TITLE in nuclear_clean_energy: "Advanced Test Reactor".
0.500
analysisapplicationscontroldistinctengineeringexistingexpertiseformfunctionsguidanceindustrialinformationinspectionintegrateintegratedplanningprocessproviderealrequirements
SHARED TOKENS (22): "analysis", "applications", "control", "distinct", "engineering", "existing", "expertise", "form", "functions", "guidance", "industrial", "information", "inspection", "integrate", "integrated", "planning", "process", "provide", "real", "requirements".... | EXACT TITLE in manufacturing_food_processing: "Machine vision".
0.500
authoritycasescodecommunicationcomplianceelectricelectricalengineersequipmentevenfederalfiregoverninginstallationjurisdictionlawlineslocalnationalpower
SHARED TOKENS (29): "authority", "cases", "code", "communication", "compliance", "electric", "electrical", "engineers", "equipment", "even", "federal", "fire", "governing", "installation", "jurisdiction", "law", "lines", "local", "national", "power".... | EXACT TITLE in nuclear_clean_energy: "National Electrical Code".
0.500
additionallyagriculturalagriculturealoneavailabilityclimatedemandeconomiceffecteffectsenvironmentalfarmsfoodgrowinghighlyimpactslandlargemakesmaking
SHARED TOKENS (31): "additionally", "agricultural", "agriculture", "alone", "availability", "climate", "demand", "economic", "effect", "effects", "environmental", "farms", "food", "growing", "highly", "impacts", "land", "large", "makes", "making".... | EXACT TITLE in manufacturing_food_processing: "Animal feed".
0.500
analysischemicalcommonlydemandfunctiongrowinglessmaterialplantsratherreceivingspecifictreatmentvaluewastewaterwater
SHARED TOKENS (16): "analysis", "chemical", "commonly", "demand", "function", "growing", "less", "material", "plants", "rather", "receiving", "specific", "treatment", "value", "wastewater", "water". | EXACT TITLE in manufacturing_food_processing: "Biochemical oxygen demand".
0.500
accessactsadditionalcategorieschemicaleconomicenvironmentalfoodoperationalpersonnelphysicalprotectionpurposequalityrisksafetysystem
SHARED TOKENS (17): "access", "acts", "additional", "categories", "chemical", "economic", "environmental", "food", "operational", "personnel", "physical", "protection", "purpose", "quality", "risk", "safety", "system". | EXACT TITLE in manufacturing_food_processing: "Food defense".
0.480
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalapplicationscommercialcommonlyindustrialmunicipalprocessesproducedsewersurfacewastewastewaterwater
SHARED TOKENS (14): "activities", "agricultural", "applications", "commercial", "commonly", "industrial", "municipal", "processes", "produced", "sewer", "surface", "waste", "wastewater", "water". | EXACT TITLE in nuclear_clean_energy: "Wastewater". | EXACT TITLE in manufacturing_food_processing: "Wastewater".
0.480
chemicalcontrolconventionalenergyengineeringfieldformimprovementsphysicalprocessprocessesproductionsafetyscale
SHARED TOKENS (14): "chemical", "control", "conventional", "energy", "engineering", "field", "form", "improvements", "physical", "process", "processes", "production", "safety", "scale". | EXACT TITLE in nuclear_clean_energy: "Microreactor".
0.480
Frozen food ↗ Q751728 EXACT TITLE
buildingsearlyfoodmaintainsmechanicalprocessesproductqualityreportedstandardsstructuresupportingtechnologywaste
SHARED TOKENS (14): "buildings", "early", "food", "maintains", "mechanical", "processes", "product", "quality", "reported", "standards", "structure", "supporting", "technology", "waste". | EXACT TITLE in manufacturing_food_processing: "Frozen food".
0.480
describesdevelopmenteconomiceconomicsgoalsincreasesinfrastructurelocalmarketpolicyprocessqualityregionwest
SHARED TOKENS (14): "describes", "development", "economic", "economics", "goals", "increases", "infrastructure", "local", "market", "policy", "process", "quality", "region", "west". | EXACT TITLE in nuclear_clean_energy: "Economic development".
0.480
americanboiseconsumerdatademandidahomajormarketownedproducedsemiconductorservedstoragetechnology
SHARED TOKENS (14): "american", "boise", "consumer", "data", "demand", "idaho", "major", "market", "owned", "produced", "semiconductor", "served", "storage", "technology". | EXACT TITLE in nuclear_clean_energy: "Micron Technology".
0.480
americanenergyfacilitiesindexinternationalnorthoperatesoutputplantspowerproductionsharesuppliestechnology
SHARED TOKENS (14): "american", "energy", "facilities", "index", "international", "north", "operates", "output", "plants", "power", "production", "share", "supplies", "technology". | EXACT TITLE in nuclear_clean_energy: "Ormat Technologies".
0.480
activitybusinessdepartmentsgovernmentjurisdictionlicenselocalmultipleoperateoperatingpermitsphysicalrequiressingle
SHARED TOKENS (14): "activity", "business", "departments", "government", "jurisdiction", "license", "local", "multiple", "operate", "operating", "permits", "physical", "requires", "single". | EXACT TITLE in manufacturing_food_processing: "Business license".
0.470
Simplot ↗ Q3484788 EXACT TITLE
agricultureamericanboisecommonlyheadquarteredidaho
SHARED TOKENS (6): "agriculture", "american", "boise", "commonly", "headquartered", "idaho". | URL->B (1): https://www.simplot.com/company. | EXACT TITLE in manufacturing_food_processing: "Simplot".
0.460
applicableapplicationcapabilitycaseschaindevelopmenthealthcarehistoryimplementationinformationmeanssupplyverify
SHARED TOKENS (13): "applicable", "application", "capability", "cases", "chain", "development", "healthcare", "history", "implementation", "information", "means", "supply", "verify". | EXACT TITLE in manufacturing_food_processing: "Traceability".
0.460
competitionconnectioncustomerequipmentfacilitieslawmarketsnetworkphysicalregulatorsregulatoryrequirementstraffic
SHARED TOKENS (13): "competition", "connection", "customer", "equipment", "facilities", "law", "markets", "network", "physical", "regulators", "regulatory", "requirements", "traffic". | EXACT TITLE in nuclear_clean_energy: "Interconnection".
0.460
customersgasidahooperatedownedpowerprivatelyprovidepublicregulatesutilitiesutilitywater
SHARED TOKENS (13): "customers", "gas", "idaho", "operated", "owned", "power", "privately", "provide", "public", "regulates", "utilities", "utility", "water". | EXACT TITLE in nuclear_clean_energy: "Idaho Public Utilities Commission".
0.460
Milk ↗ Q8495 EXACT TITLE
agriculturalbaseconsumecontainsdairyfarmsfoodgivinglargestproducedproductsourcesystem
SHARED TOKENS (13): "agricultural", "base", "consume", "contains", "dairy", "farms", "food", "giving", "largest", "produced", "product", "source", "system". | EXACT TITLE in manufacturing_food_processing: "Milk".
0.460
capablecurrentdepartmentdevelopmentenergyenvironmentalgovernmentnationalofficepowerregulatoryresearchtechnical
SHARED TOKENS (13): "capable", "current", "department", "development", "energy", "environmental", "government", "national", "office", "power", "regulatory", "research", "technical". | EXACT TITLE in nuclear_clean_energy: "Office of Nuclear Energy".
0.460
activitiesbuildingbusinessequipmentindustrialinfrastructuremaintenanceoperationalpracticesresidentialsupportingtechnicalutilities
SHARED TOKENS (13): "activities", "building", "business", "equipment", "industrial", "infrastructure", "maintenance", "operational", "practices", "residential", "supporting", "technical", "utilities". | EXACT TITLE in nuclear_clean_energy: "Maintenance". | EXACT TITLE in manufacturing_food_processing: "Maintenance".
0.460
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualclassificationclimateconditionsdifferenteffectformationglobalphysicalplantprovidewater
SHARED TOKENS (13): "agriculture", "annual", "classification", "climate", "conditions", "different", "effect", "formation", "global", "physical", "plant", "provide", "water". | EXACT TITLE in nuclear_clean_energy: "Snowpack".
0.440
controlcoveredcoveringengineeringequipmentindustrialmanufacturingmeansoperatingoperationsoperatorssafety
SHARED TOKENS (12): "control", "covered", "covering", "engineering", "equipment", "industrial", "manufacturing", "means", "operating", "operations", "operators", "safety". | EXACT TITLE in manufacturing_food_processing: "Machine guarding".
0.440
controldesignelectricalengineeringfieldintegrationmanufacturingmechanicalproductsystemstechnicaltechnology
SHARED TOKENS (12): "control", "design", "electrical", "engineering", "field", "integration", "manufacturing", "mechanical", "product", "systems", "technical", "technology". | EXACT TITLE in manufacturing_food_processing: "Mechatronics".
0.440
Forklift ↗ Q41577 EXACT TITLE
becomedevelopeddevelopmentearlyequipmentindustrialmanufacturingmaterialsmovepoweredsalessold
SHARED TOKENS (12): "become", "developed", "development", "early", "equipment", "industrial", "manufacturing", "materials", "move", "powered", "sales", "sold". | EXACT TITLE in manufacturing_food_processing: "Forklift".
0.440
aprilcommercialconventionalcreatedevelopedeconomyinterestmaterialmaterialsoperatedoperatingreduced
SHARED TOKENS (12): "april", "commercial", "conventional", "create", "developed", "economy", "interest", "material", "materials", "operated", "operating", "reduced". | EXACT TITLE in nuclear_clean_energy: "Breeder reactor".
0.440
criticaldescribesdistincteconomygovernmentinfrastructurenationalprivateprotectionscopesectorstrategic
SHARED TOKENS (12): "critical", "describes", "distinct", "economy", "government", "infrastructure", "national", "private", "protection", "scope", "sector", "strategic". | EXACT TITLE in nuclear_clean_energy: "Critical infrastructure".
0.420
controlfieldindustrialinstrumentationinvolvinglaboratoriesmakingphysicalprocessrelatedsystems
SHARED TOKENS (11): "control", "field", "industrial", "instrumentation", "involving", "laboratories", "making", "physical", "process", "related", "systems". | EXACT TITLE in nuclear_clean_energy: "Instrumentation". | EXACT TITLE in manufacturing_food_processing: "Instrumentation".
0.420
addapplicationchemicalenergyengineeringfuturegenerationmeanspercentprocessessystems
SHARED TOKENS (11): "add", "application", "chemical", "energy", "engineering", "future", "generation", "means", "percent", "processes", "systems". | EXACT TITLE in nuclear_clean_energy: "Nuclear engineering".
0.420
differentirrigationlawlegalphysicalriversourcesurfacesystemsuserswater
SHARED TOKENS (11): "different", "irrigation", "law", "legal", "physical", "river", "source", "surface", "systems", "users", "water". | EXACT TITLE in nuclear_clean_energy: "Water right".
0.420
Cattle ↗ Q830 EXACT TITLE
centralcommonlydairydistributedfarminggasgloballargeseparatesmallwestern
SHARED TOKENS (11): "central", "commonly", "dairy", "distributed", "farming", "gas", "global", "large", "separate", "small", "western". | EXACT TITLE in manufacturing_food_processing: "Cattle".
0.420
Allergen ↗ Q186752 EXACT TITLE
capableenvironmentalhealthinternationalmaintainsorganizationproducesproductionsignificanttechnicalunion
SHARED TOKENS (11): "capable", "environmental", "health", "international", "maintains", "organization", "produces", "production", "significant", "technical", "union". | EXACT TITLE in manufacturing_food_processing: "Allergen".
0.420
Sausage ↗ Q131419 EXACT TITLE
becomefoodformedmakingmaterialsnationalpreparationprocessingproductregionalsold
SHARED TOKENS (11): "become", "food", "formed", "making", "materials", "national", "preparation", "processing", "product", "regional", "sold". | EXACT TITLE in manufacturing_food_processing: "Sausage".
0.400
effectfoodhealthinfluencejurisdictionlegalplantregulatedregulatorytreatment
SHARED TOKENS (10): "effect", "food", "health", "influence", "jurisdiction", "legal", "plant", "regulated", "regulatory", "treatment". | EXACT TITLE in manufacturing_food_processing: "Nutraceutical".
0.400
Lactalis ↗ Q1799825 EXACT TITLE
approximatelybusinessdairyemployslargestmarketsnetownedplantssales
SHARED TOKENS (10): "approximately", "business", "dairy", "employs", "largest", "markets", "net", "owned", "plants", "sales". | EXACT TITLE in manufacturing_food_processing: "Lactalis".
0.380
Reservoir ↗ Q131681 EXACT TITLE
buildingexistingformgenerationhydroelectricpowerspacestoragewater
SHARED TOKENS (9): "building", "existing", "form", "generation", "hydroelectric", "power", "space", "storage", "water". | EXACT TITLE in nuclear_clean_energy: "Reservoir".
0.380
airchemicalcontainsenergymaterialpowerproducessinglestation
SHARED TOKENS (9): "air", "chemical", "contains", "energy", "material", "power", "produces", "single", "station". | EXACT TITLE in nuclear_clean_energy: "Nuclear fuel".
0.380
Anthocyanin ↗ Q262547 EXACT TITLE
amongchemicaleffectevidencefoodpathwayplantsunionverified
SHARED TOKENS (9): "among", "chemical", "effect", "evidence", "food", "pathway", "plants", "union", "verified". | EXACT TITLE in manufacturing_food_processing: "Anthocyanin".
0.380
applicationbyproductsformindustrialpaperprocessprocessesprocessingprovide
SHARED TOKENS (9): "application", "byproducts", "form", "industrial", "paper", "process", "processes", "processing", "provide". | EXACT TITLE in nuclear_clean_energy: "Process heat".
0.360
departmentdevelopmenteconomicidaholaborprocessestechnologyworkforce
SHARED TOKENS (8): "department", "development", "economic", "idaho", "labor", "processes", "technology", "workforce". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Labor". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Labor".
0.360
buildingidaholabornationalplantspowerproducedresearch
SHARED TOKENS (8): "building", "idaho", "labor", "national", "plants", "power", "produced", "research". | EXACT TITLE in nuclear_clean_energy: "Experimental Breeder Reactor I".
0.360
Purée ↗ Q636056 EXACT TITLE
broadercommonlyfoodprocessesratherservedspecificwater
SHARED TOKENS (8): "broader", "commonly", "food", "processes", "rather", "served", "specific", "water". | EXACT TITLE in manufacturing_food_processing: "Purée".
0.360
americanboiseeaglefoodheadquarteredidaholargestprocessing
SHARED TOKENS (8): "american", "boise", "eagle", "food", "headquartered", "idaho", "largest", "processing". | EXACT TITLE in manufacturing_food_processing: "Lamb Weston".
0.340
Mozzarella ↗ Q14088 EXACT TITLE
distinctmakesresearchriverservedsoldsouthern
SHARED TOKENS (7): "distinct", "makes", "research", "river", "served", "sold", "southern". | EXACT TITLE in manufacturing_food_processing: "Mozzarella".
0.340
Boiler ↗ EXACT TITLE
applicationscentralgenerationheatingpowerprocesseswater
SHARED TOKENS (7): "applications", "central", "generation", "heating", "power", "processes", "water". | EXACT TITLE in manufacturing_food_processing: "Boiler".
0.340
dairyenvironmentalfacilityfoodproducesproductwater
SHARED TOKENS (7): "dairy", "environmental", "facility", "food", "produces", "product", "water". | EXACT TITLE in nuclear_clean_energy: "Dairy product". | EXACT TITLE in manufacturing_food_processing: "Dairy product".
0.340
Chorizo ↗ Q23374 EXACT TITLE
adddifferentelsewherenationaloriginatingquestionregional
SHARED TOKENS (7): "add", "different", "elsewhere", "national", "originating", "question", "regional". | EXACT TITLE in manufacturing_food_processing: "Chorizo".
0.340
businessdevelopmentestateindustrialofficepurposerather
SHARED TOKENS (7): "business", "development", "estate", "industrial", "office", "purpose", "rather". | EXACT TITLE in manufacturing_food_processing: "Industrial park".
0.320
Whey ↗ Q185009 EXACT TITLE
chaincommercialdairymakingmanufacturinguses
SHARED TOKENS (6): "chain", "commercial", "dairy", "making", "manufacturing", "uses". | EXACT TITLE in manufacturing_food_processing: "Whey".
0.320
Raspberry ↗ Q13179 EXACT TITLE
appliesnorthplantplantsproductiontotal
SHARED TOKENS (6): "applies", "north", "plant", "plants", "production", "total". | EXACT TITLE in manufacturing_food_processing: "Raspberry".
0.300
Nuclear fusion ↗ Q13082 KW CROSS HIGH
advancedamongapplicationscombineconditionsenergyformlargelargerpathwayspowerprocessprocessesproducesproductproductionrequire
SHARED TOKENS (17): "advanced", "among", "applications", "combine", "conditions", "energy", "form", "large", "larger", "pathways", "power", "process", "processes", "produces", "product", "production", "require".
0.300
aloneapplicationsdemandenergymarketmaterialmodeloperatingpowerproductionrolessafetysharespecificvalue
SHARED TOKENS (15): "alone", "applications", "demand", "energy", "market", "material", "model", "operating", "power", "production", "roles", "safety", "share", "specific", "value".
0.300
actamericanamongapproximatelycombiningdepartmentdescribedenergyestateexistingfederalfuturegasgeneralgovernmentheadquarteredhealthidaholandmanagement
SHARED TOKENS (33): "act", "american", "among", "approximately", "combining", "department", "described", "energy", "estate", "existing", "federal", "future", "gas", "general", "government", "headquartered", "health", "idaho", "land", "management"....
0.300
accessactsassociatedcannotconditionsdefinesdifferentenergyexternalfacilitiesinternationalinvolvingmaterialmaterialsoperatingplantspowerprotectionpublicregulations
SHARED TOKENS (27): "access", "acts", "associated", "cannot", "conditions", "defines", "different", "energy", "external", "facilities", "international", "involving", "material", "materials", "operating", "plants", "power", "protection", "public", "regulations"....
0.300
amongapproximatelycontainscontrolconversiondisposalfeasibilityformationformsfuturehealthhighlyidentifiedimpactslessmaintenancemanagementmaterialsmeansnational
SHARED TOKENS (39): "among", "approximately", "contains", "control", "conversion", "disposal", "feasibility", "formation", "forms", "future", "health", "highly", "identified", "impacts", "less", "maintenance", "management", "materials", "means", "national"....
0.300
capableelectricenergyentityfacilitiesindependentindustrialoperatesoutputpowerprocesspublicruralsystemusersutilitiesutilitywater
SHARED TOKENS (18): "capable", "electric", "energy", "entity", "facilities", "independent", "industrial", "operates", "output", "power", "process", "public", "rural", "system", "users", "utilities", "utility", "water".
0.300
americanbuildingcontroldesigndevelopeddevelopmentdistrictenergyengineersfacilitiesformationfoundationsgeneralheadquartershighlylaboratorieslaboratorylinesmajormaterial
SHARED TOKENS (41): "american", "building", "control", "design", "developed", "development", "district", "energy", "engineers", "facilities", "formation", "foundations", "general", "headquarters", "highly", "laboratories", "laboratory", "lines", "major", "material"....
0.300
activitiesagriculturalairapproximatelyclimateearthindustrialirrigationmultiplenorthpotentiallyproducedriversmallsourcesupplysurfacewastewaterwater
SHARED TOKENS (19): "activities", "agricultural", "air", "approximately", "climate", "earth", "industrial", "irrigation", "multiple", "north", "potentially", "produced", "river", "small", "source", "supply", "surface", "wastewater", "water".
0.300
agriculturalagricultureairallowedbeginningcontrolcoolingdairydevelopeddirectdisposalearlyenvironmentalexpansionfarmingfarmsgasgeneralhealthhistory
SHARED TOKENS (36): "agricultural", "agriculture", "air", "allowed", "beginning", "control", "cooling", "dairy", "developed", "direct", "disposal", "early", "environmental", "expansion", "farming", "farms", "gas", "general", "health", "history"....
0.300
Salami ↗ Q188655 EXACT TITLE
amongcentralpotentiallysouthernsupply
SHARED TOKENS (5): "among", "central", "potentially", "southern", "supply". | EXACT TITLE in manufacturing_food_processing: "Salami".
0.300
customersdemanddistributionearlyelectricelectricalenergygasgenerationindustriesintegratedlargemanagementmarketmarketsoperatepowerpublicpurchasingregulated
SHARED TOKENS (24): "customers", "demand", "distribution", "early", "electric", "electrical", "energy", "gas", "generation", "industries", "integrated", "large", "management", "market", "markets", "operate", "power", "public", "purchasing", "regulated"....
0.300
additionallyavailabilityaveragecapacityconditionsconstraintsdesigndifferentelectricalenergyinstallationloadlocalmaintenancemarketnetoperationoperationaloutputplant
SHARED TOKENS (29): "additionally", "availability", "average", "capacity", "conditions", "constraints", "design", "different", "electrical", "energy", "installation", "load", "local", "maintenance", "market", "net", "operation", "operational", "output", "plant"....
0.300
additionalagriculturalapplicationscapacityconditionsdepartmentdistrictearthelectricenergyestimatedformationgenerationheatingindustriallessnearplantplantspower
SHARED TOKENS (25): "additional", "agricultural", "applications", "capacity", "conditions", "department", "district", "earth", "electric", "energy", "estimated", "formation", "generation", "heating", "industrial", "less", "near", "plant", "plants", "power"....
0.300
amongcasescommercialdairyeducationevidencefoodincompletemakingplanprovideremainsshowsmalltreatment
SHARED TOKENS (15): "among", "cases", "commercial", "dairy", "education", "evidence", "food", "incomplete", "making", "plan", "provide", "remains", "show", "small", "treatment".
0.300
coredepartmentearlyenergyfacilityfallsgovernmentidaholaboratorynationalnorthwestoperateoperatespersonnelplantspowerprocessingreceivingspentstorage
SHARED TOKENS (23): "core", "department", "early", "energy", "facility", "falls", "government", "idaho", "laboratory", "national", "northwest", "operate", "operates", "personnel", "plants", "power", "processing", "receiving", "spent", "storage"....
0.300
Nuclear reactor ↗ Q80877 KW CROSS HIGH
absorbbeginningchaincommercialcontrolledcorecriticaldesigndevelopeddiscoverydistrictearlyeffectselectricalenergyglobalheatingindustriallaboratorymajor
SHARED TOKENS (42): "absorb", "beginning", "chain", "commercial", "controlled", "core", "critical", "design", "developed", "discovery", "district", "early", "effects", "electrical", "energy", "global", "heating", "industrial", "laboratory", "major"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
agreementcapacityclimateconnectedelectricalenergyfarmsgasgenerationglobalgoalslessoutputplantspowerproducedsharesourcesouthernstorage
SHARED TOKENS (22): "agreement", "capacity", "climate", "connected", "electrical", "energy", "farms", "gas", "generation", "global", "goals", "less", "output", "plants", "power", "produced", "share", "source", "southern", "storage"....
0.300
applicationscapacitychainconsumptioncoolingdefinesdemanddistrictelectricenergyevaluatesformgenerationgoalheatinginfluenceintegratedinterestlawmeans
SHARED TOKENS (32): "applications", "capacity", "chain", "consumption", "cooling", "defines", "demand", "district", "electric", "energy", "evaluates", "form", "generation", "goal", "heating", "influence", "integrated", "interest", "law", "means"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
annualconnectionconsumerscreditcurrentelectricenergyevenfeeinvestmentnetpolicypowerprivaterequirerequiresretailsinglesmallstorage
SHARED TOKENS (22): "annual", "connection", "consumers", "credit", "current", "electric", "energy", "even", "fee", "investment", "net", "policy", "power", "private", "require", "requires", "retail", "single", "small", "storage"....
0.300
aprilauthoritybasecapablecapitalcleancommonlydemandenergygasgenerationlessloadplacesplantplantspowerreducedsecondstorage
SHARED TOKENS (22): "april", "authority", "base", "capable", "capital", "clean", "commonly", "demand", "energy", "gas", "generation", "less", "load", "places", "plant", "plants", "power", "reduced", "second", "storage"....
0.300
controlcontrolscorporatedistinguishfinancialglobalhomeinternationalinvestmentlargestmultipleoperatingorganizationportfolioproductionrisks
SHARED TOKENS (16): "control", "controls", "corporate", "distinguish", "financial", "global", "home", "international", "investment", "largest", "multiple", "operating", "organization", "portfolio", "production", "risks".
0.300
additionallyadvancedairapplicationsaveragecentralcleancontrolcreateequipmentfabricationfacilitieshighlyindustrialinsideintegratedlargemaintainmanufacturingmaterial
SHARED TOKENS (31): "additionally", "advanced", "air", "applications", "average", "central", "clean", "control", "create", "equipment", "fabrication", "facilities", "highly", "industrial", "inside", "integrated", "large", "maintain", "manufacturing", "material"....
0.300
actagricultureallianceanalysischainchemicalcontrolcontrolscriticaldepartmentdesigndistributioneffectsestablishedestablishingfirmsfoodgovernmenthealthindustrial
SHARED TOKENS (45): "act", "agriculture", "alliance", "analysis", "chain", "chemical", "control", "controls", "critical", "department", "design", "distribution", "effects", "established", "establishing", "firms", "food", "government", "health", "industrial"....
0.300
authoritybecomecapacityconstructionenergyenvironmentalevenexistfacilitiesgenerationhydroelectricinternationallargelargestpolicyportfoliopowerproducedrequiresriver
SHARED TOKENS (32): "authority", "become", "capacity", "construction", "energy", "environmental", "even", "exist", "facilities", "generation", "hydroelectric", "international", "large", "largest", "policy", "portfolio", "power", "produced", "requires", "river"....
0.300
applicationsconventionalcoredevelopmentexistinggenerationoperatesoperatingoperationoutputplantpotentiallypowerprocessproductionuses
SHARED TOKENS (16): "applications", "conventional", "core", "development", "existing", "generation", "operates", "operating", "operation", "output", "plant", "potentially", "power", "process", "production", "uses".
0.300
approximatelycommercialconnecteddesigndevelopeddevelopmentenergyenterexistsfacilitiesfuturegenerationinternationallessmakingoperateoperationoperationalorganizationpotentially
SHARED TOKENS (33): "approximately", "commercial", "connected", "design", "developed", "development", "energy", "enter", "exists", "facilities", "future", "generation", "international", "less", "making", "operate", "operation", "operational", "organization", "potentially"....
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
advancedcapablecapacitycodecommunicationsconnectconsumptioncontrolcreatecurrentdemanddescribeddistributeddistributionelectricelectricalenergyevenfunctiongeneral
SHARED TOKENS (53): "advanced", "capable", "capacity", "code", "communications", "connect", "consumption", "control", "create", "current", "demand", "described", "distributed", "distribution", "electric", "electrical", "energy", "even", "function", "general"....
0.300
Butcher ↗ Q329737 EXACT TITLE
foodmarketspreparationretailwholesale
SHARED TOKENS (5): "food", "markets", "preparation", "retail", "wholesale". | EXACT TITLE in manufacturing_food_processing: "Butcher".
0.300
actbecomedepartmentdevelopmentestablishedfederalgenerationgovernmenthydroelectricirrigationlargestlawmanagementoperationoversightpowerprogramprovisionssecondsource
SHARED TOKENS (24): "act", "become", "department", "development", "established", "federal", "generation", "government", "hydroelectric", "irrigation", "largest", "law", "management", "operation", "oversight", "power", "program", "provisions", "second", "source"....
0.300
becomechaincombinecompetitionconsolidationconsumersdescribeddifferentdirectlyeconomyintegratedintegrationinternationallargemakingmanagementmarketneedownedownership
SHARED TOKENS (31): "become", "chain", "combine", "competition", "consolidation", "consumers", "described", "different", "directly", "economy", "integrated", "integration", "international", "large", "making", "management", "market", "need", "owned", "ownership"....
0.300
Slaughterhouse ↗ Q385557 KW CROSS HIGH
agricultureconsumptiondifferentfacilityfoodhealthlargepreparationprocessprovidepublicrequirementsscalesignificantsupplywork
SHARED TOKENS (16): "agriculture", "consumption", "different", "facility", "food", "health", "large", "preparation", "process", "provide", "public", "requirements", "scale", "significant", "supply", "work".
0.300
analysisbuildingbuildingscapacitycommercialdistributedelectricalenergyequipmentformgenerationindustriallargemanagementmonitoringnetpanelspowerresidentialscale
SHARED TOKENS (25): "analysis", "building", "buildings", "capacity", "commercial", "distributed", "electrical", "energy", "equipment", "form", "generation", "industrial", "large", "management", "monitoring", "net", "panels", "power", "residential", "scale"....
0.300
actallowedaprildisposaldistrictestablishedfederalforcehighlyjurisdictionlawnationalpolicyprogramwaste
SHARED TOKENS (15): "act", "allowed", "april", "disposal", "district", "established", "federal", "force", "highly", "jurisdiction", "law", "national", "policy", "program", "waste".
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalallowedapplicationsavailabilitycapacityclimatecompetitionconstraintsconversioncoveringcurrentdemanddirectdistributioneartheffectelectricalemploysenergyfinancial
SHARED TOKENS (55): "additional", "allowed", "applications", "availability", "capacity", "climate", "competition", "constraints", "conversion", "covering", "current", "demand", "direct", "distribution", "earth", "effect", "electrical", "employs", "energy", "financial"....
0.300
aircommonlyevenfoodserved
SHARED TOKENS (5): "air", "commonly", "even", "food", "served". | EXACT TITLE in manufacturing_food_processing: "French fries".
0.300
Solar tracker ↗ Q938237 KW CROSS HIGH
applicationscapacityconcentrateddirectenergyfixedglobalincreasesmarketpanelsplacespowerproducedreducingsystemsthereforetoward
SHARED TOKENS (17): "applications", "capacity", "concentrated", "direct", "energy", "fixed", "global", "increases", "market", "panels", "places", "power", "produced", "reducing", "systems", "therefore", "toward".
0.300
apprenticeshipapproximatelyconstructioncontractorsdataelectricalgovernmentindustriesinsideinternationallabornationalprogramspublicrelatedrepresentstrainedtrainingunionutilities
SHARED TOKENS (22): "apprenticeship", "approximately", "construction", "contractors", "data", "electrical", "government", "industries", "inside", "international", "labor", "national", "programs", "public", "related", "represents", "trained", "training", "union", "utilities"....
0.300
actaddressingauthorityfederalfoodgrantsguidancehostlawlegalmajorreportedreportsrequiressafetysalesstandards
SHARED TOKENS (17): "act", "addressing", "authority", "federal", "food", "grants", "guidance", "host", "law", "legal", "major", "reported", "reports", "requires", "safety", "sales", "standards".
0.300
actactivitiesadministrativedepartmentdevelopmentenergyestablishedfacilitiesfederalfunctionslaborlawmajormaterialsoversightpowerproductionregulationregulatoryresearch
SHARED TOKENS (25): "act", "activities", "administrative", "department", "development", "energy", "established", "facilities", "federal", "functions", "labor", "law", "major", "materials", "oversight", "power", "production", "regulation", "regulatory", "research"....
0.300
additionalbuildingcurrentdepartmentdevelopmentdirectlydirectsenergyfederalgovernmentheadquarterslaboratoriesmaterialnationaloriginatingphysicalpolicypowerproductionprogram
SHARED TOKENS (25): "additional", "building", "current", "department", "development", "directly", "directs", "energy", "federal", "government", "headquarters", "laboratories", "material", "national", "originating", "physical", "policy", "power", "production", "program"....
0.300
Cogeneration ↗ Q221620 KW CROSS HIGH
buildingbuildingscenterscentralchemicalcommonlycoolingdistributeddistrictearlyelectricalenergygasgenerationheatingindustrieslargelessofficeoperations
SHARED TOKENS (31): "building", "buildings", "centers", "central", "chemical", "commonly", "cooling", "distributed", "district", "early", "electrical", "energy", "gas", "generation", "heating", "industries", "large", "less", "office", "operations"....
0.300
amongbuildingscoldcommonlycoolingearthelectricenergyheatinghvaclargelessnorthproviderequirementsourcesystemsystemsunitswater
SHARED TOKENS (20): "among", "buildings", "cold", "commonly", "cooling", "earth", "electric", "energy", "heating", "hvac", "large", "less", "north", "provide", "requirement", "source", "system", "systems", "units", "water".
0.300
commercialcommonlycontrolledcurrentdevelopeddifferentdirectearlyeconomyelectricformlesslinesloadnetworkpowerrapidrequiresourcesystem
SHARED TOKENS (24): "commercial", "commonly", "controlled", "current", "developed", "different", "direct", "early", "economy", "electric", "form", "less", "lines", "load", "network", "power", "rapid", "require", "source", "system"....
0.300
accessbecomecarryconnectedconnectingconsumerscurrentcustomersdistributionelectricelectricalenergygrowingincreaseslargemarketsneednetworkoperatepower
SHARED TOKENS (24): "access", "become", "carry", "connected", "connecting", "consumers", "current", "customers", "distribution", "electric", "electrical", "energy", "growing", "increases", "large", "markets", "need", "network", "operate", "power"....
0.300
agriculturalagriculturealliancebusinesscertificationcertifiedchangingclimatecodeconditionsconventionalconversioncreatecropeffectsenvironmentalexistfarmingfoodform
SHARED TOKENS (37): "agricultural", "agriculture", "alliance", "business", "certification", "certified", "changing", "climate", "code", "conditions", "conventional", "conversion", "create", "crop", "effects", "environmental", "exist", "farming", "food", "form"....
0.300
applicationschainconsumercustomersdifferentequipmentindustriesinvolvingmaterialmaterialsmechanicalmovespowersystemsystems
SHARED TOKENS (15): "applications", "chain", "consumer", "customers", "different", "equipment", "industries", "involving", "material", "materials", "mechanical", "moves", "power", "system", "systems".
0.300
actactivityamongcaseconsumptioncontrolcontrolleddescribeseconomiceffectevenexistsfederalgovernmentgrowinginterstatejurisdictionlinesmatterspower
SHARED TOKENS (25): "act", "activity", "among", "case", "consumption", "control", "controlled", "describes", "economic", "effect", "even", "exists", "federal", "government", "growing", "interstate", "jurisdiction", "lines", "matters", "power"....
0.300
actapproximatelycasecommonlyconstructedcovereddescribedelectricenvironmentalestablishesfacilitiesfederalgeneralgovernmentgovernsindustrieslawpolicypowerprivate
SHARED TOKENS (26): "act", "approximately", "case", "commonly", "constructed", "covered", "described", "electric", "environmental", "establishes", "facilities", "federal", "general", "government", "governs", "industries", "law", "policy", "power", "private"....
0.300
acquisitionactactivityassetsbusinesscapitalcentralcombinecompetitionconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityfederalgoverned
SHARED TOKENS (42): "acquisition", "act", "activity", "assets", "business", "capital", "central", "combine", "competition", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "federal", "governed"....
0.300
Water pollution ↗ KW CROSS HIGH
activitiesagriculturalconditionscontroleffectformformsindustrialinfrastructureirrigationmanagementplantplantspowerreducesrequiressurfacetechnologytreatmentwaste
SHARED TOKENS (22): "activities", "agricultural", "conditions", "control", "effect", "form", "forms", "industrial", "infrastructure", "irrigation", "management", "plant", "plants", "power", "reduces", "requires", "surface", "technology", "treatment", "waste"....
0.300
administrativecontrolcovereddisposalfacilitiesfacilityfuturegrowingindustriallicensematerialsoperatingplanplantprocessprotectionregulatoryremainsrequiresresearch
SHARED TOKENS (27): "administrative", "control", "covered", "disposal", "facilities", "facility", "future", "growing", "industrial", "license", "materials", "operating", "plan", "plant", "process", "protection", "regulatory", "remains", "requires", "research"....
0.300
agriculturalagriculturedairydifferenteconomyfarmsfoodidaholandlargestprocessingproducesproductionrepresentsrolesalessecondsectorsignificant
SHARED TOKENS (19): "agricultural", "agriculture", "dairy", "different", "economy", "farms", "food", "idaho", "land", "largest", "processing", "produces", "production", "represents", "role", "sales", "second", "sector", "significant".
0.300
categoriesdataeffectsenergyexternalhealthinternationallimitedmeansoccupationalprotectionriskssafetysignificantsourceunits
SHARED TOKENS (16): "categories", "data", "effects", "energy", "external", "health", "international", "limited", "means", "occupational", "protection", "risks", "safety", "significant", "source", "units".
0.300
airbuildingchemicalcleanconstructedconstructioncontainscontrolcontrolledcreatecriticaldischargeelectricalequipmentevenfabricationintegratedmanufacturingmodeloffice
SHARED TOKENS (35): "air", "building", "chemical", "clean", "constructed", "construction", "contains", "control", "controlled", "create", "critical", "discharge", "electrical", "equipment", "even", "fabrication", "integrated", "manufacturing", "model", "office"....
0.300
americanaprilaveragecapacitycentercentralcompletedconditionsdevelopmentenergyfarmsfederalgenerationgovernmenthomehydroelectriclargestnorthoverviewpermitting
SHARED TOKENS (31): "american", "april", "average", "capacity", "center", "central", "completed", "conditions", "development", "energy", "farms", "federal", "generation", "government", "home", "hydroelectric", "largest", "north", "overview", "permitting"....
0.300
alongsideaveragecategorychaincommercialconstructedexistingfuturehighlyhistoricallaboratorylargestmaintainmaterialnationaloperatedoperationalpowerreducingrequire
SHARED TOKENS (28): "alongside", "average", "category", "chain", "commercial", "constructed", "existing", "future", "highly", "historical", "laboratory", "largest", "maintain", "material", "national", "operated", "operational", "power", "reducing", "require"....
0.300
basecontractdesignindependentmanufacturingoperationsphysicalprocessproducesproductrathersalessignificantsuppliersuppliers
SHARED TOKENS (15): "base", "contract", "design", "independent", "manufacturing", "operations", "physical", "process", "produces", "product", "rather", "sales", "significant", "supplier", "suppliers".
0.300
actactivitiesadministeredadministrativeairamongassociatedcarrycleanclimatecontrolcreateenvironmentalfacilitiesfederalindustriallawlayerlocalmajor
SHARED TOKENS (35): "act", "activities", "administered", "administrative", "air", "among", "associated", "carry", "clean", "climate", "control", "create", "environmental", "facilities", "federal", "industrial", "law", "layer", "local", "major"....
0.300
acquisitionassociatedchemicalconnectionscontroldatadistributedfieldfunctionsgasgenerationindustrialindustriesinstrumentationlargelargerpaperpowerprocessprocessing
SHARED TOKENS (25): "acquisition", "associated", "chemical", "connections", "control", "data", "distributed", "field", "functions", "gas", "generation", "industrial", "industries", "instrumentation", "large", "larger", "paper", "power", "process", "processing"....
0.300
Solar inverter ↗ Q129316 KW CROSS HIGH
commercialconvertscriticalcurrentdirectelectricalequipmentfunctionslocalnetworkordinaryoutputpowerprotectionsystemutility
SHARED TOKENS (16): "commercial", "converts", "critical", "current", "direct", "electrical", "equipment", "functions", "local", "network", "ordinary", "output", "power", "protection", "system", "utility".
0.300
authoritiesdistributionelectricenergyfacilitiesgenerationinfrastructurelargestlocalmajormarketmarketsnationaloperateownedpowerpublicregulatedregulationutilities
SHARED TOKENS (21): "authorities", "distribution", "electric", "energy", "facilities", "generation", "infrastructure", "largest", "local", "major", "market", "markets", "national", "operate", "owned", "power", "public", "regulated", "regulation", "utilities"....
0.300
Food allergy ↗ KW CROSS HIGH
amongcommonlyconditionsdevelopeddevelopmentearlyfoodgivinghistorymanagementplanpressurequestionriskseparatesystemtesttreating
SHARED TOKENS (18): "among", "commonly", "conditions", "developed", "development", "early", "food", "giving", "history", "management", "plan", "pressure", "question", "risk", "separate", "system", "test", "treating".
0.300
aloneamongbasebusinessbusinessesclimateconnectconsumptioncorecreatecurrentcustomersdefineseconomyexistingfirmsfoodgeographicallyglobalgoals
SHARED TOKENS (45): "alone", "among", "base", "business", "businesses", "climate", "connect", "consumption", "core", "create", "current", "customers", "defines", "economy", "existing", "firms", "food", "geographically", "global", "goals"....
0.300
connectsconsumerscurrentcustomersdirectdirectlydistinctdistributionelectricelectricalenergyevenformlineslocalmajormarketnetworknorthowned
SHARED TOKENS (28): "connects", "consumers", "current", "customers", "direct", "directly", "distinct", "distribution", "electric", "electrical", "energy", "even", "form", "lines", "local", "major", "market", "network", "north", "owned"....
0.300
acquirecentercreateheadquarterednetworknorthoperatesoperatingpacificprincipalregulatorsreportingroutessouthernsystemtransportationunionwestwestern
SHARED TOKENS (19): "acquire", "center", "create", "headquartered", "network", "north", "operates", "operating", "pacific", "principal", "regulators", "reporting", "routes", "southern", "system", "transportation", "union", "west", "western".
0.300
accessboisecanyoncapacitycontainsenergyfallsgenerationhydroelectricidahoinformationlargestoperatedoregonownedpowerprivatelyriversnaketotal
SHARED TOKENS (22): "access", "boise", "canyon", "capacity", "contains", "energy", "falls", "generation", "hydroelectric", "idaho", "information", "largest", "operated", "oregon", "owned", "power", "privately", "river", "snake", "total"....
0.300
Food industry ↗ Q540912 KW CROSS HIGH
academicactivitiesagriculturalagriculturebecomebusinessesconstructionconsumerscreditdescribesdevelopmentdirectlydistributioneconomiceducationengineeringequipmentfarmingfarmsfinancial
SHARED TOKENS (64): "academic", "activities", "agricultural", "agriculture", "become", "businesses", "construction", "consumers", "credit", "describes", "development", "directly", "distribution", "economic", "education", "engineering", "equipment", "farming", "farms", "financial"....
0.300
activitiesactivityanalysiscarrycasesdesigndocumentationengineeringengineersestablishedgeneralgovernmentlegallicenselicensedlocalmaintenanceoverviewpracticeprocess
SHARED TOKENS (34): "activities", "activity", "analysis", "carry", "cases", "design", "documentation", "engineering", "engineers", "established", "general", "government", "legal", "license", "licensed", "local", "maintenance", "overview", "practice", "process"....
0.300
administeredagriculturalagricultureapproximatelycommercialcurrentdepartmentdirectlyfarmingfederalfoodgovernmentlargestnationalproductionprogramprogramsreportsruralsafety
SHARED TOKENS (22): "administered", "agricultural", "agriculture", "approximately", "commercial", "current", "department", "directly", "farming", "federal", "food", "government", "largest", "national", "production", "program", "programs", "reports", "rural", "safety"....
0.300
accountadvancedapplicationapproximatelyavailabilityaveragebusinessescarryconnectedconstructioncontainsdemanddesigndevelopeddifferentdischargeenergyengineersestimatedeven
SHARED TOKENS (50): "account", "advanced", "application", "approximately", "availability", "average", "businesses", "carry", "connected", "construction", "contains", "demand", "design", "developed", "different", "discharge", "energy", "engineers", "estimated", "even"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactivitiesadditionaladministeredapproximatelyauthoritiesauthorizesbusinesscannotchemicalcleancontainscontrolsdepartmentdetermineearlyenvironmentalestablishedfederal
SHARED TOKENS (53): "acquisition", "act", "activities", "additional", "administered", "approximately", "authorities", "authorizes", "business", "cannot", "chemical", "clean", "contains", "controls", "department", "determine", "early", "environmental", "established", "federal"....
0.300
associatedcommercialconnectedcoredesignelectricenergygasgenerationinsidelinkedmaintainoperateoperatedplantpowerpressuresecondstationwater
SHARED TOKENS (20): "associated", "commercial", "connected", "core", "design", "electric", "energy", "gas", "generation", "inside", "linked", "maintain", "operate", "operated", "plant", "power", "pressure", "second", "station", "water".
0.300
actauthoritydecisionseffectsenvironmentalestablishedfederalgovernmentimpactslawnationalpolicyqualityrecognizesreportsrequirementrequirementsrequiressignificantsubject
SHARED TOKENS (20): "act", "authority", "decisions", "effects", "environmental", "established", "federal", "government", "impacts", "law", "national", "policy", "quality", "recognizes", "reports", "requirement", "requirements", "requires", "significant", "subject".
0.300
becomecoredifferentdisposalfuturehighlylessmajormakesordinaryplantpowersafelysourcespentstorageunlesswastewater
SHARED TOKENS (19): "become", "core", "different", "disposal", "future", "highly", "less", "major", "makes", "ordinary", "plant", "power", "safely", "source", "spent", "storage", "unless", "waste", "water".
0.300
alongsideauthorityconsumerconsumersdevelopedearlyeastenvironmentalevenfoodglobalhealthinformationlistlistingslocalmarketsnorthproductproduction
SHARED TOKENS (33): "alongside", "authority", "consumer", "consumers", "developed", "early", "east", "environmental", "even", "food", "global", "health", "information", "list", "listings", "local", "markets", "north", "product", "production"....
0.300
activityairannualapplicationapplicationsapproximatelycapacitycoldconsumptioncontainsconversiondirectearthenergyevenformationglobalheatingsourcesurface
SHARED TOKENS (21): "activity", "air", "annual", "application", "applications", "approximately", "capacity", "cold", "consumption", "contains", "conversion", "direct", "earth", "energy", "even", "formation", "global", "heating", "source", "surface"....
0.300
airbuildingbuildingscontrolcoolingdesignelectricalenergyengineersenvironmentalheatinghvacintegratemaintenancemechanicaloperatingplumbingprovidequalitysystems
SHARED TOKENS (22): "air", "building", "buildings", "control", "cooling", "design", "electrical", "energy", "engineers", "environmental", "heating", "hvac", "integrate", "maintenance", "mechanical", "operating", "plumbing", "provide", "quality", "systems"....
0.300
analysisbusinesscapabilitiescapabilitychaindesigneducationenergyengineeringengineersequipmentfinancehealthcareindustrialindustriesinformationinstallationintegratedknowledgelabor
SHARED TOKENS (37): "analysis", "business", "capabilities", "capability", "chain", "design", "education", "energy", "engineering", "engineers", "equipment", "finance", "healthcare", "industrial", "industries", "information", "installation", "integrated", "knowledge", "labor"....
0.300
airallowedapproximatelycoldconstructioncoredesigndevelopeddirectlyelectricelectricalenergyformgeneralgenerationinsidelaboratorynationalplantpower
SHARED TOKENS (26): "air", "allowed", "approximately", "cold", "construction", "core", "design", "developed", "directly", "electric", "electrical", "energy", "form", "general", "generation", "inside", "laboratory", "national", "plant", "power"....
0.300
applieschemicalcomplydescribesdischargedisposalelectricfacilitiesfoodgasindustrialindustriesmanufacturingmaterialsmunicipalpaperplantspowerprocessprocesses
SHARED TOKENS (31): "applies", "chemical", "comply", "describes", "discharge", "disposal", "electric", "facilities", "food", "gas", "industrial", "industries", "manufacturing", "materials", "municipal", "paper", "plants", "power", "process", "processes"....
0.300
agriculturalcommonlyeastfallsidahoirrigationlargeriverseparatesnakesourcesouthernwaterwestwestern
SHARED TOKENS (15): "agricultural", "commonly", "east", "falls", "idaho", "irrigation", "large", "river", "separate", "snake", "source", "southern", "water", "west", "western".
0.300
Wholesaling ↗ Q220695 KW CROSS HIGH
businessbusinessescommercialconsumerconsumersdirectlygeneralindustrialinstitutionalmarketmarketsorganizationprofessionalpurchasingratherrelatedsourcetransactionuserswholesale
SHARED TOKENS (20): "business", "businesses", "commercial", "consumer", "consumers", "directly", "general", "industrial", "institutional", "market", "markets", "organization", "professional", "purchasing", "rather", "related", "source", "transaction", "users", "wholesale".
0.300
airbeyondcapacityconnecteddemandeconomiceconomicselectricalenergyexperienceformformslargelargestloadmakingmanagementneedoutputplants
SHARED TOKENS (29): "air", "beyond", "capacity", "connected", "demand", "economic", "economics", "electrical", "energy", "experience", "form", "forms", "large", "largest", "load", "making", "management", "need", "output", "plants"....
0.300
capacityconsumerconventionaldemandelectricelectricalenergyformgenerationhydroelectricincreasesintermittentinternationallessloadmarketnetplantplantspower
SHARED TOKENS (30): "capacity", "consumer", "conventional", "demand", "electric", "electrical", "energy", "form", "generation", "hydroelectric", "increases", "intermittent", "international", "less", "load", "market", "net", "plant", "plants", "power"....
0.300
Private equity ↗ KW CROSS HIGH
businesscapitalcategorycontroldescribeddevelopmentexpansionfinancefinancialfirmsgeneralgoalsinvestmentlimitedmanagementoperationalownershipprivateproductprovide
SHARED TOKENS (26): "business", "capital", "category", "control", "described", "development", "expansion", "finance", "financial", "firms", "general", "goals", "investment", "limited", "management", "operational", "ownership", "private", "product", "provide"....
0.300
advancedassociatedbeyondchemicalcommercializationcontrolledenergyexistfacilitiesformgasheatinghighlymaterialmeanspersonnelpotentiallypowerprocessprocesses
SHARED TOKENS (32): "advanced", "associated", "beyond", "chemical", "commercialization", "controlled", "energy", "exist", "facilities", "form", "gas", "heating", "highly", "material", "means", "personnel", "potentially", "power", "process", "processes"....
0.300
agreementassetassetsbuildingbusinessbusinessescasecommercialcontractcontractscustomerdirectlydistributedenergyfarmsfirmsfixedformgenerationgovernment
SHARED TOKENS (32): "agreement", "asset", "assets", "building", "business", "businesses", "case", "commercial", "contract", "contracts", "customer", "directly", "distributed", "energy", "farms", "firms", "fixed", "form", "generation", "government"....
0.300
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | EXACT TITLE in manufacturing_food_processing: "Northwest Nazarene University".
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesagriculturalassociatedchaincoldconsumptiondistributeddistributionequipmentfoodmaintainmanagementproductionqualityrequiressafetysequencestoragesupplyuses
SHARED TOKENS (21): "activities", "agricultural", "associated", "chain", "cold", "consumption", "distributed", "distribution", "equipment", "food", "maintain", "management", "production", "quality", "requires", "safety", "sequence", "storage", "supply", "uses"....
0.300
activitiesalreadycannotcategorieschemicalcontainscoolingcurrentdependsdevelopeddisposaleartheconomicenergygenerationgovernmenthealthhighlyinternationalmanagement
SHARED TOKENS (43): "activities", "already", "cannot", "categories", "chemical", "contains", "cooling", "current", "depends", "developed", "disposal", "earth", "economic", "energy", "generation", "government", "health", "highly", "international", "management"....
0.300
activitiesdesigndisposaldocumenteartheconomicseconomyenergyengineeringfieldfunctionglobalgrowingimpactsindustrialintegratedinvolvingmaterialmultiplenetwork
SHARED TOKENS (28): "activities", "design", "disposal", "document", "earth", "economics", "economy", "energy", "engineering", "field", "function", "global", "growing", "impacts", "industrial", "integrated", "involving", "material", "multiple", "network"....
0.300
agricultureapplicationchemicalcontroldairydesigndevelopmentenergyengineeringengineersfieldfoodindustriallargelawmakingmanufacturingmaterialmaterialsmineral
SHARED TOKENS (28): "agriculture", "application", "chemical", "control", "dairy", "design", "development", "energy", "engineering", "engineers", "field", "food", "industrial", "large", "law", "making", "manufacturing", "material", "materials", "mineral"....
0.300
actdatadescribeddevelopmentdisposalenergyfacilitiesfederalgovernmentinformationlawmaterialsprivateprocessesproductionprogramprovisionsregulationregulatorysupport
SHARED TOKENS (22): "act", "data", "described", "development", "disposal", "energy", "facilities", "federal", "government", "information", "law", "materials", "private", "processes", "production", "program", "provisions", "regulation", "regulatory", "support"....
0.300
commonlyconstraintsconvertscurrentdirectdirectlyelectricelectricalequipmentinstallationlargerneighborhoodpowerproviderequiresstationsuppliessupply
SHARED TOKENS (18): "commonly", "constraints", "converts", "current", "direct", "directly", "electric", "electrical", "equipment", "installation", "larger", "neighborhood", "power", "provide", "requires", "station", "supplies", "supply".
0.300
americanfarmsproducedsoldsummer
SHARED TOKENS (5): "american", "farms", "produced", "sold", "summer". | EXACT TITLE in manufacturing_food_processing: "Summer sausage".
0.300
capacityconnectioncontrolcoolingcustomerdemandelectricelectricalenergyevenfacilityformgasglobalgrowinginsidelargelargestlessload
SHARED TOKENS (35): "capacity", "connection", "control", "cooling", "customer", "demand", "electric", "electrical", "energy", "even", "facility", "form", "gas", "global", "growing", "inside", "large", "largest", "less", "load"....
0.300
businessbusinessescommercialcreatedecisionsfirmsgoalsidentifiedinfluencemanagementmultipleorganizationownershiprelatedrelationshipswillingness
SHARED TOKENS (16): "business", "businesses", "commercial", "create", "decisions", "firms", "goals", "identified", "influence", "management", "multiple", "organization", "ownership", "related", "relationships", "willingness".
🫐 BERRY35 edges
0.280
acquiredactanalysiscleanconventionaldetermineplantqualityratherseparatetotaltreatmentwastewaterwater
SHARED TOKENS (14): "acquired", "act", "analysis", "clean", "conventional", "determine", "plant", "quality", "rather", "separate", "total", "treatment", "wastewater", "water".
0.280
createfoodproducingroles
SHARED TOKENS (4): "create", "food", "producing", "roles". | EXACT TITLE in manufacturing_food_processing: "Food microbiology".
0.280
departmenthealthidahopublic
SHARED TOKENS (4): "department", "health", "idaho", "public". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Health and Welfare".
0.280
directenergyequipmentidentifyingindustrieslawmaintenancepowerquestionrequiressafetytestingworkworker
SHARED TOKENS (14): "direct", "energy", "equipment", "identifying", "industries", "law", "maintenance", "power", "question", "requires", "safety", "testing", "work", "worker".
0.280
beginningboisefallshomeidahointerstatemajormetropolitannearnorthwestoregonriverroutessnake
SHARED TOKENS (14): "beginning", "boise", "falls", "home", "idaho", "interstate", "major", "metropolitan", "near", "northwest", "oregon", "river", "routes", "snake".
0.280
departmentenergyfederalgasgovernmentindependentinterstatelicensingpipelineregulatesregulatoryreviewsstoragewholesale
SHARED TOKENS (14): "department", "energy", "federal", "gas", "government", "independent", "interstate", "licensing", "pipeline", "regulates", "regulatory", "reviews", "storage", "wholesale".
0.260
Fire safety ↗ Q2997557 KW CROSS HIGH
alreadybuildingbuildingscodescommonlyconstructiondepartmentdivisionfireincreasespracticessafetystructures
SHARED TOKENS (13): "already", "building", "buildings", "codes", "commonly", "construction", "department", "division", "fire", "increases", "practices", "safety", "structures".
0.260
americanmanufacturingoperations
SHARED TOKENS (3): "american", "manufacturing", "operations". | EXACT TITLE in manufacturing_food_processing: "Packaging Corporation of America".
0.260
americancompletedcontrolfallsidahoirrigationnearpowerriversecondsnakestructurewestern
SHARED TOKENS (13): "american", "completed", "control", "falls", "idaho", "irrigation", "near", "power", "river", "second", "snake", "structure", "western".
0.260
centralconstructionconsumptiondistributionfacilityfoodindustrialplantprocessprocessingproducingproductionworks
SHARED TOKENS (13): "central", "construction", "consumption", "distribution", "facility", "food", "industrial", "plant", "process", "processing", "producing", "production", "works".
0.260
aircasescombustioncommonlyconditionscontrolledeffectsforceindustrialmaterialrapidrolesafely
SHARED TOKENS (13): "air", "cases", "combustion", "commonly", "conditions", "controlled", "effects", "force", "industrial", "material", "rapid", "role", "safely".
0.240
americancommonlyequipmentgeneralhospitalsinformationmajorpreferredprogramresearchspenttitle
SHARED TOKENS (12): "american", "commonly", "equipment", "general", "hospitals", "information", "major", "preferred", "program", "research", "spent", "title".
0.240
Sugar industry ↗ Q227870 KW CROSS HIGH
byproductseconomicfoodinternationalmarketprocessingproducedproducesproductionrolesignificantsupporting
SHARED TOKENS (12): "byproducts", "economic", "food", "international", "market", "processing", "produced", "produces", "production", "role", "significant", "supporting".
0.240
associatedboisecentercontainsfederallyidaholargestmetropolitanowyheesidetribalvalley
SHARED TOKENS (12): "associated", "boise", "center", "contains", "federally", "idaho", "largest", "metropolitan", "owyhee", "side", "tribal", "valley".
0.240
Barley ↗ Q11577 KW CROSS HIGH
amongcommonlygivinglessmajormakingmaterialpreparationproducedproductionrolesource
SHARED TOKENS (12): "among", "commonly", "giving", "less", "major", "making", "material", "preparation", "produced", "production", "role", "source".
0.240
By-product ↗ Q1128255 KW CROSS HIGH
caseschemicalcommercialdisposaldistinctionfoodmanufacturingprocessproducedproductproductionwaste
SHARED TOKENS (12): "cases", "chemical", "commercial", "disposal", "distinction", "food", "manufacturing", "process", "produced", "product", "production", "waste".
0.220
soldwater
SHARED TOKENS (2): "sold", "water". | EXACT TITLE in manufacturing_food_processing: "Frozen dessert".
0.220
coldstorage
SHARED TOKENS (2): "cold", "storage". | EXACT TITLE in manufacturing_food_processing: "Cold storage".
0.210
December 20 ↗ Q2455 EXACT TITLE
remain
SHARED TOKENS (1): "remain". | EXACT TITLE in nuclear_clean_energy: "December 20".
0.210
Bel Group ↗ Q491034 EXACT TITLE
centered
SHARED TOKENS (1): "centered". | EXACT TITLE in manufacturing_food_processing: "Bel Group".
0.200
basecapacityconstructiondemandloadoutputplantplantspowerproducing
SHARED TOKENS (10): "base", "capacity", "construction", "demand", "load", "output", "plant", "plants", "power", "producing".
0.200
chaindisposalmanufacturingoperationpreparationprocessproductionrecyclingsafelyspent
SHARED TOKENS (10): "chain", "disposal", "manufacturing", "operation", "preparation", "process", "production", "recycling", "safely", "spent".
0.200
designengineerslargelinesmakingmaterialpaperproductrecyclingsource
SHARED TOKENS (10): "design", "engineers", "large", "lines", "making", "material", "paper", "product", "recycling", "source".
0.200
electricalidaholaboratorynationalpowersafetystationsupplytestingwater
SHARED TOKENS (10): "electrical", "idaho", "laboratory", "national", "power", "safety", "station", "supply", "testing", "water".
0.200
generationinterestmaterialmultipleoperatedoperationplantpowerresearchtechnology
SHARED TOKENS (10): "generation", "interest", "material", "multiple", "operated", "operation", "plant", "power", "research", "technology".
0.180
Brownlee Dam ↗ Q4976595 KW CROSS HIGH
canyonearthhydroelectricidahooregonriversnakewashingtonwestern
SHARED TOKENS (9): "canyon", "earth", "hydroelectric", "idaho", "oregon", "river", "snake", "washington", "western".
0.180
applicableapproximatelyconsumptiondirectlyeconomiceffectsestimatedevenfood
SHARED TOKENS (9): "applicable", "approximately", "consumption", "directly", "economic", "effects", "estimated", "even", "food".
0.160
carryconsumerlimitedsalessmallsoldspacespecialty
SHARED TOKENS (8): "carry", "consumer", "limited", "sales", "small", "sold", "space", "specialty".
0.120
actdisposalfederalgoverninglawwaste
SHARED TOKENS (6): "act", "disposal", "federal", "governing", "law", "waste".
0.120
Oxbow Dam ↗ Q7115136 KW CROSS HIGH
canyonhydroelectricoregonriversnakewestern
SHARED TOKENS (6): "canyon", "hydroelectric", "oregon", "river", "snake", "western".
0.120
J. R. Simplot ↗ Q326178 KW CROSS HIGH
agriculturalamericanboiseestimatedidahosupplier
SHARED TOKENS (6): "agricultural", "american", "boise", "estimated", "idaho", "supplier".
0.100
boisehomeidaholargestmetropolitan
SHARED TOKENS (5): "boise", "home", "idaho", "largest", "metropolitan".
0.100
energypowerprogramsafetytest
SHARED TOKENS (5): "energy", "power", "program", "safety", "test".
0.100
americandevelopmentheadquarteredprivatetechnology
SHARED TOKENS (5): "american", "development", "headquartered", "private", "technology".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseeagleidahonorthwest
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "northwest".
◈ Frequently Asked Questions
Nuclear Clean Energy × Manufacturing Food Processing — Treasure Valley
HAIKU · HIGH GATE
How does nuclear clean energy production in the Treasure Valley affect water availability for food processing manufacturers?
Nuclear facilities near the Snake River Plain require cooling water regulated under the Clean Water Act, which the Idaho Department of Environmental Quality oversees for both energy and manufacturing operations in Ada County and surrounding areas. Food processors in Nampa and Boise depend on consistent Snake River and Boise River access, making coordination between nuclear operators and the agricultural processing industry essential under federal EPA standards.
What building code requirements apply to nuclear facilities that support food processing operations in the Treasure Valley?
The Occupational Safety and Health Administration enforces safety codes for both nuclear infrastructure and food manufacturing facilities across Boise, Caldwell, and Nampa, ensuring that any nuclear-powered or nuclear-adjacent operations meet standards for worker protection. Ada County building code compliance applies uniformly to industrial facilities regardless of whether they use nuclear or conventional energy sources.
How do University of Idaho and Boise State University contribute to research linking nuclear energy and food processing in the region?
Both institutions conduct research on clean energy applications and agricultural manufacturing within the Treasure Valley, leveraging their location in the Snake River Plain to study how nuclear power can reduce environmental impacts on regional water systems. University of Idaho and Boise State research directly informs how the Idaho Department of Environmental Quality and local manufacturers approach sustainability.
Why is the Snake River critical to both nuclear operations and food processing in the western Treasure Valley?
The Snake River supplies cooling water for nuclear facilities and processing water for food manufacturers in the Nampa and Caldwell region, making it subject to Clean Water Act protections monitored by the EPA and Idaho Department of Environmental Quality. Both industries competing for consistent river access requires coordination under existing water management agreements that apply across Ada County.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Nuclear Clean Energy × Manufacturing Food Processing 19 QID bridges 262 edges 7,157 ext links 2026-07-17 22:32:30 UTC 91cbdf9b00ed97e1
Nuclear Clean Energy corridor ↗ Manufacturing Food Processing corridor ↗ Manufacturing Food Processing × Nuclear Clean Energy ↗ boisestandard.org/standard ↗
Parent Corridors
Nuclear Clean Energy × All Other Verticals