—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Nuclear Clean Energy ↔ relates to ↔ Biotech Life Sciences

17 Wikipedia bridge articles confirmed in both vertical ledgers. 254 deterministic cross-vertical edges. 7,055 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
254 Cross Edges
7,055 External Sources
280 Wikipedia Articles
17 🌲 Evergreen
205 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Nuclear Clean Energy
× Biotech Life Sciences
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
254
External Sources Harvested
7,055
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State University
score: 1.1500  ·  type: exact_title_cross  ·  16 shared tokens
QID Bridge Titles (17)
Idaho State UniversityUniversity of IdahoTreasure ValleyIdaho National LaboratoryBoise State UniversityIdaho Department of Environmental QualityResource Conservation and Recovery ActBoise RiverUnited States Environmental Protection AgencyBoise, IdahoOccupational Safety and Health AdministrationNampa, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, IdahoSnake River Plain
Shared Semantics (20 tokens)
idahoboisemetropolitanpopulationresearchamongpublicuniversityapproximatelyriverwesterndepartmentfederalclassifiedfallsmeridianprogramsprimarilyagriculturallocal
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:30:12 UTC
Content Hash
ecd7f729b621264f
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho State University
Q1656608 EXACT TITLE 1.150
QID OVERLAP: Q1656608 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (16): "activity", "among", "campus", "classified", "doctoral", "falls", "idaho", "meridian", "percent", "pocatello", "programs", "public", "research", "students", "universities", "university". | URL->A (1): http://www.isu.edu/. | EXACT TITLE in nuclear_clean_energy: "Idaho State University". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
activityamongcampusclassifieddoctoralfallsidahomeridianpercentpocatelloprogramspublicresearchstudentsuniversitiesuniversity
ho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (22): "among", "approximately", "boise", "campus", "classified", "division", "established", "falls", "graduate", "idaho", "later", "operates", "primarily", "production", "professional", "public", "research", "statewide", "students", "uidaho".... | EXACT TITLE in nuclear_clean_energy: "University of Idaho". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
amongapproximatelyboisecampusclassifieddivisionestablishedfallsgraduateidaholateroperatesprimarilyproductionprofessionalpublicresearchstatewidestudentsuidahoundergraduateuniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "metropolitan", "opportunities", "primarily", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in nuclear_clean_energy: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalmetropolitanopportunitiesprimarilyregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Idaho National Laboratory
Q1314158 EXACT TITLE 1.000
QID OVERLAP: Q1314158 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (27): "approximately", "behavior", "built", "commonly", "complex", "current", "department", "eastern", "energy", "engineering", "environmental", "facilities", "facility", "falls", "history", "idaho", "institute", "knowledge", "laboratories", "laboratory".... | EXACT TITLE in nuclear_clean_energy: "Idaho National Laboratory". | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
approximatelybehaviorbuiltcommonlycomplexcurrentdepartmenteasternenergyengineeringenvironmentalfacilitiesfacilityfallshistoryidahoinstituteknowledgelaboratorieslaboratorynationalorganizationsplantprincipallyresearchsitewestern
a 890-square-mile (2,310 km2) complex in the high desert of eastern Idaho, between Arco to the west and Idaho Falls and Blackfoot to the east. Atomic City, Idaho is just south. The laboratory employs approximately 5,700 people. History What is now Idaho National Laboratory in southeastern Idaho began its life as a U.S. government artillery test range in the 1940s. Shortly after the Japanese attacked Pearl Harbor, the U.S. military needed a safe location for performing maintenance on the Navy's most powerful turreted guns. The guns were brought in via rail to near Pocatello, Idaho, to be re-sleeved, rifled and tested. As the Navy began to focus on post-World War II and Cold War threats, the types of projects worked on in the Idaho desert changed, too. Perhaps the most well-known was the building of the prototype reactor for the world's first nuclear-powered submarine, the USS Nautilus. In 1949, the federal research facility was established as the National Reactor Testing Station (NRTS). In 1975, the United States Atomic Energy Commission (AEC) was divided into the Energy Research and Development Administration (ERDA) and the Nuclear Regulatory Commission (NRC). The Idaho site was renamed the Idaho National Engineering Laboratory (INEL) in 1974. After two decades as INEL, the name was changed again to the Idaho National Engineering and Environmental Laboratory (INEEL) in 1997. Throughout its lifetime, there have been more than 50 one-of-a-kind nuclear reactors built by various organizations at the facility for testing; all but three are out of service. On February 1, 2005, Battelle Energy Alliance took over operation of the lab from Bechtel, merged with Argonne National Laboratory-West, and the facility name was changed to "Idaho National Laboratory" (INL). At this time the site's clean-up activities were moved to a separate contract, the Idaho Cleanup Project, which is currently managed by the Idaho Environmental Coalition, LLC. Research activities were consolidated in the newly named Idaho National Laboratory. According to AP news reports in April 2018, a single barrel of "radioactive sludge" ruptured while being prepared for transport to the Waste Isolation Pilot Plant in Southeast New Mexico for permanent storage.
Light Water Reactor Sustainability (LWRS) program The Light Water Reactor Sustainability Program supports national efforts to do the research and gather the information necessary to demonstrate whether it is safe and prudent to apply for extensions beyond 60 years of operating life. The Program aims to safely and economically extend the service lives of the more than 100 electricity-generating nuclear power plants in the United States. The program brings together technical information, performs important research and organizes data to be used in license-extension applications. Advanced Test Reactor National Scientific User Facility (ATR NSUF) INL's Advanced Test Reactor is a research reactor located approximately 50 miles (80 km) from Idaho Falls, Idaho. The Department of Energy named Advanced Test Reactor (ATR) a National Scientific User Facility in April 2007. This designation opened the facility to use by university-led scientific research groups and gives them free access to the ATR and other resources at INL and partner facilities.
Nuclear waste processing In mid-2014, construction of a new liquid waste processing facility, the Integrated Waste Treatment Unit (IWTU), was nearing completion at INTEC on the INL site. It will process approximately 900,000 gallons of liquid nuclear waste using a steam reforming process to produce a granular product suitable for disposal. The facility is the first of its kind and based on a scaled prototype.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (24): "activity", "among", "boise", "business", "classified", "college", "division", "doctoral", "economics", "education", "engineering", "graduate", "health", "idaho", "independent", "institution", "master", "program", "programs", "public".... | EXACT TITLE in nuclear_clean_energy: "Boise State University". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityamongboisebusinessclassifiedcollegedivisiondoctoraleconomicseducationengineeringgraduatehealthidahoindependentinstitutionmasterprogramprogramspublicreportedresearchuniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho Department of Environmental Quality
Q5987351 EXACT TITLE 0.900
QID OVERLAP: Q5987351 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations", "responsible". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Environmental Quality". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
boisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulationsresponsible
tment of Environmental Quality is the department of the Idaho state government responsible for administering state and federal environmental laws and regulations. The department's main offices are in Boise, and six regional offices are also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act.
also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act. Before 2000, DEQ in Idaho was a division of the Department of Health and Welfare. Structure and functions It is organized into five divisions: Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Resource Conservation and Recovery Act
Q7315799 EXACT TITLE 0.900
QID OVERLAP: Q7315799 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "act", "conservation", "disposal", "federal", "governing", "hazardous", "law", "recovery", "resource", "waste". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
actconservationdisposalfederalgoverninghazardouslawrecoveryresourcewaste
The Resource Conservation and Recovery Act (RCRA), enacted in 1976, is the primary federal law in the United States governing the disposal of solid waste and hazardous waste. History and goals Congress enacted RCRA to address the increasing problems the nation faced from its growing volume of municipal and industrial waste. RCRA was an amendment of the Solid Waste Disposal Act of 1965.
Implementation The EPA publishes waste management regulations, which are codified in Title 40 of the Code of Federal Regulations in parts 239 through 282. Regulations regarding management of hazardous waste begin in part 260.
Subtitle F: Federal responsibilities Application of Federal, State and Local Law to Federal Facilities Federal procurement Cooperation with EPA; Applicability of solid waste disposal guidelines to executive agencies Subtitle G: Miscellaneous provisions Whistleblower protection.
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "river", "western". | EXACT TITLE in biotech_life_sciences: "Boise River".
agriculturalapproximatelyboiseidahoriverwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (39): "approved", "assessment", "conducts", "conservation", "department", "education", "energy", "engineers", "environmental", "establishing", "establishment", "federal", "federally", "government", "hearings", "independent", "industries", "information", "laboratories", "legal"....
approvedassessmentconductsconservationdepartmenteducationenergyengineersenvironmentalestablishingestablishmentfederalfederallygovernmenthearingsindependentindustriesinformationlaboratorieslegallocalmaintainingmattersmonitoringnationaloperationpermittingprogramsproposedprotection+9
xon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalemployershomeidaholocallymajormanufacturingmetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
O
Q746186 QID OVERLAP 0.800
QID OVERLAP: Q746186 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (21): "act", "conditions", "department", "education", "effects", "employment", "established", "federal", "health", "inspections", "labor", "law", "mission", "occupational", "reduce", "regulations", "regulatory", "safety", "standards", "training"....
actconditionsdepartmenteducationeffectsemploymentestablishedfederalhealthinspectionslaborlawmissionoccupationalreduceregulationsregulatorysafetystandardstrainingworking
States Department of Labor that originally had federal visitorial powers to inspect and examine workplaces. The United States Congress established the agency under the Occupational Safety and Health Act (OSH Act), which President Richard M. Nixon signed into law on December 29, 1970. OSHA's mission is to "assure safe and healthy working conditions for working men and women by setting and enforcing standards and by providing training, outreach, education, and assistance". The agency is also charged with enforcing a variety of whistleblower statutes and regulations.
History From its creation in 1934, the Bureau of Labor Standards of the Department of Labor addressed some work safety issues. The economic boom and associated labor turnover during World War II worsened work safety in nearly all areas of the United States economy, but after 1945 accidents again declined as long-term forces reasserted themselves. Additionally, new and powerful labor unions played an increasingly important role in worker safety post-World War II. In the 1960s, increasing economic expansion again led to rising injury rates, and the resulting political pressures led Congress to establish the Occupational Safety and Health Administration (OSHA) on April 28, 1971, the date that the Occupational Health and Safety Act became effective. The new agency incorporated much of what had been the original Bureau of Labor Standards. George Guenther was appointed by Labor Secretary James D. Hodgson as the agency's first director. OSHA has run a number of training, compliance assistance, and health and safety recognition programs throughout its history. The OSHA Training Institute, which trains government and private sector health and safety personnel, began in 1972. In 1978, the agency began a grant-making program, now called the Susan Harwood Training Grant Program, to train workers and employers in reducing workplace hazards.
OSH Act coverage The OSH Act covers most private-sector employers and their workers, in addition to some public-sector employers and workers in the 50 states and certain territories and jurisdictions under federal authority. Those jurisdictions include the District of Columbia, Puerto Rico, the Virgin Islands, American Samoa, Guam, Northern Mariana Islands, Wake Island, Johnston Island, and the Outer Continental Shelf Lands as defined in the Outer Continental Shelf Lands Act. Private sector employers The OSH Act covers most private sector employers in all 50 states, the District of Columbia, and other U.S. jurisdictions—either directly through federal OSHA or through an OSHA-approved state plan. State plans are OSHA-approved job safety and health programs operated by individual states instead of federal OSHA. Federal OSHA approves and monitors all state plans and provides as much as fifty percent of the funding for each program.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "university", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannampanorthwestpopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private".
adaboisecapitalhomeidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in nuclear_clean_energy (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Snake River Plain
Q1396049 QID OVERLAP 0.640
QID OVERLAP: Q1396049 in nuclear_clean_energy (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (7): "agricultural", "idaho", "land", "major", "northwest", "primarily", "river".
agriculturalidaholandmajornorthwestprimarilyriver
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain is a geologic feature located primarily within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
237 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP237 edges
🌿 BRANCH205 edges
0.590
cleancommunitydifferenteducationenergyidahoidentifymethodsorganizationriverwasteworking
SHARED TOKENS (12): "clean", "community", "different", "education", "energy", "idaho", "identify", "methods", "organization", "river", "waste", "working". | URL->A (1): http://snakeriveralliance.org/. | EXACT TITLE in nuclear_clean_energy: "Snake River Alliance".
0.500
chemicaldevelopmentdistributeddistributioneconomiceconomyelectricenergyhistoryindustrialprocessprocessesresourcessourcestoragesystemstechnologytransitiontransport
SHARED TOKENS (19): "chemical", "development", "distributed", "distribution", "economic", "economy", "electric", "energy", "history", "industrial", "process", "processes", "resources", "source", "storage", "systems", "technology", "transition", "transport". | EXACT TITLE in nuclear_clean_energy: "Electrification".
0.500
Antibody ↗ Q79460 EXACT TITLE
becomecapacitychemicalclassificationcontainsdeliverydescribesdescribingdifferentdirectlydistinctdistributionformfunctionfunctionsgeneralidentifyindependentlylargeleast
SHARED TOKENS (36): "become", "capacity", "chemical", "classification", "contains", "delivery", "describes", "describing", "different", "directly", "distinct", "distribution", "form", "function", "functions", "general", "identify", "independently", "large", "least".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
agricultureanotherapplicationsappliesapprovalbenefitsbiomedicalchemicalcleanconsequentlycoredevelopeddevelopmentdirectlyengineeringenvironmentalexistingfieldfieldsfunctions
SHARED TOKENS (66): "agriculture", "another", "applications", "applies", "approval", "benefits", "biomedical", "chemical", "clean", "consequently", "core", "developed", "development", "directly", "engineering", "environmental", "existing", "field", "fields", "functions".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
activityconditionsdependsdirectlyenvironmentalfoodformhealthmaintainmajorphysicalpreparationrequiredsuppliedwaterwork
SHARED TOKENS (16): "activity", "conditions", "depends", "directly", "environmental", "food", "form", "health", "maintain", "major", "physical", "preparation", "required", "supplied", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
activitiesagriculturalairapproximatelychangeindustrialirrigationmultipleresourceresourcesriversmallsourcesupplywastewaterwater
SHARED TOKENS (16): "activities", "agricultural", "air", "approximately", "change", "industrial", "irrigation", "multiple", "resource", "resources", "river", "small", "source", "supply", "wastewater", "water". | EXACT TITLE in biotech_life_sciences: "Water resources".
0.500
becomecapablechemicalcomplexdeterminedifferentelectricfieldfieldsfunctionidentifiedidentitymechanismprocedurestructure
SHARED TOKENS (15): "become", "capable", "chemical", "complex", "determine", "different", "electric", "field", "fields", "function", "identified", "identity", "mechanism", "procedure", "structure". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedbasinboisecapitalcontainscropdistinctearlyeasterneconomygeographicidahoindustriesisolatedlaboratorylandmanufacturing
SHARED TOKENS (38): "agricultural", "agriculture", "approximately", "associated", "basin", "boise", "capital", "contains", "crop", "distinct", "early", "eastern", "economy", "geographic", "idaho", "industries", "isolated", "laboratory", "land", "manufacturing".... | EXACT TITLE in nuclear_clean_energy: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
0.500
builtconditionsconstructioncontrolcurrentlydepartmentenergyfacilityidahoinstrumentationlaboratorymaterialmaterialsnationaloperationoriginalplannedplantsprogramsystems
SHARED TOKENS (22): "built", "conditions", "construction", "control", "currently", "department", "energy", "facility", "idaho", "instrumentation", "laboratory", "material", "materials", "national", "operation", "original", "planned", "plants", "program", "systems".... | EXACT TITLE in nuclear_clean_energy: "Transient Reactor Test Facility".
0.500
Vaccine ↗ Q134808 EXACT TITLE
alreadyassociatedcontainsdescribeddevelopeddevelopmentdifferenteffectshealthlicensedorganizationpracticepreparationproductionproposedreportsresponsiblesafetysciencesystem
SHARED TOKENS (22): "already", "associated", "contains", "described", "developed", "development", "different", "effects", "health", "licensed", "organization", "practice", "preparation", "production", "proposed", "reports", "responsible", "safety", "science", "system".... | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
actaddauthoritycontroldevicesfederalfoodformimplementationlawmarketednationalprincipalproductprovisionsregulationsrequirementssafetystudy
SHARED TOKENS (19): "act", "add", "authority", "control", "devices", "federal", "food", "form", "implementation", "law", "marketed", "national", "principal", "product", "provisions", "regulations", "requirements", "safety", "study". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
adaaddsboisecanyoncommonlycurrentlydesignatedhomeidahomeridianmetropolitannampanorthwestpacificpercentpopulationsectiontreasurevalley
SHARED TOKENS (19): "ada", "adds", "boise", "canyon", "commonly", "currently", "designated", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "pacific", "percent", "population", "section", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
0.500
approvalcannotcommercializationcontractdevelopmentdevicesentryevidenceexpandexperienceexpertiseformindustriesinstitutionsinternationallargemaintainmanagementmarketsneed
SHARED TOKENS (35): "approval", "cannot", "commercialization", "contract", "development", "devices", "entry", "evidence", "expand", "experience", "expertise", "form", "industries", "institutions", "international", "large", "maintain", "management", "markets", "need".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
advancedapprovalsbiomedicalbuildingcategoryclassificationcomplexcomponentsconditionscropdevicesdifferentdirectlyengineeringgeneralisolatedmarketoutsidepathwaysplant
SHARED TOKENS (33): "advanced", "approvals", "biomedical", "building", "category", "classification", "complex", "components", "conditions", "crop", "devices", "different", "directly", "engineering", "general", "isolated", "market", "outside", "pathways", "plant".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
amonganalysisassessmentchangeconditionsdatadecisionsdescriptiondesigndistributioneffectsengineeringenvironmentalfunctiongeneralhealthhealthcareidentifyingknowledgemajor
SHARED TOKENS (38): "among", "analysis", "assessment", "change", "conditions", "data", "decisions", "description", "design", "distribution", "effects", "engineering", "environmental", "function", "general", "health", "healthcare", "identifying", "knowledge", "major".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
actappliescurrentlyenvironmentalfederalfoodintendedlawprivateprotectionpublicqualityregulatedrequiredstandardssystemsystemswater
SHARED TOKENS (18): "act", "applies", "currently", "environmental", "federal", "food", "intended", "law", "private", "protection", "public", "quality", "regulated", "required", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Immunology ↗ Q101929 EXACT TITLE
advancedapplicationsassociatedbecomechemicalcomponentsearlyfieldshealthlatermaintainphysicalratherrecognitionresponsesmallstudiesstudysystemsystems
SHARED TOKENS (21): "advanced", "applications", "associated", "become", "chemical", "components", "early", "fields", "health", "later", "maintain", "physical", "rather", "recognition", "response", "small", "studies", "study", "system", "systems".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityadvancedbehaviorcenteredchemicalcomplexcouncilcovereddescribeddetaileddiscoveryearlyfieldfocusedfunctiongoverninglaboratorymechanismsmodelorganization
SHARED TOKENS (34): "activity", "advanced", "behavior", "centered", "chemical", "complex", "council", "covered", "described", "detailed", "discovery", "early", "field", "focused", "function", "governing", "laboratory", "mechanisms", "model", "organization".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
aircleancommonlycontainsfacilitieshazardousindustrialinsidemaintainsmanufacturingmaterialmaterialspermitsprocessesproductionresearchscientificsemiconductorsizespace
SHARED TOKENS (21): "air", "clean", "commonly", "contains", "facilities", "hazardous", "industrial", "inside", "maintains", "manufacturing", "material", "materials", "permits", "processes", "production", "research", "scientific", "semiconductor", "size", "space".... | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalavailabilitybuildingbuiltclassifiedcleanconstructioncriticaldesigndevelopedearlyengineeringfailfunctionsgenerategoverninghealthimproveincreaseindustrial
SHARED TOKENS (48): "additional", "availability", "building", "built", "classified", "clean", "construction", "critical", "design", "developed", "early", "engineering", "fail", "functions", "generate", "governing", "health", "improve", "increase", "industrial".... | EXACT TITLE in nuclear_clean_energy: "Dam".
0.500
Virology ↗ Q7215 EXACT TITLE
agriculturebeginningclassificationcoveringdetectiondifferentdistinctfieldfunctionshealthlaboratorymethodsofficialplantplantsproposedresearchsciencescientificsignificant
SHARED TOKENS (24): "agriculture", "beginning", "classification", "covering", "detection", "different", "distinct", "field", "functions", "health", "laboratory", "methods", "official", "plant", "plants", "proposed", "research", "science", "scientific", "significant".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
chemicalcontrolconventionaldegreedevicesenergyengineeringfieldformphysicalprocessprocessesproductionsafetyscale
SHARED TOKENS (15): "chemical", "control", "conventional", "degree", "devices", "energy", "engineering", "field", "form", "physical", "process", "processes", "production", "safety", "scale". | EXACT TITLE in nuclear_clean_energy: "Microreactor".
0.500
Biosensor ↗ Q669391 EXACT TITLE
anotherassociatedchemicalconnectsdetectiondifferentengineeringgeneratematerialprimarilyrecognizesresponsiblesensorstudyworkingworks
SHARED TOKENS (16): "another", "associated", "chemical", "connects", "detection", "different", "engineering", "generate", "material", "primarily", "recognizes", "responsible", "sensor", "study", "working", "works". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.500
annualanotherbecomebusinesscapitalcompleteconsequentlycontroldecisionsdevelopmentdisposalearlyentityfinancefinancingfirmsformfundinggeneratinggrowth
SHARED TOKENS (46): "annual", "another", "become", "business", "capital", "complete", "consequently", "control", "decisions", "development", "disposal", "early", "entity", "finance", "financing", "firms", "form", "funding", "generating", "growth".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
Drought ↗ Q43059 EXACT TITLE
activityaffectingagricultureairannualavailabilitybasinbecomechangeconditionsdirectlyeconomiceconomyeffectselectricenvironmentalexperiencefoodhealthhistory
SHARED TOKENS (36): "activity", "affecting", "agriculture", "air", "annual", "availability", "basin", "become", "change", "conditions", "directly", "economic", "economy", "effects", "electric", "environmental", "experience", "food", "health", "history".... | EXACT TITLE in nuclear_clean_energy: "Drought".
0.500
analysisappliesapprovalbehaviorbenefitsbiomedicalboardcodescommonlydelivereddesignateddeterminedevicesfieldsformhealthindependentinstitutioninstitutionalinternational
SHARED TOKENS (42): "analysis", "applies", "approval", "behavior", "benefits", "biomedical", "board", "codes", "commonly", "delivered", "designated", "determine", "devices", "fields", "form", "health", "independent", "institution", "institutional", "international".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
agriculturalanotherchemicaldisposalenvironmentfacilityindustrialmunicipalperformsplantplantsprocessprocessespurposesafelyseparationtreatmentuseswastewastewater
SHARED TOKENS (21): "agricultural", "another", "chemical", "disposal", "environment", "facility", "industrial", "municipal", "performs", "plant", "plants", "process", "processes", "purpose", "safely", "separation", "treatment", "uses", "waste", "wastewater".... | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
additionallybusinessescategorycreatedevelopedeconomicgivesinformationlandlawlegalmodernoriginalownershipprocessespropertypurposerightssystems
SHARED TOKENS (19): "additionally", "businesses", "category", "create", "developed", "economic", "gives", "information", "land", "law", "legal", "modern", "original", "ownership", "processes", "property", "purpose", "rights", "systems". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
Toxicology ↗ Q7218 EXACT TITLE
academicchemicalcombiningcurrentlyeffectsenvironmentfieldinfluencemovementoverlappingpracticepracticesrelationshipresearchroutescientificstudysubjecttreatingtreatment
SHARED TOKENS (21): "academic", "chemical", "combining", "currently", "effects", "environment", "field", "influence", "movement", "overlapping", "practice", "practices", "relationship", "research", "route", "scientific", "study", "subject", "treating", "treatment".... | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralchangecommercialconnectedconsumercontroldifferentdistributionelectricelectricalenergyfunctionsgeneratingindustrialinfrastructurelargeownedperformplant
SHARED TOKENS (27): "approximately", "central", "change", "commercial", "connected", "consumer", "control", "different", "distribution", "electric", "electrical", "energy", "functions", "generating", "industrial", "infrastructure", "large", "owned", "perform", "plant".... | EXACT TITLE in nuclear_clean_energy: "Substation".
0.500
certificationcompetencecompletefieldformallaborlicensemasteroutsidepracticepractitionersprofessionalregulatedrolesstudysystemtrainingworking
SHARED TOKENS (18): "certification", "competence", "complete", "field", "formal", "labor", "license", "master", "outside", "practice", "practitioners", "professional", "regulated", "roles", "study", "system", "training", "working". | EXACT TITLE in nuclear_clean_energy: "Apprenticeship".
0.500
Microbiology ↗ Q7193 EXACT TITLE
classifiedcomplexcurrentcurrentlydesigndevelopedeffectslessmaterialmeanspossessscientificsmallstudywork
SHARED TOKENS (15): "classified", "complex", "current", "currently", "design", "developed", "effects", "less", "material", "means", "possess", "scientific", "small", "study", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
affordablebecomechemicalclassifiedcommonlycommunitydirectestablishmenthealthindustriesinformationinstitutionallinksmodernmonitoringofficepracticeprofessionalrelatedroles
SHARED TOKENS (27): "affordable", "become", "chemical", "classified", "commonly", "community", "direct", "establishment", "health", "industries", "information", "institutional", "links", "modern", "monitoring", "office", "practice", "professional", "related", "roles".... | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
actclassificationclassificationscontrolcontrolledcurrentlydecisionsdeterminedistributionestablishingfederalfoodinitialinternationalisolatedlawlistingnationalpolicyqualifications
SHARED TOKENS (25): "act", "classification", "classifications", "control", "controlled", "currently", "decisions", "determine", "distribution", "establishing", "federal", "food", "initial", "international", "isolated", "law", "listing", "national", "policy", "qualifications".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
additionallyanalysisapplicationsbeginningcomponentscontroldesigndeterminedevelopmentexternalfieldformhundredsmeansmediamovementprocessprocessesreducesscience
SHARED TOKENS (30): "additionally", "analysis", "applications", "beginning", "components", "control", "design", "determine", "development", "external", "field", "form", "hundreds", "means", "media", "movement", "process", "processes", "reduces", "science".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
agriculturalbiomedicalchemicalcontrolcreatedesigndevicesdiagnosticenergyengineeringengineersequipmentexpertiseimproveknowledgematerialsmechanicalprocessprocessesrapid
SHARED TOKENS (30): "agricultural", "biomedical", "chemical", "control", "create", "design", "devices", "diagnostic", "energy", "engineering", "engineers", "equipment", "expertise", "improve", "knowledge", "materials", "mechanical", "process", "processes", "rapid".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongcapablefieldsgivesindustrialinternationallawlegalmakingmodelsnationalorganizationprivateprocedurepropertyprotectionpublicratherrequirements
SHARED TOKENS (24): "agreements", "among", "capable", "fields", "gives", "industrial", "international", "law", "legal", "making", "models", "national", "organization", "private", "procedure", "property", "protection", "public", "rather", "requirements".... | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
agriculturalanalysisbuildingcomplexdatadevelopmentengineeringfieldinformationlargemethodsmodelingmodelsnetworkspathwaysphysicsprocessprocessingprogrammingregulation
SHARED TOKENS (26): "agricultural", "analysis", "building", "complex", "data", "development", "engineering", "field", "information", "large", "methods", "modeling", "models", "networks", "pathways", "physics", "process", "processing", "programming", "regulation".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
additionallyanotherdevelopmentdiagnosticdifferentengineeringfieldfunctiongrowthhistorylargematerialmaterialsproposedpurposesciencestudysystemsystems
SHARED TOKENS (19): "additionally", "another", "development", "diagnostic", "different", "engineering", "field", "function", "growth", "history", "large", "material", "materials", "proposed", "purpose", "science", "study", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
airalternativeapplicationsassociatedbuiltcapacitycommerciallyconstructioncontrolledenergyenvironmentexpandedfleetgenerategeneratingglobalincreasedlessmovementnear
SHARED TOKENS (33): "air", "alternative", "applications", "associated", "built", "capacity", "commercially", "construction", "controlled", "energy", "environment", "expanded", "fleet", "generate", "generating", "global", "increased", "less", "movement", "near".... | EXACT TITLE in nuclear_clean_energy: "Nuclear power".
0.500
additionallyalreadyapplieschemicalcontroldesigndeviceselectricalengineeringexistingfieldmaterialsciencescientificsystems
SHARED TOKENS (15): "additionally", "already", "applies", "chemical", "control", "design", "devices", "electrical", "engineering", "existing", "field", "material", "science", "scientific", "systems". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.500
businessescapacitychangechangesconsumerscustomersdemanddirectdirectlyeconomicelectricenergygeneralgeneratingimplicationlargemanagementnetnetworksoperate
SHARED TOKENS (33): "businesses", "capacity", "change", "changes", "consumers", "customers", "demand", "direct", "directly", "economic", "electric", "energy", "general", "generating", "implication", "large", "management", "net", "networks", "operate".... | EXACT TITLE in nuclear_clean_energy: "Demand response".
0.500
actactivitiesapproximatelycertificationcommonlycomponentsdecisionsdepartmentdifferentenergyenvironmentalevaluateexperiencefacilitiesfacilityformguidancehearingsholdingindependent
SHARED TOKENS (53): "act", "activities", "approximately", "certification", "commonly", "components", "decisions", "department", "different", "energy", "environmental", "evaluate", "experience", "facilities", "facility", "form", "guidance", "hearings", "holding", "independent".... | EXACT TITLE in nuclear_clean_energy: "Nuclear material".
0.500
actcommunitycontrolleddepartmentdistributionestablishedfederalgovernmentintelligenceinvolvingjurisdictionlawnationaloperationsprotectionratherreportsresponsibleuses
SHARED TOKENS (19): "act", "community", "controlled", "department", "distribution", "established", "federal", "government", "intelligence", "involving", "jurisdiction", "law", "national", "operations", "protection", "rather", "reports", "responsible", "uses". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
activityapprovalapprovedauthoritybecomebiomedicalcentercenterscentralcompletecontractdatadesigndevelopmentdevicesfunctionsgeneratehealthlaboratorymonitoring
SHARED TOKENS (40): "activity", "approval", "approved", "authority", "become", "biomedical", "center", "centers", "central", "complete", "contract", "data", "design", "development", "devices", "functions", "generate", "health", "laboratory", "monitoring".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
agriculturalcentralchemicalconsumersdesigndevelopmentdirectlyearlyevaluationfieldfoodmaterialsmethodsmodernorganizedperformphysicspracticesprocessesprocessing
SHARED TOKENS (30): "agricultural", "central", "chemical", "consumers", "design", "development", "directly", "early", "evaluation", "field", "food", "materials", "methods", "modern", "organized", "perform", "physics", "practices", "processes", "processing".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesbasinbeginningcanyoncentralcommercialconstructioncontrolcovereddevelopedeasternfallshistoryidahoirrigationlargemajornationalnearnorthwest
SHARED TOKENS (39): "activities", "basin", "beginning", "canyon", "central", "commercial", "construction", "control", "covered", "developed", "eastern", "falls", "history", "idaho", "irrigation", "large", "major", "national", "near", "northwest".... | EXACT TITLE in nuclear_clean_energy: "Snake River".
0.500
accreditationairbecomeboardcertificationcommissioningconsumerdesignelectricalenergyfebruaryfieldfieldsinternationaljobsknowledgelicensemaintenancemissionmultiple
SHARED TOKENS (42): "accreditation", "air", "become", "board", "certification", "commissioning", "consumer", "design", "electrical", "energy", "february", "field", "fields", "international", "jobs", "knowledge", "license", "maintenance", "mission", "multiple".... | EXACT TITLE in nuclear_clean_energy: "North American Board of Certified Energy Practitioners".
0.500
affectanalysisassociatedchemicalcomponentsdifferentestablishingformlaboratorylatermaterialpresenceprocessproductionpurposeresultseparateseparationsitessystem
SHARED TOKENS (20): "affect", "analysis", "associated", "chemical", "components", "different", "establishing", "form", "laboratory", "later", "material", "presence", "process", "production", "purpose", "result", "separate", "separation", "sites", "system". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
bachelordegreedemonstratesdependseducationenvironmentenvironmentalexperiencefacilitiesfieldfocusedgovernmenthealthknowledgemakingphysicsprincipallyprofessionalprotectionregulations
SHARED TOKENS (26): "bachelor", "degree", "demonstrates", "depends", "education", "environment", "environmental", "experience", "facilities", "field", "focused", "government", "health", "knowledge", "making", "physics", "principally", "professional", "protection", "regulations".... | EXACT TITLE in nuclear_clean_energy: "Health physics".
0.500
academicbiomedicaldepartmentfundinggovernedhealthinstitutionalinstitutionsinvolvingoversightpublicresearchresearchersreviewrightsrulesignificanttitle
SHARED TOKENS (18): "academic", "biomedical", "department", "funding", "governed", "health", "institutional", "institutions", "involving", "oversight", "public", "research", "researchers", "review", "rights", "rule", "significant", "title". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongapplicationsbiomedicalcurrentdesigndevelopmentdevicesdiagnosticengineeringequipmentfieldfieldsgrowthhealthhealthcarehospitalsmaintenancemakingmanagementmonitoring
SHARED TOKENS (30): "among", "applications", "biomedical", "current", "design", "development", "devices", "diagnostic", "engineering", "equipment", "field", "fields", "growth", "health", "healthcare", "hospitals", "maintenance", "making", "management", "monitoring".... | EXACT TITLE in nuclear_clean_energy: "Biomedical engineering". | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
capableconsentcurrentdepartmentdevelopmentenergyenvironmentalgovernmentnationalneedsofficepromotesregulatoryresearchresourcetechnical
SHARED TOKENS (16): "capable", "consent", "current", "department", "development", "energy", "environmental", "government", "national", "needs", "office", "promotes", "regulatory", "research", "resource", "technical". | EXACT TITLE in nuclear_clean_energy: "Office of Nuclear Energy".
0.500
changecombustiondeliverydemanddirectlydistributionelectricelectricalenergyfieldsgeneratingglobalgrowthmeansmethodsplantplantsprimarilyprocessproduction
SHARED TOKENS (30): "change", "combustion", "delivery", "demand", "directly", "distribution", "electric", "electrical", "energy", "fields", "generating", "global", "growth", "means", "methods", "plant", "plants", "primarily", "process", "production".... | EXACT TITLE in nuclear_clean_energy: "Electricity generation".
0.500
activitiesagriculturalairamongbenefitschangecontinuesdevelopmentelectricenvironmentalformationhealthhistoryincreaseinitialinvolvinglegalmaterialsmethodsnational
SHARED TOKENS (32): "activities", "agricultural", "air", "among", "benefits", "change", "continues", "development", "electric", "environmental", "formation", "health", "history", "increase", "initial", "involving", "legal", "materials", "methods", "national".... | EXACT TITLE in nuclear_clean_energy: "Cloud seeding".
0.500
changescriticaldevelopmentengineeringfieldloadsmajormechanicalmechanismsmovementphysicalphysicsregulationrolesciencestructurework
SHARED TOKENS (17): "changes", "critical", "development", "engineering", "field", "loads", "major", "mechanical", "mechanisms", "movement", "physical", "physics", "regulation", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
affectingamongcapacitycleancomplexconstructiondemanddirectelectricalenergyenvironmentalglobalincreasedlandlargelessmakingplantspopulationprincipally
SHARED TOKENS (35): "affecting", "among", "capacity", "clean", "complex", "construction", "demand", "direct", "electrical", "energy", "environmental", "global", "increased", "land", "large", "less", "making", "plants", "population", "principally".... | EXACT TITLE in nuclear_clean_energy: "Hydroelectricity".
0.500
actdisposalenergyestablishedfacilitiesfunctionsgovernmenthealthlicensingmaterialsoperationsoversightpublicradioactiveregulationregulatoryrelatedsafetystorage
SHARED TOKENS (19): "act", "disposal", "energy", "established", "facilities", "functions", "government", "health", "licensing", "materials", "operations", "oversight", "public", "radioactive", "regulation", "regulatory", "related", "safety", "storage". | EXACT TITLE in nuclear_clean_energy: "Nuclear Regulatory Commission".
0.500
addamongbuiltcapacitycentercenterscommercialconstructionconventionalcustomersdatademanddesignelectricalemergencyexternalintendedlargelessmodels
SHARED TOKENS (38): "add", "among", "built", "capacity", "center", "centers", "commercial", "construction", "conventional", "customers", "data", "demand", "design", "electrical", "emergency", "external", "intended", "large", "less", "models".... | EXACT TITLE in nuclear_clean_energy: "Small modular reactor".
0.500
actassociatedbiomedicalcomplexcontrolsdesigndevicesdiscoveryengineeringestablishestablishedfederalfieldfoodgeneralglobalincreaseintendedlatermajor
SHARED TOKENS (36): "act", "associated", "biomedical", "complex", "controls", "design", "devices", "discovery", "engineering", "establish", "established", "federal", "field", "food", "general", "global", "increase", "intended", "later", "major".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
annualchemicalcurrentcurrentlydedicatedenergyglobalgrowthindustriallargelessmarketmethodsprocessproductproductionstoragesupplyunderstooduses
SHARED TOKENS (21): "annual", "chemical", "current", "currently", "dedicated", "energy", "global", "growth", "industrial", "large", "less", "market", "methods", "process", "product", "production", "storage", "supply", "understood", "uses".... | EXACT TITLE in nuclear_clean_energy: "Hydrogen production".
0.500
Cold War ↗ Q8683 EXACT TITLE
anotherchangecoldcontactsconventionaldirectdivisionearlyeasterneconomicexpandedfundinginfluenceinternationalmajorplanrecoveryregionalspacesupport
SHARED TOKENS (22): "another", "change", "cold", "contacts", "conventional", "direct", "division", "early", "eastern", "economic", "expanded", "funding", "influence", "international", "major", "plan", "recovery", "regional", "space", "support".... | EXACT TITLE in nuclear_clean_energy: "Cold War".
0.500
Pathology ↗ Q7208 EXACT TITLE
analysischangescomponentsconditionsconsequencesdevelopmentdifferentdistinctfieldfieldsgeneralmajormechanismsmodernphysicalpracticepracticesprocessesresearchsignificant
SHARED TOKENS (24): "analysis", "changes", "components", "conditions", "consequences", "development", "different", "distinct", "field", "fields", "general", "major", "mechanisms", "modern", "physical", "practice", "practices", "processes", "research", "significant".... | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclassificationcommunitiesconditionsdifferentformationglobalphysicalplantprovideremoteresourcescientistsstudywater
SHARED TOKENS (17): "agriculture", "annual", "change", "classification", "communities", "conditions", "different", "formation", "global", "physical", "plant", "provide", "remote", "resource", "scientists", "study", "water". | EXACT TITLE in nuclear_clean_energy: "Snowpack".
0.500
accurateadvancedanalysisbiomedicalcapabilitieschangeschemicalcomponentsdevelopmentdiagnosticdifferentdivisionengineeringevaluationfieldformhealthhealthcareidentifyinstruments
SHARED TOKENS (42): "accurate", "advanced", "analysis", "biomedical", "capabilities", "changes", "chemical", "components", "development", "diagnostic", "different", "division", "engineering", "evaluation", "field", "form", "health", "healthcare", "identify", "instruments".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
academicactivitiesanalysisapplicationscommercialdatadegreedevelopmentdevicesdifferentengineersfieldgovernmentgraduateincreaseinstituteinstrumentationinstrumentslaboratorieslaboratory
SHARED TOKENS (40): "academic", "activities", "analysis", "applications", "commercial", "data", "degree", "development", "devices", "different", "engineers", "field", "government", "graduate", "increase", "institute", "instrumentation", "instruments", "laboratories", "laboratory".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddevicesdirectlydischargedistributeddistributioneffectsenvironmentalfieldfieldsform
SHARED TOKENS (50): "agricultural", "agriculture", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "devices", "directly", "discharge", "distributed", "distribution", "effects", "environmental", "field", "fields", "form".... | EXACT TITLE in nuclear_clean_energy: "Irrigation". | EXACT TITLE in biotech_life_sciences: "Irrigation".
0.500
chemicalconventionalcurrentlydemandelectricalenergyfoodformlargelatermethodsmultipleoperateprocessproductionprovidereducescalestoragetechnologies
SHARED TOKENS (20): "chemical", "conventional", "currently", "demand", "electrical", "energy", "food", "form", "large", "later", "methods", "multiple", "operate", "process", "production", "provide", "reduce", "scale", "storage", "technologies". | EXACT TITLE in nuclear_clean_energy: "Energy storage".
0.500
applicationsbuiltcapacitychangecommercialconcentratedcurrentcurrentlydevelopeddirectlyelectricenergyfinancingglobalinternationallargeplantspolicyproducesproduction
SHARED TOKENS (28): "applications", "built", "capacity", "change", "commercial", "concentrated", "current", "currently", "developed", "directly", "electric", "energy", "financing", "global", "international", "large", "plants", "policy", "produces", "production".... | EXACT TITLE in nuclear_clean_energy: "Solar power".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureassociatedbecomechemicalcontrolcropdependsdevelopeddistincteffectsenergyengineeringenvironmentexplainingfieldsfunctionfunctionshealthindustrialmaintain
SHARED TOKENS (36): "agriculture", "associated", "become", "chemical", "control", "crop", "depends", "developed", "distinct", "effects", "energy", "engineering", "environment", "explaining", "fields", "function", "functions", "health", "industrial", "maintain".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
academicadaboardboisecampuscanyoncollegecommunitydevelopmenteasterneducationgovernedidaholargenampapopulationprogramspublicreportedresidents
SHARED TOKENS (28): "academic", "ada", "board", "boise", "campus", "canyon", "college", "community", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents".... | EXACT TITLE in nuclear_clean_energy: "College of Western Idaho". | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
0.500
actassociatedauthorityconsentcontrolcurrentdepartmentdevicesdirectlyfederalfieldfoodhealthlaboratorieslaboratorypublicregulatedregulationsrelatedreports
SHARED TOKENS (25): "act", "associated", "authority", "consent", "control", "current", "department", "devices", "directly", "federal", "field", "food", "health", "laboratories", "laboratory", "public", "regulated", "regulations", "related", "reports".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
Data center ↗ Q671224 EXACT TITLE
academicactaloneassociatedbuildingcentercenterscleancomponentsconditionsconnectioncontainscontrolcovereddatademanddevicesdifferentearlyedge
SHARED TOKENS (69): "academic", "act", "alone", "associated", "building", "center", "centers", "clean", "components", "conditions", "connection", "contains", "control", "covered", "data", "demand", "devices", "different", "early", "edge".... | EXACT TITLE in nuclear_clean_energy: "Data center".
0.500
alternativeassociatedbenefitscapacitycapitaldetailsdirectlydocumentearlyestablishingexistingformgrowthinformationinitialinstitutionallegallistedmarketmethods
SHARED TOKENS (32): "alternative", "associated", "benefits", "capacity", "capital", "details", "directly", "document", "early", "establishing", "existing", "form", "growth", "information", "initial", "institutional", "legal", "listed", "market", "methods".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
activityadvancedapplicationsapproximatelyconditionscoredesigndifferentenvironmentidahoindustrialisolatedlaboratorymaterialsmultiplenationaloperateoperatesphysicalplants
SHARED TOKENS (30): "activity", "advanced", "applications", "approximately", "conditions", "core", "design", "different", "environment", "idaho", "industrial", "isolated", "laboratory", "materials", "multiple", "national", "operate", "operates", "physical", "plants".... | EXACT TITLE in nuclear_clean_energy: "Advanced Test Reactor".
0.500
associationauthoritycodecomplianceelectricelectricalengineersequipmentevenfederalfiregoverninginstitutejurisdictionlawlineslocalnationalpracticesprivate
SHARED TOKENS (26): "association", "authority", "code", "compliance", "electric", "electrical", "engineers", "equipment", "even", "federal", "fire", "governing", "institute", "jurisdiction", "law", "lines", "local", "national", "practices", "private".... | EXACT TITLE in nuclear_clean_energy: "National Electrical Code".
0.500
academiccareerscentercentralcertificationcriticaldoctoraleducationemployersfacultyinstitutionsknowledgemissionprivateproductionpublicratherresearchscientificsites
SHARED TOKENS (26): "academic", "careers", "center", "central", "certification", "critical", "doctoral", "education", "employers", "faculty", "institutions", "knowledge", "mission", "private", "production", "public", "rather", "research", "scientific", "sites".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.480
Microscopy ↗ Q1074953 EXACT TITLE
anothercreatedevelopmentfieldinsidephysicalprocessremainssmallstudiestechnicaltransmissionusesview
SHARED TOKENS (14): "another", "create", "development", "field", "inside", "physical", "process", "remains", "small", "studies", "technical", "transmission", "uses", "view". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.480
conservationeconomyelectricalenergylessmechanicalnetphysicsprocessproducespurposesourcetransportationwork
SHARED TOKENS (14): "conservation", "economy", "electrical", "energy", "less", "mechanical", "net", "physics", "process", "produces", "purpose", "source", "transportation", "work". | EXACT TITLE in nuclear_clean_energy: "Energy efficiency".
0.460
behaviordescribeddifferentexpandedfunctionsmodelingphysicssciencescientificscopestudiesstudysystem
SHARED TOKENS (13): "behavior", "described", "different", "expanded", "functions", "modeling", "physics", "science", "scientific", "scope", "studies", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.460
boiseconsumerdatademandidahomajormarketmarketedownedsemiconductorstoragetechnologiestechnology
SHARED TOKENS (13): "boise", "consumer", "data", "demand", "idaho", "major", "market", "marketed", "owned", "semiconductor", "storage", "technologies", "technology". | EXACT TITLE in nuclear_clean_energy: "Micron Technology".
0.460
commercialcompleteconventionalcreatecurrentlydevelopedeconomygeneratingmaterialmaterialsmethodsoperatingturn
SHARED TOKENS (13): "commercial", "complete", "conventional", "create", "currently", "developed", "economy", "generating", "material", "materials", "methods", "operating", "turn". | EXACT TITLE in nuclear_clean_energy: "Breeder reactor".
0.460
alternativebuiltenergyfacilitiesinternationaloperatesplantsproductionsharesuppliedsuppliestechnologiestechnology
SHARED TOKENS (13): "alternative", "built", "energy", "facilities", "international", "operates", "plants", "production", "share", "supplied", "supplies", "technologies", "technology". | EXACT TITLE in nuclear_clean_energy: "Ormat Technologies".
0.450
govgovernmenthealthlibrarynational
SHARED TOKENS (5): "gov", "government", "health", "library", "national". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
cannotcommunitydemandfieldformhospitalhospitalsmanufacturingneedspreparationprovideregulations
SHARED TOKENS (12): "cannot", "community", "demand", "field", "form", "hospital", "hospitals", "manufacturing", "needs", "preparation", "provide", "regulations". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.440
Cell biology ↗ Q7141 EXACT TITLE
behaviorbiomedicalcomponentsfieldsfunctiongivesresearchresponsiblestructurestudiesstudywork
SHARED TOKENS (12): "behavior", "biomedical", "components", "fields", "function", "gives", "research", "responsible", "structure", "studies", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.440
agriculturalbasindivisionidahomajornationalnearprimarilyriversectionturnvalley
SHARED TOKENS (12): "agricultural", "basin", "division", "idaho", "major", "national", "near", "primarily", "river", "section", "turn", "valley". | EXACT TITLE in nuclear_clean_energy: "Payette River".
0.440
competitionconnectionequipmentfacilitieslawmarketsnetworknetworksphysicalregulatorsregulatoryrequirements
SHARED TOKENS (12): "competition", "connection", "equipment", "facilities", "law", "markets", "network", "networks", "physical", "regulators", "regulatory", "requirements". | EXACT TITLE in nuclear_clean_energy: "Interconnection".
0.440
agriculturalcropdevelopeddifferentengineeringgrowthinvolvingplantspossesssciencescientificsize
SHARED TOKENS (12): "agricultural", "crop", "developed", "different", "engineering", "growth", "involving", "plants", "possess", "science", "scientific", "size". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.440
addanotherchemicalenergyengineeringgenerategeneratingmeanspercentprocessessciencesystems
SHARED TOKENS (12): "add", "another", "chemical", "energy", "engineering", "generate", "generating", "means", "percent", "processes", "science", "systems". | EXACT TITLE in nuclear_clean_energy: "Nuclear engineering".
0.420
benefitsdepartmentdevelopmenteconomicidahoinsurancelaborprocessesresponsibletechnologyworkforce
SHARED TOKENS (11): "benefits", "department", "development", "economic", "idaho", "insurance", "labor", "processes", "responsible", "technology", "workforce". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Labor". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.420
businessdistributioneasternelectricalidahooperatesplantsregulatedriversoldtransmission
SHARED TOKENS (11): "business", "distribution", "eastern", "electrical", "idaho", "operates", "plants", "regulated", "river", "sold", "transmission". | EXACT TITLE in nuclear_clean_energy: "Idaho Power".
0.420
criticaldescribesdistincteconomygovernmentinfrastructurenationalprivateprotectionscopesector
SHARED TOKENS (11): "critical", "describes", "distinct", "economy", "government", "infrastructure", "national", "private", "protection", "scope", "sector". | EXACT TITLE in nuclear_clean_energy: "Critical infrastructure".
0.400
Hazardous waste ↗ EXACT TITLE
environmenthazardoushealthinternationallocalmaterialsnationalproducesregulatedwaste
SHARED TOKENS (10): "environment", "hazardous", "health", "international", "local", "materials", "national", "produces", "regulated", "waste". | EXACT TITLE in nuclear_clean_energy: "Hazardous waste". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.400
airchemicalcontainsdevicesenergygeneratematerialproducessinglestation
SHARED TOKENS (10): "air", "chemical", "contains", "devices", "energy", "generate", "material", "produces", "single", "station". | EXACT TITLE in nuclear_clean_energy: "Nuclear fuel".
0.400
differentirrigationlawlegalphysicalriversourcesystemsuserswater
SHARED TOKENS (10): "different", "irrigation", "law", "legal", "physical", "river", "source", "systems", "users", "water". | EXACT TITLE in nuclear_clean_energy: "Water right". | EXACT TITLE in biotech_life_sciences: "Water right".
0.400
consentdifferentfacilityinformationlaboratorymaterialmaterialsplantsresearchstudies
SHARED TOKENS (10): "consent", "different", "facility", "information", "laboratory", "material", "materials", "plants", "research", "studies". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.360
associationcentersfirmsindustrialorganizationrelatedresearchserves
SHARED TOKENS (8): "association", "centers", "firms", "industrial", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.360
actchaptercodefederalhealthlawpublictitle
SHARED TOKENS (8): "act", "chapter", "code", "federal", "health", "law", "public", "title". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.360
Phlebotomy ↗ Q3595842 EXACT TITLE
involvingmakingperformsprocedureprocesspurposetechnicianstreatment
SHARED TOKENS (8): "involving", "making", "performs", "procedure", "process", "purpose", "technicians", "treatment". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.360
customersidahoownedprovidepublicregulatesutilitieswater
SHARED TOKENS (8): "customers", "idaho", "owned", "provide", "public", "regulates", "utilities", "water". | EXACT TITLE in nuclear_clean_energy: "Idaho Public Utilities Commission".
0.360
evenfunctionmechanicalmethodsoperatesstructurestudysystems
SHARED TOKENS (8): "even", "function", "mechanical", "methods", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.360
affectconditionseconomicenvironmentalmanagementplantscientificstudy
SHARED TOKENS (8): "affect", "conditions", "economic", "environmental", "management", "plant", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.350
federalgovernmenthealthinstitutelibrarynationalrelatedreportstechnicalworks
SHARED TOKENS (10): "federal", "government", "health", "institute", "library", "national", "related", "reports", "technical", "works". | URL->B (1): http://clinicaltrials.gov/.
0.340
Reservoir ↗ Q131681 EXACT TITLE
buildingbuiltexistingformspacestoragewater
SHARED TOKENS (7): "building", "built", "existing", "form", "space", "storage", "water". | EXACT TITLE in nuclear_clean_energy: "Reservoir". | EXACT TITLE in biotech_life_sciences: "Reservoir".
0.340
analysisdatafieldmodelingrelationshipssciencesystems
SHARED TOKENS (7): "analysis", "data", "field", "modeling", "relationships", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.340
buildingidaholabornationalplantsresearchsufficient
SHARED TOKENS (7): "building", "idaho", "labor", "national", "plants", "research", "sufficient". | EXACT TITLE in nuclear_clean_energy: "Experimental Breeder Reactor I".
0.320
Forage ↗ Q13377214 EXACT TITLE
annualcropdirectlymaterialplantplants
SHARED TOKENS (6): "annual", "crop", "directly", "material", "plant", "plants". | EXACT TITLE in biotech_life_sciences: "Forage".
0.320
federallaboratoryregulatoryresearchstandardstesting
SHARED TOKENS (6): "federal", "laboratory", "regulatory", "research", "standards", "testing". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.320
Histology ↗ Q7168 EXACT TITLE
fieldmodernplacesplantsstudiesstudy
SHARED TOKENS (6): "field", "modern", "places", "plants", "studies", "study". | EXACT TITLE in biotech_life_sciences: "Histology".
0.320
formindustrialprocessprocessesprocessingprovide
SHARED TOKENS (6): "form", "industrial", "process", "processes", "processing", "provide". | EXACT TITLE in nuclear_clean_energy: "Process heat".
0.300
Nuclear fusion ↗ Q13082 KW CROSS HIGH
advancedamongapplicationsconditionsenergyformlargepathwaysprocessprocessesproducesproductproductionrequireresult
SHARED TOKENS (15): "advanced", "among", "applications", "conditions", "energy", "form", "large", "pathways", "process", "processes", "produces", "product", "production", "require", "result".
0.300
actamongapproximatelycombiningconservationdepartmentdescribeddiversityenergyestateexistingfederalgeneralgovernmentheadquarteredhealthidaholandmanagementmission
SHARED TOKENS (29): "act", "among", "approximately", "combining", "conservation", "department", "described", "diversity", "energy", "estate", "existing", "federal", "general", "government", "headquartered", "health", "idaho", "land", "management", "mission"....
0.300
accessassociatedcannotconditionsconsequencesdetectiondifferentenergyenvironmentexternalfacilitiesinternationalinvolvingmaterialmaterialsoperatingplantsproposedprotectionpublic
SHARED TOKENS (31): "access", "associated", "cannot", "conditions", "consequences", "detection", "different", "energy", "environment", "external", "facilities", "international", "involving", "material", "materials", "operating", "plants", "proposed", "protection", "public"....
0.300
amongapproximatelybehaviorconcerningcontainscontinuescontroldisposalevaluationfeasibilityformationhealthidentifiedinstitutionslessmaintenancemanagementmaterialsmeansmodels
SHARED TOKENS (43): "among", "approximately", "behavior", "concerning", "contains", "continues", "control", "disposal", "evaluation", "feasibility", "formation", "health", "identified", "institutions", "less", "maintenance", "management", "materials", "means", "models"....
0.300
capableelectricenergyentityfacilitiesgenerategeneratingindependentindustrialoperatesprocesspublicsystemusersutilitieswater
SHARED TOKENS (16): "capable", "electric", "energy", "entity", "facilities", "generate", "generating", "independent", "industrial", "operates", "process", "public", "system", "users", "utilities", "water".
0.300
buildingcomplexcontroldesigndesignateddevelopeddevelopmentdocumentsenergyengineersfacilitiesformationgeneralintelligencelaboratorieslaboratorylinesmajormaterialmaterials
SHARED TOKENS (42): "building", "complex", "control", "design", "designated", "developed", "development", "documents", "energy", "engineers", "facilities", "formation", "general", "intelligence", "laboratories", "laboratory", "lines", "major", "material", "materials"....
0.300
additionallyanalysisarchitecturebeyondcommercialcomponentsdatadevelopmentdifferentenvironmentalequipmentevenexecutionfacilitiesfunctionsimplementationinformationinfrastructurelaboratorymanagement
SHARED TOKENS (43): "additionally", "analysis", "architecture", "beyond", "commercial", "components", "data", "development", "different", "environmental", "equipment", "even", "execution", "facilities", "functions", "implementation", "information", "infrastructure", "laboratory", "management"....
0.300
agriculturalagricultureairbeginningcommerciallyconsequencescontroldairydevelopeddirectdisposalearlyenvironmentalexpansionfarmsgeneralgrowthhealthhistoryincrease
SHARED TOKENS (33): "agricultural", "agriculture", "air", "beginning", "commercially", "consequences", "control", "dairy", "developed", "direct", "disposal", "early", "environmental", "expansion", "farms", "general", "growth", "health", "history", "increase"....
0.300
businesscapitalcenterscorporatedevelopmentemploymentgovernmentinstitutionslocalnetworksplacesprivatepublicrelatedresearchresultrevenuesupportingtechnologyuniversities
SHARED TOKENS (21): "business", "capital", "centers", "corporate", "development", "employment", "government", "institutions", "local", "networks", "places", "private", "public", "related", "research", "result", "revenue", "supporting", "technology", "universities"....
0.300
activitiesalternativeanotherappliesauthoritybenefitsboardcapacityconditionsconsentdecisionsevidenceformhealthcareinformationinstitutionalintendedinternationallawlegal
SHARED TOKENS (44): "activities", "alternative", "another", "applies", "authority", "benefits", "board", "capacity", "conditions", "consent", "decisions", "evidence", "form", "healthcare", "information", "institutional", "intended", "international", "law", "legal"....
0.300
actapprovalapprovedbenefitsboardcommercialcompleteconsentcontroldatadesigndevicesdistributionestablishmentevaluationfoodinformationinstitutionalintendedknowledge
SHARED TOKENS (47): "act", "approval", "approved", "benefits", "board", "commercial", "complete", "consent", "control", "data", "design", "devices", "distribution", "establishment", "evaluation", "food", "information", "institutional", "intended", "knowledge"....
0.300
changechangescustomersdemanddistributionearlyelectricelectricalenergyimproveindustrieslargemanagementmarketmarketsmechanismsoperateprimarilypublicpurchasing
SHARED TOKENS (28): "change", "changes", "customers", "demand", "distribution", "early", "electric", "electrical", "energy", "improve", "industries", "large", "management", "market", "markets", "mechanisms", "operate", "primarily", "public", "purchasing"....
0.300
additionallyaffectingavailabilitycapacityconditionsconstraintsdesigndifferentelectricalenergylocalmaintenancemarketnetoperationoperationalplantproductionregulatoryrelevant
SHARED TOKENS (22): "additionally", "affecting", "availability", "capacity", "conditions", "constraints", "design", "different", "electrical", "energy", "local", "maintenance", "market", "net", "operation", "operational", "plant", "production", "regulatory", "relevant"....
0.300
additionalagriculturalapplicationsbuiltcapacityconditionsdepartmentelectricenergyexpandformationgeneratingindustriallessnearneedsplantplantsprocessesradioactive
SHARED TOKENS (26): "additional", "agricultural", "applications", "built", "capacity", "conditions", "department", "electric", "energy", "expand", "formation", "generating", "industrial", "less", "near", "needs", "plant", "plants", "processes", "radioactive"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysisdistinctexpandedfieldfoodformationfunctionslargerequirementsscalescopesinglestructurestudysystem
SHARED TOKENS (16): "activity", "analysis", "distinct", "expanded", "field", "food", "formation", "functions", "large", "requirements", "scale", "scope", "single", "structure", "study", "system".
0.300
coredepartmentearlyenergyfacilityfallsfleetgovernmentidaholaboratorynationalnorthwestoperateoperatespersonnelplantsprocessingreceivingstoragesupported
SHARED TOKENS (22): "core", "department", "early", "energy", "facility", "falls", "fleet", "government", "idaho", "laboratory", "national", "northwest", "operate", "operates", "personnel", "plants", "processing", "receiving", "storage", "supported"....
0.300
Nuclear reactor ↗ Q80877 KW CROSS HIGH
beginningbuiltcommercialcontrolledcorecriticaldesigndevelopeddiscoveryearlyeffectselectricalenergyglobalindustriallaboratorymajormodularmovementmultiple
SHARED TOKENS (38): "beginning", "built", "commercial", "controlled", "core", "critical", "design", "developed", "discovery", "early", "effects", "electrical", "energy", "global", "industrial", "laboratory", "major", "modular", "movement", "multiple"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
capacitychangeconnectedcurrentlyelectricalenergyenvironmentexpandfarmsgenerategloballessneedsplantsreliablesharesourcestoragesuppliedsupply
SHARED TOKENS (21): "capacity", "change", "connected", "currently", "electrical", "energy", "environment", "expand", "farms", "generate", "global", "less", "needs", "plants", "reliable", "share", "source", "storage", "supplied", "supply"....
0.300
applicationscapacityconservationdemandelectricenergyevaluatesformgeneratinggrowthinfluencelawmeansplanningplantsprocessproductionpublicpurchasingrequires
SHARED TOKENS (23): "applications", "capacity", "conservation", "demand", "electric", "energy", "evaluates", "form", "generating", "growth", "influence", "law", "means", "planning", "plants", "process", "production", "public", "purchasing", "requires"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
annualconnectionconsumerscurrentelectricenergyevengeneratelatermechanismnetpolicyprivateprocedurerequirerequiressinglesmallsolelystorage
SHARED TOKENS (21): "annual", "connection", "consumers", "current", "electric", "energy", "even", "generate", "later", "mechanism", "net", "policy", "private", "procedure", "require", "requires", "single", "small", "solely", "storage"....
0.300
authoritybasecapablecapitalcleancommonlycouncildemandenergylessperiodsplacesplantplantsrapidlyseekingstoragesuppliedsupplywaste
SHARED TOKENS (20): "authority", "base", "capable", "capital", "clean", "commonly", "council", "demand", "energy", "less", "periods", "places", "plant", "plants", "rapidly", "seeking", "storage", "supplied", "supply", "waste".
0.300
additionallyadvancedairapplicationscentralcleancomponentscontrolcreatedevicesenvironmentequipmentfacilitiesimproveindustrialinsidelargemaintainmanufacturingmaterial
SHARED TOKENS (37): "additionally", "advanced", "air", "applications", "central", "clean", "components", "control", "create", "devices", "environment", "equipment", "facilities", "improve", "industrial", "inside", "large", "maintain", "manufacturing", "material"....
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsideapplicationscapabilitieschemicalclassifieddesigndeterminediscoverydistributioneffectsfieldfunctionfunctionshealthmechanismspracticeprocessesresearchrolescience
SHARED TOKENS (22): "alongside", "applications", "capabilities", "chemical", "classified", "design", "determine", "discovery", "distribution", "effects", "field", "function", "functions", "health", "mechanisms", "practice", "processes", "research", "role", "science"....
0.300
activitiesaffectairatmosphericcategoriesdesignatedenvironmentalestablishedhealthlessmultipleprimarilyqualityresultriskstandards
SHARED TOKENS (16): "activities", "affect", "air", "atmospheric", "categories", "designated", "environmental", "established", "health", "less", "multiple", "primarily", "quality", "result", "risk", "standards".
0.300
associationauthoritybasinbecomecapacitychangesconstructionenergyenvironmentalevenfacilitiesinternationallargeleastpolicyportfolioprojectsrequiresresourceriver
SHARED TOKENS (26): "association", "authority", "basin", "become", "capacity", "changes", "construction", "energy", "environmental", "even", "facilities", "international", "large", "least", "policy", "portfolio", "projects", "requires", "resource", "river"....
0.300
approximatelyassociationcommercialconnectedcoordinatesdesigndevelopeddevelopmentenergyenterfacilitiesfundingintendedinternationalleastlessmakingmodelsoperateoperation
SHARED TOKENS (33): "approximately", "association", "commercial", "connected", "coordinates", "design", "developed", "development", "energy", "enter", "facilities", "funding", "intended", "international", "least", "less", "making", "models", "operate", "operation"....
0.300
classificationdiagnosticexplainsfieldhealthcarehistoryidentifyinformationmajorphysicalprocedureproceduresprocessprofessionalrecognitionrequiredseekingstudyview
SHARED TOKENS (19): "classification", "diagnostic", "explains", "field", "healthcare", "history", "identify", "information", "major", "physical", "procedure", "procedures", "process", "professional", "recognition", "required", "seeking", "study", "view".
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
advancedcapablecapacitycodeconnectcontrolcreatecurrentdeliverydemanddeploymentdescribeddevicesdistributeddistributionelectricelectricalenergyevenfinancing
SHARED TOKENS (58): "advanced", "capable", "capacity", "code", "connect", "control", "create", "current", "delivery", "demand", "deployment", "described", "devices", "distributed", "distribution", "electric", "electrical", "energy", "even", "financing"....
0.300
alreadyanotherapplicationsassociatedbecomechangechemicalconcerningconditionscreatecurrentdevelopmentfieldsmajormethodsopportunitiesphysicalprocessesrelatedrelevant
SHARED TOKENS (29): "already", "another", "applications", "associated", "become", "change", "chemical", "concerning", "conditions", "create", "current", "development", "fields", "major", "methods", "opportunities", "physical", "processes", "related", "relevant"....
0.300
actbecomebuiltcurrentlydeliverydepartmentdevelopmentestablishedfederalfundinggovernmentinitialirrigationlawmanagementoperationoversightprogramprojectsprovisions
SHARED TOKENS (27): "act", "become", "built", "currently", "delivery", "department", "development", "established", "federal", "funding", "government", "initial", "irrigation", "law", "management", "operation", "oversight", "program", "projects", "provisions"....
0.300
affectapplicationsconditionscontrolcoveringdifferentfoodhealthmaintainmanagementmonitoringprofessionalresearchrolessafetysciencescientistsscopespecializedsupply
SHARED TOKENS (24): "affect", "applications", "conditions", "control", "covering", "different", "food", "health", "maintain", "management", "monitoring", "professional", "research", "roles", "safety", "science", "scientists", "scope", "specialized", "supply"....
0.300
availabilityconsumerconsumersdeliveredgeneralinformationmultipleneedsonlineoperatorprocessproductproductionproviderssegmentsinglesiteusers
SHARED TOKENS (18): "availability", "consumer", "consumers", "delivered", "general", "information", "multiple", "needs", "online", "operator", "process", "product", "production", "providers", "segment", "single", "site", "users".
0.300
analysisbuildingbuildingscapacitycommercialcomponentsdevicesdistributedelectricalenergyenvironmentequipmentformindustriallargemanagementmonitoringnetresidentialscale
SHARED TOKENS (26): "analysis", "building", "buildings", "capacity", "commercial", "components", "devices", "distributed", "electrical", "energy", "environment", "equipment", "form", "industrial", "large", "management", "monitoring", "net", "residential", "scale"....
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalapplicationsavailabilitycapacitychangecommerciallycompetitionconstraintscoveringcurrentdemanddirectdistributionelectricalenergyfinancinggenerateglobalgovernmentgrowth
SHARED TOKENS (52): "additional", "applications", "availability", "capacity", "change", "commercially", "competition", "constraints", "covering", "current", "demand", "direct", "distribution", "electrical", "energy", "financing", "generate", "global", "government", "growth"....
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagriculturalapplicationscenterscomplexconditionscreatecropcurrentlydeterminedevelopmentdifferentdiversityfoodgovernmentgrowingimproveinstitutionsinternationalknowledge
SHARED TOKENS (34): "additional", "agricultural", "applications", "centers", "complex", "conditions", "create", "crop", "currently", "determine", "development", "different", "diversity", "food", "government", "growing", "improve", "institutions", "international", "knowledge"....
0.300
applicationsassociatedbiomedicaldifferentengineeringfieldformationfunctionsimproveinvolvingmaintainmaterialsmechanicalmethodsperformportionspracticepurposerequirescope
SHARED TOKENS (23): "applications", "associated", "biomedical", "different", "engineering", "field", "formation", "functions", "improve", "involving", "maintain", "materials", "mechanical", "methods", "perform", "portions", "practice", "purpose", "require", "scope"....
0.300
approximatelyassociationconductsconstructioncontractorsdataelectricalelectriciansfieldsgovernmentindustriesinsideinternationallabornationalnetworksprogramspublicrelatedrepresents
SHARED TOKENS (25): "approximately", "association", "conducts", "construction", "contractors", "data", "electrical", "electricians", "fields", "government", "industries", "inside", "international", "labor", "national", "networks", "programs", "public", "related", "represents"....
0.300
actactivitiesdepartmentdevelopmentenergyestablishedfacilitiesfederalfunctionslaborlaterlawmajormaterialsoversightproductionregulationregulatoryresearchresponsibility
SHARED TOKENS (25): "act", "activities", "department", "development", "energy", "established", "facilities", "federal", "functions", "labor", "later", "law", "major", "materials", "oversight", "production", "regulation", "regulatory", "research", "responsibility"....
0.300
additionalbuildingconservationcurrentdepartmentdevelopmentdirectlyenergyfebruaryfederalgovernmentinitiativelaboratoriesmaterialnationaloriginatingphysicalpolicypositionproduction
SHARED TOKENS (26): "additional", "building", "conservation", "current", "department", "development", "directly", "energy", "february", "federal", "government", "initiative", "laboratories", "material", "national", "originating", "physical", "policy", "position", "production"....
0.300
accessaccurateactivitiesannouncedassociationcapacitycenterschangesconductscontroldepartmentenvironmentalfebruaryfederalfoodgovernmentheadquarteredhealthimproveinformation
SHARED TOKENS (41): "access", "accurate", "activities", "announced", "association", "capacity", "centers", "changes", "conducts", "control", "department", "environmental", "february", "federal", "food", "government", "headquartered", "health", "improve", "information"....
0.300
Cogeneration ↗ Q221620 KW CROSS HIGH
buildingbuildingscenterscentralchemicalcommonlydistributedearlyelectricalenergygenerategeneratingindustrieslargelessofficeoperationsplantspopulationprocess
SHARED TOKENS (28): "building", "buildings", "centers", "central", "chemical", "commonly", "distributed", "early", "electrical", "energy", "generate", "generating", "industries", "large", "less", "office", "operations", "plants", "population", "process"....
0.300
advantageamongbuildingscoldcommonlydeviceselectricenergylargelessproviderequirementsourcesystemsystemstechnologiestransferwater
SHARED TOKENS (18): "advantage", "among", "buildings", "cold", "commonly", "devices", "electric", "energy", "large", "less", "provide", "requirement", "source", "system", "systems", "technologies", "transfer", "water".
0.300
changescommercialcommonlycontrolledcurrentcurrentlydevelopeddifferentdirectearlyeconomyelectricformindependentlylesslinesmodernnetworknetworksrapid
SHARED TOKENS (28): "changes", "commercial", "commonly", "controlled", "current", "currently", "developed", "different", "direct", "early", "economy", "electric", "form", "independently", "less", "lines", "modern", "network", "networks", "rapid"....
0.300
accessbecomebuiltcomplexconnectedconnectingconsumerscurrentcustomersdeliverydistributionelectricelectricalenergygrowinglargemarketsneednetworkoperate
SHARED TOKENS (28): "access", "become", "built", "complex", "connected", "connecting", "consumers", "current", "customers", "delivery", "distribution", "electric", "electrical", "energy", "growing", "large", "markets", "need", "network", "operate"....
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
commonlyconditionscontrolleddevelopmentenvironmentformgrowthhistoricalisolatedlaboratorylinesmaintainingmethodsneedoriginaloutsideplantplantspopulationpractice
SHARED TOKENS (27): "commonly", "conditions", "controlled", "development", "environment", "form", "growth", "historical", "isolated", "laboratory", "lines", "maintaining", "methods", "need", "original", "outside", "plant", "plants", "population", "practice"....
0.300
academicaccessannualapplicationsapproximatelybusinessescapitalcontinuescovereddevelopeddevelopmentdiscoverydistantdistincteducationeffectsevaluationexpandexpansionfield
SHARED TOKENS (55): "academic", "access", "annual", "applications", "approximately", "businesses", "capital", "continues", "covered", "developed", "development", "discovery", "distant", "distinct", "education", "effects", "evaluation", "expand", "expansion", "field"....
0.300
annualapprovalcenterchangescomplianceentityestablishmentevaluationfacilitiesfoodforminformationinterstatelegallicensemanufacturingproductregulatedreportsrequirements
SHARED TOKENS (25): "annual", "approval", "center", "changes", "compliance", "entity", "establishment", "evaluation", "facilities", "food", "form", "information", "interstate", "legal", "license", "manufacturing", "product", "regulated", "reports", "requirements"....
0.300
actapproximatelycommonlycompensationcovereddescribedelectricenvironmentalestablishesfacilitiesfederalgeneralgovernmentgovernsincreaseindustrieslawpolicyprivateproduction
SHARED TOKENS (25): "act", "approximately", "commonly", "compensation", "covered", "described", "electric", "environmental", "establishes", "facilities", "federal", "general", "government", "governs", "increase", "industries", "law", "policy", "private", "production"....
0.300
categoriescommercializationcommunitiescurrentdevelopedeconomiceconomyfinancefocusedformhealthhealthcareindustriespercentproductpurchasingrequirementssectorsharesystem
SHARED TOKENS (20): "categories", "commercialization", "communities", "current", "developed", "economic", "economy", "finance", "focused", "form", "health", "healthcare", "industries", "percent", "product", "purchasing", "requirements", "sector", "share", "system".
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcompetitionconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityexpandfederal
SHARED TOKENS (44): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "competition", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "expand", "federal"....
0.300
anotherapprovedcompletecontrolcovereddevicesdisposalenvironmentfacilitiesfacilityfinalgrowinghundredsindustrialinitiallicensematerialsoperatingplanplant
SHARED TOKENS (35): "another", "approved", "complete", "control", "covered", "devices", "disposal", "environment", "facilities", "facility", "final", "growing", "hundreds", "industrial", "initial", "license", "materials", "operating", "plan", "plant"....
0.300
assessmentcategoriesdataeffectsemergencyenergyexternalhealthinternationalmeansmeasurementsoccupationalprotectionradioactivesafetysignificantsource
SHARED TOKENS (17): "assessment", "categories", "data", "effects", "emergency", "energy", "external", "health", "international", "means", "measurements", "occupational", "protection", "radioactive", "safety", "significant", "source".
0.300
airbuildingchemicalcleanconstructioncontainscontrolcontrolledcreatecriticaldeliverydevicesdischargeelectricalenvironmentequipmentevenmanufacturingmodeloffice
SHARED TOKENS (33): "air", "building", "chemical", "clean", "construction", "contains", "control", "controlled", "create", "critical", "delivery", "devices", "discharge", "electrical", "environment", "equipment", "even", "manufacturing", "model", "office"....
0.300
capacitycentercentralconditionscurrentlydevelopmentenergyexpandedfarmsfederalgeneratinggovernmentgrowthhomeoverviewpermittingportfolioprocessproductionprojects
SHARED TOKENS (25): "capacity", "center", "central", "conditions", "currently", "development", "energy", "expanded", "farms", "federal", "generating", "government", "growth", "home", "overview", "permitting", "portfolio", "process", "production", "projects"....
0.300
alongsidecategorycommercialexistinghistoricalinitiativelaboratorymaintainmaterialnationalneedsoperationalproposedrequirerequiresresearchrisksourcesystemswaste
SHARED TOKENS (20): "alongside", "category", "commercial", "existing", "historical", "initiative", "laboratory", "maintain", "material", "national", "needs", "operational", "proposed", "require", "requires", "research", "risk", "source", "systems", "waste".
0.300
approvalbecomechemicalcommercialcomplexdevelopeddevelopmentdiscoveryeffectsentityexperiencefieldsfundinggrantshealthidentifiedidentifyidentifyingincreaseisolated
SHARED TOKENS (44): "approval", "become", "chemical", "commercial", "complex", "developed", "development", "discovery", "effects", "entity", "experience", "fields", "funding", "grants", "health", "identified", "identify", "identifying", "increase", "isolated"....
0.300
activitiesassociatedbiomedicalcapablechemicaldescribeddetaileddevicesdisposaldistinctemergencyenvironmentenvironmentalfacilitiesgeneralgeneratehazardoushealthhealthcarehome
SHARED TOKENS (36): "activities", "associated", "biomedical", "capable", "chemical", "described", "detailed", "devices", "disposal", "distinct", "emergency", "environment", "environmental", "facilities", "general", "generate", "hazardous", "health", "healthcare", "home"....
0.300
actactivitiesairamongassociatedbenefitschangecleancomplexcontrolcoordinationcreatedependenvironmentalfacilitiesfederalhazardousindustrialintendedlaw
SHARED TOKENS (39): "act", "activities", "air", "among", "associated", "benefits", "change", "clean", "complex", "control", "coordination", "create", "depend", "environmental", "facilities", "federal", "hazardous", "industrial", "intended", "law"....
0.300
accessbiomedicalcenterscontrolequipmentestablishedfacilitiesfacilityhealthlaboratorieslaboratorymultiplepersonnelproceduresprotectionpublicationreportsrequiredspecifiedsystems
SHARED TOKENS (21): "access", "biomedical", "centers", "control", "equipment", "established", "facilities", "facility", "health", "laboratories", "laboratory", "multiple", "personnel", "procedures", "protection", "publication", "reports", "required", "specified", "systems"....
0.300
distributionelectricenergyfacilitiesinfrastructurelocalmajormarketmarketsnationaloperateownedproviderspublicregulatedregulationtransmissionutilities
SHARED TOKENS (18): "distribution", "electric", "energy", "facilities", "infrastructure", "local", "major", "market", "markets", "national", "operate", "owned", "providers", "public", "regulated", "regulation", "transmission", "utilities".
0.300
connectsconsumerscurrentcustomersdeliverydirectdirectlydistinctdistributioneasternelectricelectricalenergyevenformgeneratingincreaseincreasedlineslocal
SHARED TOKENS (31): "connects", "consumers", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "electric", "electrical", "energy", "even", "form", "generating", "increase", "increased", "lines", "local"....
0.300
accessbasinboisebuiltcanyoncapacitycomplexcontainsenergyfallsfinalgeneratingidahoinformationownedprojectriverwestern
SHARED TOKENS (18): "access", "basin", "boise", "built", "canyon", "capacity", "complex", "contains", "energy", "falls", "final", "generating", "idaho", "information", "owned", "project", "river", "western".
0.300
beyondbusinessbusinessesearlyexternalfundinggrowinggrowthinfluencelargemodelprivateprojectpublicrapidsignificant
SHARED TOKENS (16): "beyond", "business", "businesses", "early", "external", "funding", "growing", "growth", "influence", "large", "model", "private", "project", "public", "rapid", "significant".
0.300
applicationscodedesigndetailedengineeringevenexpandexpandedfieldsfunctiongeneralimproveindustrialknowledgemarketmethodsprocessproductproductionrecognition
SHARED TOKENS (24): "applications", "code", "design", "detailed", "engineering", "even", "expand", "expanded", "fields", "function", "general", "improve", "industrial", "knowledge", "market", "methods", "process", "product", "production", "recognition"....
0.300
activitiesactivityanalysisdesigndocumentationengineeringengineersenvironmentestablishedgeneralgovernmentlegallicenselicensedlocalmaintenanceoverviewperformpracticepractitioners
SHARED TOKENS (39): "activities", "activity", "analysis", "design", "documentation", "engineering", "engineers", "environment", "established", "general", "government", "legal", "license", "licensed", "local", "maintenance", "overview", "perform", "practice", "practitioners"....
0.300
agriculturalagricultureapproximatelycommercialcommunitiescurrentdepartmentdirectlyfebruaryfederalfoodgovernmentnationalneedsproductionprogramprogramspromotesreportsresources
SHARED TOKENS (22): "agricultural", "agriculture", "approximately", "commercial", "communities", "current", "department", "directly", "february", "federal", "food", "government", "national", "needs", "production", "program", "programs", "promotes", "reports", "resources"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactivitiesadditionalapproximatelyassessmentatmosphericbusinesscannotchemicalcleancompensationconservationcontainscontrolsdepartmentdetermineearlyecosystemenvironment
SHARED TOKENS (61): "acquisition", "act", "activities", "additional", "approximately", "assessment", "atmospheric", "business", "cannot", "chemical", "clean", "compensation", "conservation", "contains", "controls", "department", "determine", "early", "ecosystem", "environment"....
0.300
associatedcommercialconnectedcoredesignelectricenergyfleetinsidemaintainoperateoriginalplantstationwater
SHARED TOKENS (15): "associated", "commercial", "connected", "core", "design", "electric", "energy", "fleet", "inside", "maintain", "operate", "original", "plant", "station", "water".
0.300
actauthoritycouncildecisionseffectsenvironmentenvironmentalestablishedevaluatefederalfinalgovernmentlawnationalpolicyproposedqualityrecognizesreportsrequirement
SHARED TOKENS (25): "act", "authority", "council", "decisions", "effects", "environment", "environmental", "established", "evaluate", "federal", "final", "government", "law", "national", "policy", "proposed", "quality", "recognizes", "reports", "requirement"....
0.300
becomecoredifferentdisposallessmajormakesordinaryplantradioactivesafelysourcestorageunlesswastewater
SHARED TOKENS (16): "become", "core", "different", "disposal", "less", "major", "makes", "ordinary", "plant", "radioactive", "safely", "source", "storage", "unless", "waste", "water".
0.300
actchangeschemicalcleanconservationcontrolcoordinationdirectlyengineersenvironmentalfederalformfundinggoverninginvolvinglawmaintainmaintainingmajormodern
SHARED TOKENS (33): "act", "changes", "chemical", "clean", "conservation", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "involving", "law", "maintain", "maintaining", "major", "modern"....
0.300
activityadvantageairannualapplicationsapproximatelycapacitycoldcontainsdirectenergyevenformationglobaloriginalradioactivesource
SHARED TOKENS (17): "activity", "advantage", "air", "annual", "applications", "approximately", "capacity", "cold", "contains", "direct", "energy", "even", "formation", "global", "original", "radioactive", "source".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
approvedauthoritybuildingbuildingscodecodescomplianceconstructioncontrolcouncildepartmentsdesigndeveloperseffectselectricalengineersenvironmentalestatefacilitygeneral
SHARED TOKENS (47): "approved", "authority", "building", "buildings", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "developers", "effects", "electrical", "engineers", "environmental", "estate", "facility", "general"....
0.300
actcenterscertificationcommonlydepartmentfacilitiesfederalfinancinggovhealthhealthcarehomeinsurancelaboratorymaintainingoversightprocessprogramprogramsquality
SHARED TOKENS (24): "act", "centers", "certification", "commonly", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "home", "insurance", "laboratory", "maintaining", "oversight", "process", "program", "programs", "quality"....
0.300
chemicalcomponentsdatadetectionengineeringfocusedfunctionhealthinstrumentsphysicalpopulationpracticeprocessresearchseparatesizeuses
SHARED TOKENS (17): "chemical", "components", "data", "detection", "engineering", "focused", "function", "health", "instruments", "physical", "population", "practice", "process", "research", "separate", "size", "uses".
0.300
analysisapplicationsbecomebiomedicalbuildingchangesconstructiondetaileddetectiondevelopeddifferentexposesisolatedlaboratorymethodsmonitoringoriginalproceduresprocessrapidly
SHARED TOKENS (27): "analysis", "applications", "become", "biomedical", "building", "changes", "construction", "detailed", "detection", "developed", "different", "exposes", "isolated", "laboratory", "methods", "monitoring", "original", "procedures", "process", "rapidly"....
0.300
airapproximatelycoldconstructioncoredesigndevelopeddirectlyelectricelectricalenergyformgeneralinsidelaboratorynationalplantriverseparationsource
SHARED TOKENS (21): "air", "approximately", "cold", "construction", "core", "design", "developed", "directly", "electric", "electrical", "energy", "form", "general", "inside", "laboratory", "national", "plant", "river", "separation", "source"....
0.300
agricultureanotherapplicationsfoodhealthindustriesinformationmajorphysicalplantsqualityscalesciencescientificstudiesstudy
SHARED TOKENS (16): "agriculture", "another", "applications", "food", "health", "industries", "information", "major", "physical", "plants", "quality", "scale", "science", "scientific", "studies", "study".
0.300
airalternativeanotherbeyondcapacitychangeconnecteddemandeconomiceconomicselectricalenergyexperienceformlargelatermakingmanagementneedplants
SHARED TOKENS (29): "air", "alternative", "another", "beyond", "capacity", "change", "connected", "demand", "economic", "economics", "electrical", "energy", "experience", "form", "large", "later", "making", "management", "need", "plants"....
0.300
associationcapacityconsumerconventionaldemandelectricelectricalenergyformgeneratinginternationallessmarketnetperiodsplantplantsprocessreportedrevenue
SHARED TOKENS (27): "association", "capacity", "consumer", "conventional", "demand", "electric", "electrical", "energy", "form", "generating", "international", "less", "market", "net", "periods", "plant", "plants", "process", "reported", "revenue"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancingfirmsgeneralmanagementoperationalownershippartnershipsprivateproductprovidepublic
SHARED TOKENS (25): "business", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financing", "firms", "general", "management", "operational", "ownership", "partnerships", "private", "product", "provide", "public"....
0.300
advancedassociatedbeyondchemicalcommercializationcontrolledenergyfacilitiesfocusedformincreasedmaterialmeanspersonnelprocessprocessesproductprogramradioactiveregulated
SHARED TOKENS (29): "advanced", "associated", "beyond", "chemical", "commercialization", "controlled", "energy", "facilities", "focused", "form", "increased", "material", "means", "personnel", "process", "processes", "product", "program", "radioactive", "regulated"....
0.300
agreementsassetassetsbuildingbuiltbusinessbusinessescommercialcontractdirectlydistributedenergyfarmsfinancingfirmsformgovernmentindependentlymaintainsmarket
SHARED TOKENS (26): "agreements", "asset", "assets", "building", "built", "business", "businesses", "commercial", "contract", "directly", "distributed", "energy", "farms", "financing", "firms", "form", "government", "independently", "maintains", "market"....
0.300
Biophysics ↗ Q7100 EXACT TITLE
appliesmethodsphysicssciencestudy
SHARED TOKENS (5): "applies", "methods", "physics", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.300
departmentenergyfederalgovernmentindependentinterstatelicensingpipelineprojectsregulatesregulatoryservingstoragetransmissiontransport
SHARED TOKENS (15): "department", "energy", "federal", "government", "independent", "interstate", "licensing", "pipeline", "projects", "regulates", "regulatory", "serving", "storage", "transmission", "transport".
0.300
Cold chain ↗ KW CROSS HIGH
activitiesagriculturalassociatedcolddistributeddistributionequipmentfleetfoodmaintainmanagementproductionqualityrequiressafetystoragesupplyuseswaste
SHARED TOKENS (19): "activities", "agricultural", "associated", "cold", "distributed", "distribution", "equipment", "fleet", "food", "maintain", "management", "production", "quality", "requires", "safety", "storage", "supply", "uses", "waste".
0.300
activitiesalreadycannotcategorieschemicalclassifiedcontainscurrentcurrentlydependsdevelopeddisposaleconomicenergyenvironmentgovernmenthazardoushealthhundredsinternational
SHARED TOKENS (39): "activities", "already", "cannot", "categories", "chemical", "classified", "contains", "current", "currently", "depends", "developed", "disposal", "economic", "energy", "environment", "government", "hazardous", "health", "hundreds", "international"....
0.300
activitiesbehaviorcomplexdesigndisposaldocumenteconomicseconomyenergyengineeringenvironmentfieldfunctionglobalgrowingindustrialinvolvingmaterialmodernmultiple
SHARED TOKENS (31): "activities", "behavior", "complex", "design", "disposal", "document", "economics", "economy", "energy", "engineering", "environment", "field", "function", "global", "growing", "industrial", "involving", "material", "modern", "multiple"....
0.300
activitiesamonganalysisanotherbehaviorcentercompletecomplexcomponentsconcerningconstructionconventionalcreatedatadescriptiondetaileddifferenteffectsengineersexternal
SHARED TOKENS (59): "activities", "among", "analysis", "another", "behavior", "center", "complete", "complex", "components", "concerning", "construction", "conventional", "create", "data", "description", "detailed", "different", "effects", "engineers", "external"....
0.300
Technology transfer ↗ KW CROSS HIGH
academicactivityanalysisanothercapacitycommercialconnectingcontrolcoredevelopmentenvironmentestablishesfundinggivesglobalgovernmentindustrialinfluenceinstitutionsknowledge
SHARED TOKENS (41): "academic", "activity", "analysis", "another", "capacity", "commercial", "connecting", "control", "core", "development", "environment", "establishes", "funding", "gives", "global", "government", "industrial", "influence", "institutions", "knowledge"....
0.300
actdatadescribeddevelopmentdisposalenergyfacilitiesfederalgeneratinggovernmentincreasedinformationlawmaterialsprivateprocessesproductionprogramprovisionsregulation
SHARED TOKENS (24): "act", "data", "described", "development", "disposal", "energy", "facilities", "federal", "generating", "government", "increased", "information", "law", "materials", "private", "processes", "production", "program", "provisions", "regulation"....
0.300
commonlyconstraintsconvertscurrentdelivereddirectdirectlyelectricelectricalequipmentmodernproviderequiressizestationsuppliedsuppliessupply
SHARED TOKENS (18): "commonly", "constraints", "converts", "current", "delivered", "direct", "directly", "electric", "electrical", "equipment", "modern", "provide", "requires", "size", "station", "supplied", "supplies", "supply".
0.300
amongdecisionsdevelopmentdiagnosticdifferentengineeringhealthidentifiedinitiativeleastmodelnationalorganizationspracticesproviderelatedresponserisksystemstherefore
SHARED TOKENS (21): "among", "decisions", "development", "diagnostic", "different", "engineering", "health", "identified", "initiative", "least", "model", "national", "organizations", "practices", "provide", "related", "response", "risk", "systems", "therefore"....
0.300
capacityconnectioncontroldemandelectricelectricalenergyevenextendingfacilityformgeneratingglobalgrowinginsidelargelessoperatingplantsrapidly
SHARED TOKENS (32): "capacity", "connection", "control", "demand", "electric", "electrical", "energy", "even", "extending", "facility", "form", "generating", "global", "growing", "inside", "large", "less", "operating", "plants", "rapidly"....
🫐 BERRY32 edges
0.280
aloneapplicationsdemandenergyincreasedmarketmaterialmodeloperatingproductionrolessafetysharevalue
SHARED TOKENS (14): "alone", "applications", "demand", "energy", "increased", "market", "material", "model", "operating", "production", "roles", "safety", "share", "value".
0.280
applicationsconventionalcorecurrentlydevelopmentexistingoperatesoperatingoperationplantprocessproductionproposeduses
SHARED TOKENS (14): "applications", "conventional", "core", "currently", "development", "existing", "operates", "operating", "operation", "plant", "process", "production", "proposed", "uses".
0.280
departmenthealthidahopublic
SHARED TOKENS (4): "department", "health", "idaho", "public". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.280
Biomarker ↗ EXACT TITLE
biomedicalfieldsprocessesscientific
SHARED TOKENS (4): "biomedical", "fields", "processes", "scientific". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.260
Serology ↗ Q502159 EXACT TITLE
responsescientificstudy
SHARED TOKENS (3): "response", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.260
builtcommonlydeliveredequipmentgeneralhospitalsinformationinstitutionsmajorprogramresearchsuppliedtitle
SHARED TOKENS (13): "built", "commonly", "delivered", "equipment", "general", "hospitals", "information", "institutions", "major", "program", "research", "supplied", "title".
0.260
Solar tracker ↗ Q938237 KW CROSS HIGH
applicationscapacitycomponentsconcentrateddirectenergyglobalmarketplacesprimarilyprojectssystemstherefore
SHARED TOKENS (13): "applications", "capacity", "components", "concentrated", "direct", "energy", "global", "market", "places", "primarily", "projects", "systems", "therefore".
0.260
builtcontrolfallsidahoirrigationnearoriginalprimarilyprojectresidentsriverstructurewestern
SHARED TOKENS (13): "built", "control", "falls", "idaho", "irrigation", "near", "original", "primarily", "project", "residents", "river", "structure", "western".
0.260
Alfalfa ↗ Q156106 EXACT TITLE
commonlycropplant
SHARED TOKENS (3): "commonly", "crop", "plant". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.260
Solar inverter ↗ Q129316 KW CROSS HIGH
commercialconvertscriticalcurrentdirectelectricalequipmentfunctionslocalnetworkordinaryprotectionsystem
SHARED TOKENS (13): "commercial", "converts", "critical", "current", "direct", "electrical", "equipment", "functions", "local", "network", "ordinary", "protection", "system".
0.260
Seed testing ↗ Q7445654 KW CROSS HIGH
analysiscommerciallydedicateddetermineevaluatelaboratoriesqualityresearchscientificsoldstoragetestingtrained
SHARED TOKENS (13): "analysis", "commercially", "dedicated", "determine", "evaluate", "laboratories", "quality", "research", "scientific", "sold", "storage", "testing", "trained".
0.260
researchscientificstudy
SHARED TOKENS (3): "research", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.240
chemicalcurrentlydifferentenvironmentenvironmentalformpathwaysrelationshiprelationshipsrolesscientistsstudy
SHARED TOKENS (12): "chemical", "currently", "different", "environment", "environmental", "form", "pathways", "relationship", "relationships", "roles", "scientists", "study".
0.240
chemicalcomplexeffectsenergyinfluencemodelmodelsplacesrelationshipsrepresentsresponsestudy
SHARED TOKENS (12): "chemical", "complex", "effects", "energy", "influence", "model", "models", "places", "relationships", "represents", "response", "study".
0.240
actdisposalestablishedfederaljurisdictionlawleastnationalpolicyprogramradioactivewaste
SHARED TOKENS (12): "act", "disposal", "established", "federal", "jurisdiction", "law", "least", "national", "policy", "program", "radioactive", "waste".
0.240
Water quality ↗ Q625376 KW CROSS HIGH
assessmentchemicalcompliancehealthphysicalqualitysafetysignificantstandardssupplytreatmentwater
SHARED TOKENS (12): "assessment", "chemical", "compliance", "health", "physical", "quality", "safety", "significant", "standards", "supply", "treatment", "water".
0.240
agriculturalcommonlyeasternfallsidahoirrigationlargeriverseparatesourcewaterwestern
SHARED TOKENS (12): "agricultural", "commonly", "eastern", "falls", "idaho", "irrigation", "large", "river", "separate", "source", "water", "western".
0.240
facilitieshealthhealthcarehomehospitalhospitalsidahonetworkoperatesoperatingsupportsystem
SHARED TOKENS (12): "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "network", "operates", "operating", "support", "system".
0.220
approvedcouncilfoodinternationallinesmeansprimarilyproceduresprogramregulationsregulatory
SHARED TOKENS (11): "approved", "council", "food", "international", "lines", "means", "primarily", "procedures", "program", "regulations", "regulatory".
0.220
applicationsdevelopeddiagnosticfieldintendedlaboratoryprogramregulatedresearchsingletest
SHARED TOKENS (11): "applications", "developed", "diagnostic", "field", "intended", "laboratory", "program", "regulated", "research", "single", "test".
0.220
builteasternelectricalidaholaboratorynationalsafetystationsupplytestingwater
SHARED TOKENS (11): "built", "eastern", "electrical", "idaho", "laboratory", "national", "safety", "station", "supply", "testing", "water".
0.220
chemicaldedicateddescribingeffectsfoodinfluencemodelingmodelsplacesrelationshipstudy
SHARED TOKENS (11): "chemical", "dedicated", "describing", "effects", "food", "influence", "modeling", "models", "places", "relationship", "study".
0.210
December 20 ↗ Q2455 EXACT TITLE
remain
SHARED TOKENS (1): "remain". | EXACT TITLE in nuclear_clean_energy: "December 20".
0.200
Medical test ↗ Q2671652 KW CROSS HIGH
analysischemicaldeterminediagnosticphysicalprocedureprocessestesttestingtreatment
SHARED TOKENS (10): "analysis", "chemical", "determine", "diagnostic", "physical", "procedure", "processes", "test", "testing", "treatment".
0.200
increasedmaterialmultipleoperationplantprimarilyprojectsresearchsizetechnology
SHARED TOKENS (10): "increased", "material", "multiple", "operation", "plant", "primarily", "projects", "research", "size", "technology".
0.180
academicbachelordegreeeducationgraduateprofessionalqualificationsstudentsundergraduate
SHARED TOKENS (9): "academic", "bachelor", "degree", "education", "graduate", "professional", "qualifications", "students", "undergraduate".
0.160
Select agent ↗ KW CROSS HIGH
affectingagriculturecontrolleddepartmenthealthlawpublicsafety
SHARED TOKENS (8): "affecting", "agriculture", "controlled", "department", "health", "law", "public", "safety".
0.160
becomecapabilitydifferentmultiplerecognizedsitessubsequenttreatment
SHARED TOKENS (8): "become", "capability", "different", "multiple", "recognized", "sites", "subsequent", "treatment".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitanpercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "metropolitan", "percent", "population".
0.140
disposalmanufacturingoperationpreparationprocessproductionsafely
SHARED TOKENS (7): "disposal", "manufacturing", "operation", "preparation", "process", "production", "safely".
0.120
basecapacityconstructiondemandplantplants
SHARED TOKENS (6): "base", "capacity", "construction", "demand", "plant", "plants".
0.120
developmentheadquarteredinstituteprivatesciencetechnology
SHARED TOKENS (6): "development", "headquartered", "institute", "private", "science", "technology".
◈ Frequently Asked Questions
Nuclear Clean Energy × Biotech Life Sciences — Treasure Valley
HAIKU · HIGH GATE
How do Idaho National Laboratory's research capabilities support biotech innovation in the Treasure Valley?
Idaho National Laboratory conducts advanced research that generates datasets and methodologies applicable to life sciences research conducted at Boise State University and the University of Idaho. Biotech firms in Ada County and Canyon County access INL's federal research infrastructure through collaborative partnerships that accelerate diagnostic and therapeutic development.
What environmental compliance requirements connect nuclear energy facilities and biotech operations in Boise and Nampa?
Both nuclear clean energy operations and biotech manufacturing in the Treasure Valley must comply with Resource Conservation and Recovery Act standards enforced by the Idaho Department of Environmental Quality and United States Environmental Protection Agency oversight. Ada County and Canyon County biotech facilities follow the same federal waste management protocols that govern nuclear operations, ensuring consistent environmental stewardship across the metropolitan region.
How do Occupational Safety and Health Administration standards apply across nuclear and biotech research at Boise universities?
Boise State University and the University of Idaho enforce OSHA regulations across both nuclear research laboratories and biotech life sciences facilities in Ada County. These safety standards ensure workers in radiological research and biohazard containment meet identical federal occupational protection requirements regardless of their research focus.
What shared workforce development opportunities exist between INL and Treasure Valley biotech companies?
Idaho National Laboratory, Boise State University, and the University of Idaho collaborate to train researchers in technologies applicable to both nuclear science and biotech applications across the Treasure Valley metropolitan area. Companies operating in Boise, Nampa, and Caldwell recruit graduates with dual expertise in nuclear methods and life sciences from these research institutions.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Nuclear Clean Energy × Biotech Life Sciences 17 QID bridges 254 edges 7,055 ext links 2026-07-17 22:30:12 UTC add4287b1c1ead7a
Nuclear Clean Energy corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Nuclear Clean Energy ↗ boisestandard.org/standard ↗
Parent Corridors
Nuclear Clean Energy × All Other Verticals