—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Nuclear Clean Energy ↔ relates to ↔ Energy Utilities

47 Wikipedia bridge articles confirmed in both vertical ledgers. 237 deterministic cross-vertical edges. 6,243 external source links harvested. Every edge provenance-stamped. Every claim auditable.

47 QID Bridge Articles
237 Cross Edges
6,243 External Sources
294 Wikipedia Articles
50 🌲 Evergreen
164 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Nuclear Clean Energy
× Energy Utilities
QID Bridge Articles
47
confirmed Wikipedia overlap
Total Cross Edges
237
External Sources Harvested
6,243
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho Public Utilities Commission
score: 1.1500  ·  type: exact_title_cross  ·  18 shared tokens
QID Bridge Titles (20)
Idaho Public Utilities CommissionBureau of ReclamationTreasure ValleyDamIdaho PowerSubstationApprenticeshipDemand responseSnake RiverElectricity generationHydroelectricityBoise State UniversityClean Water ActGeothermal heatingEnergy efficiencySolar powerFederal Energy Regulatory CommissionReservoirWater rightIdaho Department of Environmental Quality
Shared Semantics (20 tokens)
powerenergyelectricityidahoelectricalgenerationcapacitysourcestorageboisesolarelectricsupplylargesystemlargestrivergridsystemspopulation
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:31:16 UTC
Content Hash
92a6ef65adeaa368
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
47 BRIDGES
I
Q5987408 EXACT TITLE 1.150
QID OVERLAP: Q5987408 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (18): "commission", "customers", "electricity", "gas", "idaho", "intermountain", "investor-owned", "operated", "owned", "power", "privately", "provide", "public", "regulate", "regulates", "utilities", "utility", "water". | URL->B (1): https://puc.idaho.gov/. | EXACT TITLE in nuclear_clean_energy: "Idaho Public Utilities Commission". | EXACT TITLE in energy_utilities: "Idaho Public Utilities Commission".
commissioncustomerselectricitygasidahointermountaininvestor-ownedoperatedownedpowerprivatelyprovidepublicregulateregulatesutilitiesutilitywater
The Idaho Public Utilities Commission is a public utilities commission, a quasi-judicial tribunal, which regulates investor-owned or privately owned utilities that provide gas, water, electricity, or telephone service for profit in the U.S.
st, and United Water of Idaho. The Commission does not regulate utility cooperatives (owned by customers) or utilities operated by municipalities. References External links Idaho Public Utilities Commission Website Office of the Administrative Rules Coordinator Bloomberg Markets
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (31): "acres", "act", "become", "built", "delivery", "department", "development", "diversion", "federal", "funding", "generation", "hydroelectric", "irrigation", "largest", "law", "management", "operation", "oversight", "potential", "power".... | EXACT TITLE in energy_utilities: "Bureau of Reclamation".
acresactbecomebuiltdeliverydepartmentdevelopmentdiversionfederalfundinggenerationhydroelectricirrigationlargestlawmanagementoperationoversightpotentialpowerprogramprojectsprovisionsreclamationresourcerevenuesourcestoragesupplywater+1
power generation. It is currently the U.S.'s largest wholesaler of water, bringing water to more than 31 million people, and providing one in five Western farmers with irrigation water for 10 million acres of farmland, which produce 60% of the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "rural", "snake", "treasure", "valley", "western". | EXACT TITLE in nuclear_clean_energy: "Treasure Valley". | EXACT TITLE in energy_utilities: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalmetropolitanregionresourcesriverruralsnaketreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Dam
Q12323 EXACT TITLE 1.000
QID OVERLAP: Q12323 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (49): "additional", "application", "around", "availability", "building", "built", "century", "clean", "construction", "critical", "dam", "design", "downstream", "electricity", "engineering", "flood", "functions", "governing", "household", "hydropower".... | EXACT TITLE in nuclear_clean_energy: "Dam". | EXACT TITLE in energy_utilities: "Dam".
additionalapplicationaroundavailabilitybuildingbuiltcenturycleanconstructioncriticaldamdesigndownstreamelectricityengineeringfloodfunctionsgoverninghouseholdhydropowerincreaseindustrialirrigationlandlargemaintenancemanagementneedspassperform+19
ty of concrete and heavy construction machinery led to the creation of many large-scale dam projects worldwide. The most visible part of a dam is the barrier that retains water, but most dams contain additional structures that perform important functions. When a dam blocks a navigable river, locks may be incorporated into the project to allow ships to pass through. Fish ladders are included in many dams to enable fish to migrate upstream. Spillways are often included to safely release excess reservoir water downstream and prevent catastrophic overflows. Dam outlets allow reservoirs to be partially drained to purge sediment, perform maintenance, or increase water flow downstream. A dam may be deliberately removed for various reasons: if it poses a safety hazard, if the dam no longer fulfills its original purpose, to restore fish migration routes, or to improve the health of downstream rivers by improving sediment flow. Dams occasionally fail, resulting in flooding and loss of life.
Embankment dams and concrete dams use distinct construction methods. Embankment dams require vast amounts of soil and rock, which are usually excavated from "borrow areas" near the dam site. The soil and rocks are laid down in successive layers called lifts. After laying down a layer, it is compacted with heavy machinery. The layers must be carefully monitored to ensure that they contain the correct materials, are not overly wet, and are sufficiently compacted. Instruments are embedded within the dam as it is built, and are continually monitored so any defects can be quickly corrected. Concrete dams require a concrete plant to be built near the dam site. The plant combines aggregate (rocks), cement, fly ash, and water to produce concrete. The concrete is delivered from the concrete plant to the dam structure by means of conveyor belts, concrete buckets, dump trucks, or cranes. Formwork is built at the dam location to contain the concrete when it is placed. After it is placed into the dam structure, the concrete must be vibrated to eliminate any bubbles or air pockets. The dam is gradually built up by pouring individual "blocks" of concrete; each block is typically 1.5 to 3 m (5 to 10 ft) high, and 12 to 30 m (39 to 98 ft) wide and deep. Concrete of such thickness – called mass concrete – contracts and generates a large amount of heat as it cures, which can lead to cracks. To mitigate this issue, expansion joints can be included within the dam to permit the concrete to shrink without cracking. After the heat dissipates, the expansion joints are filled with grout, and their upstream edges are sealed with strips of metal, rubber, or plastic. Additionally, refrigeration systems may be employed that circulate coolant through the concrete by means of pipes. A recent innovation is roller compacted concrete (RCC), which has several benefits over conventional concrete. RCC uses less cement, permits the use of aggregate up to 100 mm in size, and does not generate as much heat as conventional concrete.
Journals, news, and websites Ayenalem, Abebe Yirga; et al. (28 December 2023). "Popular Culture and Nile Hydropolitics: Amharic Songs about the Grand Ethiopian Renaissance Dam". International Journal of Water Governance. 10 (1). Delft University of Technology. doi:10.59490/ijwg.10.2023.7359. ISSN 2211-4505. Bellmore, J. R.; et al. (2017) [2016]. "Status and Trends of Dam Removal Research in the United States". WIREs Water. 4 (2) e1164. Wiley-Blackwell. Bibcode:2017WIRWa...4E1164R. doi:10.1002/wat2.1164. ISSN 2049-1948. Retrieved 22 May 2026. Boulange, Julien; et al. (2021). "Role of Dams in Reducing Global Flood Exposure Under Climate Change". Nature Communications. 12 (1) 417. Springer Nature. Bibcode:2021NatCo..12..417B. doi:10.1038/s41467-020-20704-0. ISSN 2041-1723. PMC 7814128. PMID 33462241. Bulu, Atil. "Water Resources: Lecture Notes IV" (PDF). Istanbul Technical University. Retrieved 22 April 2026. Chanson, Hubert (1998). "Extreme Reservoir Sedimentation in Australia" (PDF). International Journal of Sediment Research. 13 (3). International Research and Training Centre on Erosion and Sedimentation: 55–63. ISSN 1001-6279. Retrieved 8 June 2026. Costa, Francisco; et al. (2025). "Local Economic Impacts of Hydroelectric Power Plants: Evidence from Brazil". Economía LACEA Journal. 24 (1). Latin American and Caribbean Economic Association: 105–123. doi:10.31389/eco.466. ISSN 1533-6239. El-Askary, Hesham; et al. (2026). "The World's Largest Saddle Dam at Risk". International Journal of Disaster Risk Reduction. 135 106045. Elsevier. doi:10.1016/j.ijdrr.2026.106045. ISSN 2212-4209. Fowkes, Maja; et al. (2025). "Mega-Dams In the Hydrologics of the Socialist Anthropocene". ARTMargins. 14 (2). The MIT Press: 11–38. doi:10.1162/artm_a_00411. ISSN 2162-2574. Retrieved 21 May 2026. Ghiasi, Behzad; et al. (2025). "Estimating the Volume of Evaporation from the Main Dams of Iran". Results in Engineering. 27 107057. Elsevier. doi:10.1016/j.rineng.2025.107057. ISSN 2590-1230. Retrieved 5 July 2026. Graves, Carl (29 August 2016). "Buhen: A Site Submerged". Egypt Exploration Society. Retrieved 29 May 2026. Gyau-Boakye, P. (2001). "Environmental Impacts of the Akosombo Dam and Effects of Climate Change on the Lake Levels". Environment, Development and Sustainability. 3 (1). Springer Nature: 17–29. Bibcode:2001EDSus...3...17G. doi:10.1023/A:1011402116047. ISSN 1573-2975. Retrieved 14 June 2026. Horn, John (1 May 2014). "Patagonia's New Line of Activism Is Documentary 'DamNation'". Los Angeles Times. Huang, Zhenli; et al. (2024). "Dams Trigger Exponential Population Declines of Migratory Fish". Science Advances. 10 (19) eadi6580. American Association for the Advancement of Science. doi:10.1126/sciadv.adi6580. ISSN 2375-2548. Retrieved 4 July 2026. Jeuland, Marc (2020). "The Economics of Dams" (PDF). Oxford Review of Economic Policy. 36 (1): 45–68. doi:10.1093/oxrep/grz028. ISSN 0266-903X. Retrieved 2 June 2026. Kakoyannis, Christina; et al. (2002). Assessing and Evaluating Recreational Uses of Water Resources: Implications for an Integrated Management Framework (PDF). PNW-GTR-536 (Report). US Department of Agriculture. doi:10.2737/pnw-gtr-536. Retrieved 5 July 2026. Kayiranga, Alphonse; et al. (2024). "Anthropogenic activities and the influence of desertification processes on the water cycle and water use in the Aral Sea basin". Journal of Hydrology: Regional Studies. 51 101598. Elsevier. doi:10.1016/j.ejrh.2023.101598. ISSN 2214-5818. Retrieved 9 July 2026. Keijzer, Tamara; et al. (2024). "Threats of Dams to the Persistence of the World's Freshwater Fishes". Global Change Biology. 30 (2) e17166. Wiley-Blackwell. doi:10.1111/gcb.17166. ISSN 1365-2486. Retrieved 4 July 2026. Krol, Debra (2 September 2024). "Largest Dam Removal Project in US: Klamath River Flows Freely". USA TODAY. Retrieved 22 May 2026. Larsen, Annegret; et al. (2021). "Dam Builders and Their Works: Beaver Influences on the Structure and Function of River Corridor Hydrology, Geomorphology, Biogeochemistry and Ecosystems". Earth-Science Reviews. 218 103623. Elsevier. Bibcode:2021ESRv..21803623L. doi:10.1016/j.earscirev.2021.103623. ISSN 0012-8252. Retrieved 9 June 2026. Lehner, Bernhard; et al. (2011). "High-Resolution Mapping of the World's Reservoirs and Dams for Sustainable River-Flow Management". Frontiers in Ecology and the Environment. 9 (9). Ecological Society of America: 494–502. Bibcode:2011FrEE....9..494L. doi:10.1890/100125. ISSN 1540-9295. Retrieved 30 April 2026. Lichtenstein, Grace (20 January 1976). "Edward Abbey, Voice of Southwest Wilds". The New York Times. Retrieved 17 May 2026. Liu, Xiongjun; et al. (2019). "Biodiversity Decline of Fish Assemblages After the Impoundment of the Three Gorges Dam in the Yangtze River Basin, China". Reviews in Fish Biology and Fisheries. 29 (1). doi:10.1007/s11160-019-09548-0. ISSN 1573-5184. Retrieved 21 June 2026. Marchetti, Nicolò; et al. (2019). "A Multi-scalar Approach for Assessing the Impact of Dams on the Cultural Heritage in the Middle East and North Africa". Journal of Cultural Heritage. 37. Elsevier: 17–28. doi:10.1016/j.culher.2018.10.007. ISSN 1296-2074. Retrieved 26 May 2026. McSweeney, Catherine (1 September 2023). "Rewilding Europe's Rivers with Dam Removal Boosts Biodiversity, Economy". European Investment Bank. Retrieved 22 May 2026. Morison, Conner A. G.; et al. (2023). "Mount Garibaldi: Hazard Potential from a Long-Dormant Volcanic System in the Pacific Northwest". Canadian Journal of Earth Sciences. 60 (5). Canadian Science Publishing: 464–484. doi:10.1139/cjes-2022-0067. ISSN 0008-4077. Niranjan, Ajit (21 May 2026). "Record Number of Dams Dismantled in Europe in Effort to Help Wildlife Thrive". The Guardian. Retrieved 22 May 2026. Onder, H.; Yilmaz, M. (2005). "Underground Dams: A Tool of Sustainable Development and Management of Ground Resources" (PDF). European Water. 11 (12). European Water Resources Association: 35–45. ISSN 1105-7580. Retrieved 9 May 2026. Author M. Yilmaz wrote a 2003 Masters thesis with additional detail and history on underground dams. Pearse-Smith, Scott W.D.; et al. (February 2014). "The Return of Large Dams to the Development Agenda: A Post-Development Critique". Consilience: The Journal of Sustainable Development. 11 (11). Columbia University Libraries: 123–131. ISSN 2333-9705. JSTOR 26188733. Ranjan, Amit (2024). "Grand Ethiopian Renaissance Dam Dispute: Implications, Negotiations, And Mediations". Journal of Contemporary African Studies. 42 (1). Routledge: 18–36. doi:10.1080/02589001.2023.2287425. ISSN 0258-9001. Ritchie, A. C.; et al. (2018). "Morphodynamic Evolution Following Sediment Release from the World's Largest Dam Removal". Scientific Reports. 8 (1) 13279. National Library of Medicine. Bibcode:2018NatSR...813279R. doi:10.1038/s41598-018-30817-8. ISSN 2045-2322. PMC 6125403. PMID 30185796. Ritchie, Hannah; et al. (2025). "Renewable Energy". Our World in Data. Retrieved 14 June 2026. Scott, K. F.; et al. (1968). "Farahnaz Pahlavi Dam at Layiyan". Proceedings of the Institution of Civil Engineers. 39 (3). Institution of Civil Engineers: 353–395. doi:10.1680/iicep.1968.8072. ISSN 1753-7789. Retrieved 3 July 2026. Sutor, Dave (24 March 2018). "Johnstown Flood: McCullough's 'Lucky Break' Launched Career". AP News. Retrieved 16 May 2026. Villamayor-Tomas, Sergio; et al. (2026). "Challenges and Opportunities for the Governance of Hydropower". Nature Sustainability. 9 (5). Nature Portfolio: 653–663. Bibcode:2026NatSu...9..653V. doi:10.1038/s41893-026-01782-2. ISSN 2398-9629. Retrieved 25 April 2026. Vogt, Berber (2019). "The Afsluitdijk as a Complex System". Insight. 22 (1). International Council on Systems Engineering: 32–36. doi:10.1002/inst.12235. ISSN 2156-485X. Retrieved 3 July 2026. Watts, Jonathan (25 February 2019). "Concrete: the Most Destructive Material on Earth". The Guardian. Retrieved 31 May 2026. Wieland, Martin (15 September 2023). "Comparing Vulnerabilities of CFRDs and ECRDs". International Water Power & Dam Construction. Wilmington plc. ISSN 0306-400X. Retrieved 31 May 2026. Zafarnejad, Fatemeh; et al. (2009). "The Contribution of Dams to Iran's Desertification". International Journal of Environmental Studies. 66 (3). Routledge: 327--341. doi:10.1080/00207230902798648. ISSN 0020-7233. Retrieved 5 July 2026. Zhang, Hui; et al. (2020). "Extinction of One of the World's Largest Freshwater Fishes: Lessons for Conserving the Endangered Yangtze Fauna". Science of The Total Environment. 710 136242. Elsevier. doi:10.1016/j.scitotenv.2019.13624. ISSN 0048-9697.
I
Q3147780 EXACT TITLE 1.000
QID OVERLAP: Q3147780 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (23): "around", "business", "distribution", "eastern", "electrical", "electricity", "gas", "generation", "geothermal", "hydroelectric", "idaho", "ipc", "natural", "operates", "power", "regulated", "river", "snake", "solar", "southern".... | EXACT TITLE in nuclear_clean_energy: "Idaho Power". | EXACT TITLE in energy_utilities: "Idaho Power".
aroundbusinessdistributioneasternelectricalelectricitygasgenerationgeothermalhydroelectricidahoipcnaturaloperatespowerregulatedriversnakesolarsoutherntransmissionutilitywind
mission and distribution of electricity in eastern Oregon and southern Idaho. It is a subsidiary of IDACORP, Inc. The company's 24,000-square-mile (62,000 km2) service area generally follows the area around the Snake River and its tributaries. Idaho Power owns and operates 17 hydroelectric dams and three natural gas power plants.
Substation
Q174814 EXACT TITLE 1.000
QID OVERLAP: Q174814 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (35): "approximately", "central", "change", "commercial", "connected", "consumer", "control", "customer", "different", "distribution", "electric", "electrical", "energy", "functions", "generation", "grid", "industrial", "infrastructure", "interconnection", "large".... | EXACT TITLE in nuclear_clean_energy: "Substation". | EXACT TITLE in energy_utilities: "Substation".
approximatelycentralchangecommercialconnectedconsumercontrolcustomerdifferentdistributionelectricelectricalenergyfunctionsgenerationgridindustrialinfrastructureinterconnectionlargeoperatedownedperformplantpowerreceivingremotestationstationssubstation+5
high transmission voltages and lower distribution voltages, or at the interconnection of two different transmission voltages. They are a common component of the infrastructure. As of 2022, there were approximately 55,000 substations in the United States. Substations are also occasionally known in some countries as switchyards. Substations may be owned and operated by an electrical utility, or may be owned by a large industrial or commercial customer. Generally substations are unattended, relying on SCADA for remote supervision and control. The word substation comes from the days before the distribution system became a grid. As central generation stations became larger, smaller generating plants were converted to distribution stations, receiving their energy supply from a larger plant instead of using their own generators.
ommercial customer. Generally substations are unattended, relying on SCADA for remote supervision and control. The word substation comes from the days before the distribution system became a grid. As central generation stations became larger, smaller generating plants were converted to distribution stations, receiving their energy supply from a larger plant instead of using their own generators.
Selection of the location of a substation must consider many factors. Sufficient land area is required for installation of equipment with necessary clearances for electrical safety, and for access to maintain large apparatus such as transformers. The site must have room for expansion due to load growth or planned transmission additions. Environmental effects of the substation must be considered, such as drainage, noise and road traffic effects. The substation site must be reasonably central to the distribution area to be served.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (22): "apprenticeship", "apprenticeships", "boundaries", "cases", "certification", "competence", "complete", "continued", "field", "formal", "journeyman", "labor", "level", "license", "outside", "potential", "professional", "regulated", "study", "system".... | EXACT TITLE in nuclear_clean_energy: "Apprenticeship". | EXACT TITLE in energy_utilities: "Apprenticeship".
apprenticeshipapprenticeshipsboundariescasescertificationcompetencecompletecontinuedfieldformaljourneymanlaborlevellicenseoutsidepotentialprofessionalregulatedstudysystemtrainingworking
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Demand response
Q5255048 EXACT TITLE 1.000
QID OVERLAP: Q5255048 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (48): "batteries", "businesses", "capacity", "century", "change", "changes", "consumers", "consumption", "cost", "customer", "customers", "demand", "direct", "directly", "economic", "electric", "electricity", "energy", "full", "heat".... | EXACT TITLE in nuclear_clean_energy: "Demand response".
batteriesbusinessescapacitycenturychangechangesconsumersconsumptioncostcustomercustomersdemanddirectdirectlyeconomicelectricelectricityenergyfullheatimplicationincentiveslargeloadmanagementnetnetworksoperatepanelspeak+18
d response is a change in the power consumption of an electric utility customer to better match the demand for power with the supply. Until the 21st century decrease in the cost of pumped storage and batteries, electric energy could not be easily stored, so utilities have traditionally matched demand and supply by throttling the production rate of their power plants, taking generating units on or off line, or importing power from other utilities. There are limits to what can be achieved on the supply side, because some generating units can take a long time to come up to full power, some units may be very expensive to operate, and demand can at times be greater than the capacity of all the available power plants put together. Demand response, a type of energy demand management, seeks to adjust in real-time the demand for power instead of adjusting the supply. Utilities may signal demand requests to their customers in a variety of ways, including simple off-peak metering, in which power is cheaper at certain times of the day, and smart metering, in which explicit requests or changes in price can be communicated to customers. The customer may adjust power demand by postponing some tasks that require large amounts of electric power, or may decide to pay a higher price for their electricity. Some customers may switch part of their consumption to alternate sources, such as on-site solar panels and batteries. In many respects, demand response can be put simply as a technology-enabled economic rationing system for electric power supply. In demand response, voluntary rationing is accomplished by price incentives—offering lower net unit pricing in exchange for reduced power consumption in peak periods. The direct implication is that users of electric power capacity not reducing usage (load) during peak periods will pay "surge" unit prices, whether directly, or factored into general rates. Involuntary rationing, if employed, would be accomplished via rolling blackouts during peak load periods.
large amounts of electric power, or may decide to pay a higher price for their electricity. Some customers may switch part of their consumption to alternate sources, such as on-site solar panels and batteries. In many respects, demand response can be put simply as a technology-enabled economic rationing system for electric power supply. In demand response, voluntary rationing is accomplished by price incentives—offering lower net unit pricing in exchange for reduced power consumption in peak periods. The direct implication is that users of electric power capacity not reducing usage (load) during peak periods will pay "surge" unit prices, whether directly, or factored into general rates. Involuntary rationing, if employed, would be accomplished via rolling blackouts during peak load periods.
In an electricity grid, electricity consumption and production must balance at all times; any significant imbalance could cause grid instability or severe voltage fluctuations, and cause failures within the grid. Total generation capacity is therefore sized to correspond to total peak demand with some margin of error and allowance for contingencies (such as plants being off-line during peak demand periods). Operators will generally plan to use the least expensive generating capacity (in terms of marginal cost) at any given period, and use additional capacity from more expensive plants as demand increases. Demand response in most cases is targeted at reducing peak demand to reduce the risk of potential disturbances, avoid additional capital cost requirements for additional plants, and avoid use of more expensive or less efficient operating plants. Consumers of electricity will also pay higher prices if generation capacity is used from a higher-cost source of power generation. Demand response may also be used to increase demand during periods of high supply and low demand. Some types of generating plant must be run at close to full capacity (such as nuclear), while other types may produce at negligible marginal cost (such as wind and solar). Since there is usually limited capacity to store energy, demand response may attempt to increase load during these periods to maintain grid stability. For example, in the province of Ontario in September 2006, there was a short period of time when electricity prices were negative for certain users. Energy storage such as pumped-storage hydroelectricity is a way to increase load during periods of low demand for use during later periods. Use of demand response to increase load is less common, but may be necessary or efficient in systems where there are large amounts of generating capacity that cannot be easily cycled down. Some grids may use pricing mechanisms that are not real-time, but easier to implement (users pay higher prices during the day and lower prices at night, for example) to provide some of the benefits of the demand response mechanism with less demanding technological requirements. In the UK, Economy 7 and similar schemes that attempt to shift demand associated with electric heating to overnight off-peak periods have been in operation since the 1970s. More recently, in 2006 Ontario began implementing a "smart meter" program that implements "time-of-use" (TOU) pricing, which tiers pricing according to on-peak, mid-peak and off-peak schedules. During the winter, on-peak is defined as morning and early evening, mid-peak as midday to late afternoon, and off-peak as nighttime; during the summer, the on-peak and mid-peak periods are reversed, reflecting air conditioning as the driver of summer demand. As of May 1, 2015, most Ontario electrical utilities have completed converting all customers to "smart meter" time-of-use billing with on-peak rates about 200% and mid-peak rates about 150% of the off-peak rate per kWh. Australia has national standards for Demand Response (AS/NZS 4755 series), which has been implemented nationwide by electricity distributors for several decades, e.g. controlling storage water heaters, air conditioners and pool pumps. In 2016, how to manage electrical energy storage (e.g., batteries) has been added into the series of standards. Load shedding When the loss of load happens (generation capacity falls below the load), utilities may impose load shedding on service areas via targeted blackouts, rolling blackouts, or emergency load reduction program, (ELRP) by agreements with specific high-use industrial consumers to turn off equipment at times of system-wide peak demand.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (49): "activities", "american", "canyon", "central", "century", "commercial", "constructed", "construction", "control", "dam", "downstream", "eastern", "falls", "flood", "habitat", "history", "hydroelectric", "idaho", "irrigation", "large".... | EXACT TITLE in nuclear_clean_energy: "Snake River". | EXACT TITLE in energy_utilities: "Snake River".
activitiesamericancanyoncentralcenturycommercialconstructedconstructioncontroldamdownstreameasternfallsfloodhabitathistoryhydroelectricidahoirrigationlargelargestlimitedmagicmajornationalnearnorthnorthwestpolicyprivate+19
and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
River is a major river in the interior Pacific Northwest region of the United States. About 1,080 miles (1,740 km) long, it is the largest tributary of the Columbia River, which is the largest North American river that empties into the Pacific Ocean. Beginning in Yellowstone National Park, western Wyoming, it flows across the arid Snake River Plain of southern Idaho, the rugged Hells Canyon on the borders of Idaho, Oregon and Washington, and finally the rolling Palouse Hills of southeast Washington. It joins the Columbia River just downstream from the Tri-Cities, Washington, in the southern Columbia Basin. The river's watershed, which drains parts of six U.S. states, is situated between the Rocky Mountains to the north and east, the Great Basin to the south, and the Blue Mountains and Oregon high desert to the west. The region has a long history of volcanism; millions of years ago, Columbia River basalts covered vast areas of the western Snake River watershed, while the Snake River Plain was a product of the Yellowstone volcanic hotspot. The river was further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
as further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
Electricity generation
Q383973 EXACT TITLE 1.000
QID OVERLAP: Q383973 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (34): "change", "delivery", "demand", "directly", "distribution", "electric", "electrical", "electricity", "electrification", "energy", "fields", "forecast", "gas", "generation", "geothermal", "growth", "heat", "homes", "means", "peak".... | EXACT TITLE in nuclear_clean_energy: "Electricity generation".
changedeliverydemanddirectlydistributionelectricelectricalelectricityelectrificationenergyfieldsforecastgasgenerationgeothermalgrowthheathomesmeanspeakplantpowerprocessproductionproposedreportedsolarstationsstoragesupply+4
l-fired power stations and eventually gas-fired power stations, or, if practical, capturing their greenhouse gas emissions, is an important part of the energy transformation required to limit climate change. Vastly more solar power and wind power is forecast to be required, with electricity demand increasing strongly with further electrification of transport, homes and industry.
Steam Water is boiled by coal burned in a thermal power plant. About 41% of all electricity is generated this way. Nuclear fission heat created in a nuclear reactor creates steam. Less than 15% of electricity is generated this way. Renewable energy. The steam is generated by biomass, solar thermal energy, or geothermal power. Natural gas: turbines are driven directly by gases produced by combustion. Combined cycle are driven by both steam and natural gas. They generate power by burning natural gas in a gas turbine and use residual heat to generate steam. At least 20% of the world's electricity is generated by natural gas. Water Energy is captured by a water turbine from the movement of water - from falling water, the rise and fall of tides or ocean thermal currents (see ocean thermal energy conversion). Currently, hydroelectric plants provide approximately 16% of the world's electricity. The windmill was a very early wind turbine. In 2018 around 5% of the world's electricity was produced from wind. Turbines can also use other heat-transfer liquids than steam. Supercritical carbon dioxide based cycles can provide higher conversion efficiency due to faster heat exchange, higher energy density and simpler power cycle infrastructure. Supercritical carbon dioxide blends, that are currently in development, can further increase efficiency by optimizing its critical pressure and temperature points. Although turbines are most common in commercial power generation, smaller generators can be powered by gasoline or diesel engines.
Variations between countries generating electrical power affect concerns about the environment. In France only 10% of electricity is generated from fossil fuels, the US is higher at 70% and China is at 80%. The cleanliness of electricity depends on its source. Methane leaks (from natural gas to fuel gas-fired power plants) and carbon dioxide emissions from fossil fuel-based electricity generation account for a significant portion of world greenhouse gas emissions. In the United States, fossil fuel combustion for electric power generation is responsible for 65% of all emissions of sulfur dioxide, the main component of acid rain. Electricity generation is the fourth highest combined source of NOx, carbon monoxide, and particulate matter in the US. According to the International Energy Agency (IEA), low-carbon electricity generation needs to account for 85% of global electrical output by 2040 in order to ward off the worst effects of climate change. Like other organizations including the Energy Impact Center (EIC) and the United Nations Economic Commission for Europe (UNECE), the IEA has called for the expansion of nuclear and renewable energy to meet that objective. Some, like EIC founder Bret Kugelmass, believe that nuclear power is the primary method for decarbonizing electricity generation because it can also power direct air capture that removes existing carbon emissions from the atmosphere. Nuclear power plants can also create district heating and desalination projects, limiting carbon emissions and the need for expanded electrical output. A fundamental issue regarding centralised generation and the current electrical generation methods in use today is the significant negative environmental effects that many of the generation processes have. Processes such as coal and gas not only release carbon dioxide as they combust, but their extraction from the ground also impacts the environment. Open pit coal mines use large areas of land to extract coal and limit the potential for productive land use after the excavation. Natural gas extraction releases large amounts of methane into the atmosphere when extracted from the ground, which greatly increases global greenhouse gases. Although nuclear power plants do not release carbon dioxide through electricity generation, there are risks associated with nuclear waste and safety concerns associated with the use of nuclear sources. Per unit of electricity generated coal and gas-fired power life-cycle greenhouse gas emissions are almost always at least ten times that of other generation methods. Extreme heat events can negatively impact electrical power generation, transmission, and distribution, potentially leading to power outages (blackouts or brownouts). Increased ambient air temperature significantly reduces the efficiency of turbines, boilers and generators, affecting natural gas, oil, and nuclear power plants, but not coal or biomass plants. Increased water temperatures limit cooling capacity in fossil-fuel, geothermal, biomass and nuclear power plants.
Hydroelectricity
Q80638 EXACT TITLE 1.000
QID OVERLAP: Q80638 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (41): "among", "capacity", "clean", "complex", "constructed", "construction", "creating", "dam", "demand", "direct", "electrical", "electricity", "energy", "environmental", "gas", "generation", "hydroelectric", "hydropower", "involved", "land".... | EXACT TITLE in nuclear_clean_energy: "Hydroelectricity".
amongcapacitycleancomplexconstructedconstructioncreatingdamdemanddirectelectricalelectricityenergyenvironmentalgasgenerationhydroelectrichydropowerinvolvedlandlargelargestmakingnaturalpopulationpowerprincipallyproducesprovideregion+11
n and erosion patterns. While dams can ameliorate the risks of flooding, dam failure can be catastrophic. In 2021, global installed hydropower electrical capacity reached almost 1,400 GW, the highest among all renewable energy technologies. Hydroelectricity plays a leading role in countries like Brazil, Norway and China. but there are geographical limits and environmental issues. Tidal power can be used in coastal regions. China added 24 GW in 2022, accounting for nearly three-quarters of global hydropower capacity additions. Europe added 2 GW, the largest amount for the region since 1990.
ffecting habitats and ecosystems, and siltation and erosion patterns. While dams can ameliorate the risks of flooding, dam failure can be catastrophic. In 2021, global installed hydropower electrical capacity reached almost 1,400 GW, the highest among all renewable energy technologies. Hydroelectricity plays a leading role in countries like Brazil, Norway and China. but there are geographical limits and environmental issues. Tidal power can be used in coastal regions. China added 24 GW in 2022, accounting for nearly three-quarters of global hydropower capacity additions. Europe added 2 GW, the largest amount for the region since 1990.
and China. but there are geographical limits and environmental issues. Tidal power can be used in coastal regions. China added 24 GW in 2022, accounting for nearly three-quarters of global hydropower capacity additions. Europe added 2 GW, the largest amount for the region since 1990.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in nuclear_clean_energy: "Boise State University". | EXACT TITLE in energy_utilities: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringidahoindependentinstitutionprogramprogramspublicreportedresearchuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (32): "act", "addressing", "administered", "changes", "chemical", "clean", "conservation", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "groundwater", "law", "maintain", "major".... | EXACT TITLE in energy_utilities: "Clean Water Act".
actaddressingadministeredchangeschemicalcleanconservationcontrolcoordinationdirectlyengineersenvironmentalfederalformfundinggoverninggroundwaterlawmaintainmajorownedphysicalprotectionprovisionsqualityrecoveryresourcethoughtreatmentwastewater+2
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Geothermal heating
Q10577628 EXACT TITLE 1.000
QID OVERLAP: Q10577628 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (27): "activity", "advantage", "air", "annual", "application", "applications", "approximately", "around", "boundaries", "capacity", "consumption", "contains", "direct", "earth", "efficiency", "energy", "even", "formation", "geothermal", "groundwater".... | EXACT TITLE in energy_utilities: "Geothermal heating".
activityadvantageairannualapplicationapplicationsapproximatelyaroundboundariescapacityconsumptioncontainsdirectearthefficiencyenergyevenformationgeothermalgroundwaterheatheatingneededsolarsourcesurfacewinter
net, from radioactive decay of minerals, and from solar energy absorbed at the surface. Most high temperature geothermal heat is harvested in regions close to tectonic plate boundaries where volcanic activity rises close to the surface of the Earth. In these areas, ground and groundwater can be found with temperatures higher than the target temperature of the application. However, even cold ground contains heat.
Geothermal heating is the direct use of geothermal energy for some heating applications. Humans have taken advantage of geothermal heat this way since the Paleolithic era. Approximately seventy countries made direct use of a total of 270 PJ of geothermal heating in 2004. As of 2007, 28 GW of geothermal heating capacity is installed around the world, satisfying 0.07% of global primary energy consumption. Thermal efficiency is high since no energy conversion is needed, but capacity factors tend to be low (around 20%) since the heat is mostly needed in the winter. Geothermal energy originates from the heat retained within the Earth since the original formation of the planet, from radioactive decay of minerals, and from solar energy absorbed at the surface. Most high temperature geothermal heat is harvested in regions close to tectonic plate boundaries where volcanic activity rises close to the surface of the Earth. In these areas, ground and groundwater can be found with temperatures higher than the target temperature of the application. However, even cold ground contains heat.
In regions without any high temperature geothermal resources, a ground-source heat pump (GSHP) can provide space heating and space cooling. Like a refrigerator or air conditioner, these systems use a heat pump to force the transfer of heat from the ground to the building. Heat can be extracted from any source, no matter how cold, but a warmer source allows higher efficiency. A ground-source heat pump uses the shallow ground or ground water (typically starting at 10–12 °C or 50–54 °F) as a source of heat, thus taking advantage of its seasonally moderate temperatures. In contrast, an air source heat pump draws heat from the air (colder outside air) and thus requires more energy. GSHPs circulate a carrier fluid (usually a mixture of water and small amounts of antifreeze) through closed pipe loops buried in the ground. Single-home systems can be "vertical loop field" systems with bore holes 50–400 feet (15–120 m) deep or, if adequate land is available for extensive trenches, a "horizontal loop field" is installed approximately six feet subsurface. As the fluid circulates underground it absorbs heat from the ground and, on its return, the warmed fluid passes through the heat pump which uses electricity to extract heat from the fluid. The re-chilled fluid is sent back into the ground thus continuing the cycle. The heat extracted and that generated by the heat pump appliance as a byproduct is used to heat the house. The addition of the ground heating loop in the energy equation means that significantly more heat can be transferred to a building than if electricity alone had been used directly for heating. Switching the direction of heat flow, the same system can be used to circulate the cooled water through the house for cooling in the summer months. The heat is exhausted to the relatively cooler ground (or groundwater) rather than delivering it to the hot outside air as an air conditioner does. As a result, the heat is pumped across a larger temperature difference and this leads to higher efficiency and lower energy use. This technology makes ground source heating economically viable in any geographical location. In 2004, an estimated million ground-source heat pumps with a total capacity of 15 GW extracted 88 PJ of heat energy for space heating.
E
Q5377042 EXACT TITLE 1.000
QID OVERLAP: Q5377042 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (19): "conservation", "consumption", "economy", "efficiency", "efficient", "electrical", "energy", "heat", "mechanical", "net", "potential", "power", "process", "produces", "purpose", "reducing", "source", "transportation", "work". | EXACT TITLE in nuclear_clean_energy: "Energy efficiency".
conservationconsumptioneconomyefficiencyefficientelectricalenergyheatmechanicalnetpotentialpowerprocessproducespurposereducingsourcetransportationwork
Energy efficiency (physics), the ratio between the useful output and input of an energy conversion process Electrical efficiency, useful power output per electrical power consumed Mechanical efficiency, a ratio of the measured performance to the performance of an ideal machine Thermal efficiency, the extent to which the energy added by heat is converted to net work output or vice versa Luminous efficiency, a measure of how well a light source produces visible light Fuel efficiency, the efficiency of converting potential energy in a fuel into kinetic energy Energy efficiency in transportation, the fuel economy of various modes of transportation Energy-efficient landscaping, a type of landscaping designed for the purpose of conserving energy Efficient energy use, minimizing the amount of energy used for a given, constant energy service Energy conservation, reducing energy consumption by using less of an energy service See also Energy (disambiguation) Efficiency (disambiguation) Energy rating (disambiguation) All pages with titles containing Energy e
Solar power
Q1483757 EXACT TITLE 1.000
QID OVERLAP: Q1483757 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (45): "applications", "built", "capacity", "change", "commercial", "continuing", "convert", "cost", "current", "directly", "electric", "electricity", "electrification", "energy", "financing", "generation", "grid", "homes", "installations", "installer".... | EXACT TITLE in nuclear_clean_energy: "Solar power".
applicationsbuiltcapacitychangecommercialcontinuingconvertcostcurrentdirectlyelectricelectricityelectrificationenergyfinancinggenerationgridhomesinstallationsinstallerintegrationinternationallargelargestneededoff-gridpanelsphotovoltaicpolicypower+15
r tracking systems to focus a large area of sunlight to a hot spot, often to drive a steam turbine. Photovoltaics (PV) were initially solely used as a source of electricity for small and medium-sized applications, from the calculator powered by a single solar cell to remote homes powered by an off-grid rooftop PV system. Commercial concentrated solar power plants were first developed in the 1980s. Since then, as the cost of solar panels has fallen, grid-connected solar PV systems' capacity and production have doubled about every three years. Three-quarters of new generation capacity is solar, with both millions of rooftop installations and gigawatt-scale photovoltaic power stations continuing to be built. In 2025, solar power generated 9% of global electricity. In 2024, solar generated over 1% of primary energy (2.7% by the substitution method), adding twice as much new electricity as coal. Along with onshore wind power, utility-scale solar is the source with the cheapest levelised cost of electricity for new installations in most countries. Almost half the solar power installed in 2022 was mounted on rooftops. China is currently the largest producer and installer of solar power capacity; globally, it produces 98% of solar wafers, 92% of solar cells and 85% of solar panels, and accounted for more than 55% of global installed solar capacity in the first half of 2025. Much more low-carbon power is needed for electrification and to limit climate change. The International Energy Agency said in 2022 that more effort was needed for grid integration and the mitigation of policy, regulation and financing challenges. Nevertheless solar may greatly cut the cost of energy.
The photovoltaic effect in solar cells converts light into electric current. The first solar cell was constructed by Charles Fritts in the 1880s. The German industrialist Ernst Werner von Siemens was among those who recognized the importance of this discovery. In 1931, the German engineer Bruno Lange developed a photo cell using silver selenide in place of copper oxide, although the prototype selenium cells converted less than 1% of incident light into electricity. Following the work of Russell Ohl in the 1940s, researchers Gerald Pearson, Calvin Fuller and Daryl Chapin created the silicon solar cell in 1954. These early solar cells cost US$286/watt and reached efficiencies of 4.5–6%. In 1957, Mohamed M. Atalla developed the process of silicon surface passivation by thermal oxidation at Bell Labs. The surface passivation process has since been critical to solar cell efficiency. As of 2022 over 90% of the market is crystalline silicon. Other types of solar cell include thin-film solar cells, made by depositing one or more thin layers, or thin film (TF) of photovoltaic material on a substrate, such as glass, plastic or metal. The array of a photovoltaic system, or PV system, produces direct current (DC) power which fluctuates with the sunlight's intensity. For practical use this usually requires conversion to alternating current (AC), through the use of inverters. Multiple solar cells are connected inside panels. Panels are wired together to form arrays, then tied to an inverter, which produces power at the desired voltage, and for AC, the desired frequency/phase. Many residential PV systems are connected to the grid when available, especially in developed countries with large markets. In these grid-connected PV systems energy storage is optional. In certain applications such as satellites, lighthouses, or in developing countries, batteries or additional power generators are often added as back-ups.
Variability The overwhelming majority of electricity produced worldwide is used immediately because traditional generators can adapt to demand and storage is generally more expensive. Both solar power and wind power are sources of variable renewable power, meaning that all available output must be used locally, transmitted elsewhere to be used, or stored (e.g., in a battery). Since solar energy is not available at night, storing it so as to have continuous electricity availability is potentially an important issue, particularly in off-grid applications and for future 100% renewable energy scenarios. As solar power is intermittent and depends on both daylight and weather conditions, countries following net-zero pathways that rely heavily on solar energy typically need to integrate it with large-scale battery storage, pumped hydroelectric energy storage, or long-distance power transmission to help maintain grid reliability. Solar power can be forecast to some extent by time based on the time of day, location, and seasons, although short-term generation also depends on weather conditions. The challenge of integrating solar power in any given electric utility varies significantly.
Federal Energy Regulatory Commission
Q3067862 EXACT TITLE 1.000
QID OVERLAP: Q3067862 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (20): "build", "commission", "department", "electricity", "energy", "federal", "gas", "hydropower", "independent", "licensing", "natural", "pipeline", "projects", "regulates", "regulatory", "reviews", "serving", "storage", "transmission", "wholesale". | EXACT TITLE in energy_utilities: "Federal Energy Regulatory Commission".
buildcommissiondepartmentelectricityenergyfederalgashydropowerindependentlicensingnaturalpipelineprojectsregulatesregulatoryreviewsservingstoragetransmissionwholesale
government that regulates the interstate transmission and wholesale sale of electricity and natural gas and the prices of interstate transport of petroleum by pipeline. FERC also reviews proposals to build interstate natural gas pipelines, natural gas storage projects, and liquefied natural gas (LNG) terminals, in addition to licensing non-federal hydropower projects. FERC was created in 1977 by the U.S. Congress in the aftermath of the 1973 oil crisis. It is an independent agency, despite being part of the U.S. Department of Energy. It is headed by five commissioners who are nominated by the U.S. president and confirmed by the U.S. Senate.
projects. FERC was created in 1977 by the U.S. Congress in the aftermath of the 1973 oil crisis. It is an independent agency, despite being part of the U.S. Department of Energy. It is headed by five commissioners who are nominated by the U.S. president and confirmed by the U.S. Senate.
nergy. It is headed by five commissioners who are nominated by the U.S. president and confirmed by the U.S. Senate.
Reservoir
Q131681 EXACT TITLE 0.980
QID OVERLAP: Q131681 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (14): "behind", "building", "built", "controlling", "dam", "existing", "form", "generation", "hydroelectric", "power", "reservoir", "reservoirs", "storage", "water". | EXACT TITLE in nuclear_clean_energy: "Reservoir". | EXACT TITLE in energy_utilities: "Reservoir".
behindbuildingbuiltcontrollingdamexistingformgenerationhydroelectricpowerreservoirreservoirsstoragewater
A reservoir (; from French réservoir [ʁezɛʁvwaʁ]) is an enlarged lake behind a dam, usually built to store fresh water, often doubling for hydroelectric power generation. Reservoirs are created by controlling a watercourse that drains an existing body of water, interrupting a watercourse to form an embayment within it, excavating, or building any number of retaining walls or levees to enclose any area to store water.
Downstream water supply water may be released from an upland reservoir so that it can be abstracted for drinking water lower down the system, sometimes hundreds of miles further downstream. Irrigation water in an irrigation reservoir may be released into networks of canals for use in farmlands or secondary water systems. Irrigation may also be supported by reservoirs which maintain river flows, allowing water to be abstracted for irrigation lower down the river. Flood control also known as an "attenuation" or "balancing" reservoirs, flood control reservoirs collect water at times of very high rainfall, then release it slowly during the following weeks or months. Some of these reservoirs are constructed across the river line, with the onward flow controlled by an orifice plate. When river flow exceeds the capacity of the orifice plate, water builds up behind the dam; but as soon as the flow rate reduces, the water behind the dam is slowly released until the reservoir is empty again. In some cases, such reservoirs only function a few times in a decade, and the land behind the reservoir may be developed as community or recreational land. A new generation of balancing dams are being developed to combat the possible consequences of climate change. They are called "Flood Detention Reservoirs". Because these reservoirs will remain dry for long periods, there may be a risk of the clay core drying out, reducing its structural stability. Recent developments include the use of composite core fill made from recycled materials as an alternative to clay. Canals Where a natural watercourse's water is not available to be diverted into a canal, a reservoir may be built to guarantee the water level in the canal: for example, where a canal climbs through locks to cross a range of hills. Another use is to reduce costs or construction time when the canal must be dug through rock, as used on the Rideau Canal with The Narrows locks dividing the two Rideau's and essentially turning the upper Rideau into an enlarged reservoir, albeit only by two or three feet. Recreation water may be released from a reservoir to create or supplement white water conditions for kayaking and other white-water sports.
Hydroelectricity and climate change Depending upon the area flooded versus power produced, a reservoir built for hydro-electricity generation can either reduce or increase the net production of greenhouse gases when compared to other sources of power. A study for the National Institute for Research in the Amazon found that hydroelectric reservoirs release a large pulse of carbon dioxide from decay of trees left standing in the reservoirs, especially during the first decade after flooding. This elevates the global warming impact of the dams to levels much higher than would occur by generating the same power from fossil fuels. According to the World Commission on Dams report (Dams And Development), when the reservoir is relatively large and no prior clearing of forest in the flooded area was undertaken, greenhouse gas emissions from the reservoir could be higher than those of a conventional oil-fired thermal generation plant. For instance, In 1990, the impoundment behind the Balbina Dam in Brazil (inaugurated in 1987) had over 20 times the impact on global warming than would generating the same power from fossil fuels, due to the large area flooded per unit of electricity generated. Another study published in the Global Biogeochemical Cycles also found that newly flooded reservoirs released more carbon dioxide and methane than the pre-flooded landscape, noting that forest lands, wetlands, and preexisting water features all released differing amounts of carbon dioxide and methane both pre- and post-flooding. The Tucuruí Dam in Brazil (completed in 1984) had only 0.4 times the impact on global warming than would generating the same power from fossil fuels. A two-year study of carbon dioxide and methane releases in Canada concluded that while the hydroelectric reservoirs there do emit greenhouse gases, it is on a much smaller scale than thermal power plants of similar capacity.
W
Q7973730 EXACT TITLE 0.940
QID OVERLAP: Q7973730 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (12): "different", "groundwater", "irrigation", "law", "legal", "physical", "right", "river", "source", "surface", "systems", "water". | EXACT TITLE in nuclear_clean_energy: "Water right". | EXACT TITLE in energy_utilities: "Water right".
differentgroundwaterirrigationlawlegalphysicalrightriversourcesurfacesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
Community-based allocation of water In some jurisdictions, appropriative water rights can be granted directly to communities. Here, water is reserved to provide sufficient capacity for the future growth of that particular community. For example, California provides communities and other water users within watersheds senior status over appropriative (use-based) water rights solely because they are located where the water originates and naturally flows. A second example of community-based water rights is pueblo water rights. As recognized by California, pueblo water rights are grants to individual settlements (i.e. pueblos) over all streams and rivers flowing through the city and to all groundwater aquifers underlying that particular city. The pueblo's claim expands with the needs of the city and may be used to supply the needs of areas that are later annexed to the city. While California recognizes pueblo water rights, pueblo water rights are controversial.
Idaho Department of Environmental Quality
Q5987351 EXACT TITLE 0.860
QID OVERLAP: Q5987351 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (8): "boise", "department", "environmental", "federal", "idaho", "quality", "regional", "responsible". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Environmental Quality". | EXACT TITLE in energy_utilities: "Idaho Department of Environmental Quality".
boisedepartmentenvironmentalfederalidahoqualityregionalresponsible
tment of Environmental Quality is the department of the Idaho state government responsible for administering state and federal environmental laws and regulations. The department's main offices are in Boise, and six regional offices are also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act.
also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act. Before 2000, DEQ in Idaho was a division of the Department of Health and Welfare. Structure and functions It is organized into five divisions: Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Boise River
Q891080 EXACT TITLE 0.860
QID OVERLAP: Q891080 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (8): "agricultural", "approximately", "boise", "idaho", "river", "snake", "urban", "western". | EXACT TITLE in energy_utilities: "Boise River".
agriculturalapproximatelyboiseidahoriversnakeurbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Geothermal energy
Q127993 QID OVERLAP 0.800
QID OVERLAP: Q127993 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (33): "additional", "agricultural", "applications", "boundaries", "built", "capacity", "century", "continued", "cost", "department", "district", "earth", "electric", "electricity", "energy", "formation", "generation", "geothermal", "heat", "heating"....
additionalagriculturalapplicationsboundariesbuiltcapacitycenturycontinuedcostdepartmentdistrictearthelectricelectricityenergyformationgenerationgeothermalheatheatingindustrialnearneedsplantpowerprocessesratereducerenewableresources+3
ergy estimated that power from a newly built plant costs about $0.05/kWh. 16 gigawatts (GW) of geothermal power was available worldwide in 2025, which was less than 1% of renewable power capacity. An additional 28 gigawatts provided heat for district heating, space heating, spas, industrial processes, desalination, and agricultural applications as of 2010.
However, local effects of heat extraction must be considered. Over the course of decades, individual wells draw down local temperatures and water levels. The three oldest sites, at Larderello, Wairakei, and the Geysers experienced reduced output because of local depletion. Heat and water, in uncertain proportions, were extracted faster than they could be replenished. Reducing production and injecting additional water could allow these wells to return to their original capacity. Such strategies have been implemented at some sites, which continue to provide significant energy. The Wairakei power station was commissioned in November 1958, and it attained its peak generation of 173 MW in 1965, but already the supply of high-pressure steam was faltering. In 1982 it was down-rated to intermediate pressure and the output to 157 MW. In 2005, two 8 MW isopentane systems were added, boosting output by about 14 MW.
able worldwide in 2025, which was less than 1% of renewable power capacity. An additional 28 gigawatts provided heat for district heating, space heating, spas, industrial processes, desalination, and agricultural applications as of 2010.
Wind power
Q43302 QID OVERLAP 0.800
QID OVERLAP: Q43302 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (28): "agreement", "capacity", "change", "connected", "electrical", "electricity", "energy", "environment", "farms", "gas", "generation", "grid", "installations", "needs", "potential", "power", "renewable", "share", "solar", "source"....
agreementcapacitychangeconnectedelectricalelectricityenergyenvironmentfarmsgasgenerationgridinstallationsneedspotentialpowerrenewablesharesolarsourcesouthernstationsstoragesuppliedsupplywindwinterwork
ed wind power capacity exceeded 800 GW. 30 countries generated more than a tenth of their electricity from wind power in 2024 and wind generation has nearly tripled since 2015. To help meet the Paris Agreement goals to limit climate change, analysts say it should expand much faster – by over 1% of electricity generation per year. Wind power is a sustainable, renewable energy source, and has a much smaller impact on the environment than burning fossil fuels. Wind power is variable, so it needs energy storage or other dispatchable generation energy sources to attain a reliable supply of electricity. Land-based (onshore) wind farms have a greater visual impact on the landscape than most other power stations per energy produced. Wind farms sited offshore have less visual impact and have higher capacity factors, although they are generally more expensive. Offshore wind power currently has a share of about 10% of new installations. Wind power is one of the lowest-cost electricity sources per unit of energy produced. In many locations, new onshore wind farms are cheaper than new coal or gas plants. Regions in the higher northern and southern latitudes have the highest potential for wind power. In most regions, wind power generation is higher in nighttime, and in winter when solar power output is low.
Collection and transmission network Near offshore wind farms may be connected by AC and far offshore by HVDC. Wind power resources are not always located near areas with a high population density. As transmission lines become longer, the losses associated with power transmission increase, as modes of losses at lower lengths are exacerbated and new modes of losses are no longer negligible as the length is increased; making it harder to transport large loads over large distances. When the transmission capacity does not meet the generation capacity, wind farms are forced to produce below their full potential or stop running altogether, in a process known as curtailment. While this leads to potential renewable generation left untapped, it prevents possible grid overload or risk to reliable service. One of the major challenges to wind power grid integration in some countries is developing new transmission lines to carry power from wind farms, which are often in remote lowly populated areas due to availability of wind, to high load locations where population density is higher. Any existing transmission lines in remote locations may not have been designed for the transport of large amounts of energy. In particular geographic regions, peak wind speeds may not coincide with peak demand for electrical power, whether offshore or onshore. A possible future option may be to interconnect widely dispersed geographic areas with an HVDC super grid. Wind power capacity and production In 2024, wind supplied over 2,494 TWh of electricity, which was 8.1% of world electricity. Growth trends To help meet the Paris Agreement's goals to limit climate change, analysts say it should expand much faster than it currently is – by over 1% of electricity generation per year. Expansion of wind power is being hindered by fossil fuel subsidies. The actual amount of electric power that wind can generate is calculated by multiplying the nameplate capacity by the capacity factor, which varies according to equipment and location.
In 2025, wind supplied about 2,700 TWh of electricity, which was over 8% of world electricity. With about 100 GW added during 2021, mostly in China and the United States, global installed wind power capacity exceeded 800 GW. 30 countries generated more than a tenth of their electricity from wind power in 2024 and wind generation has nearly tripled since 2015. To help meet the Paris Agreement goals to limit climate change, analysts say it should expand much faster – by over 1% of electricity generation per year. Wind power is a sustainable, renewable energy source, and has a much smaller impact on the environment than burning fossil fuels. Wind power is variable, so it needs energy storage or other dispatchable generation energy sources to attain a reliable supply of electricity. Land-based (onshore) wind farms have a greater visual impact on the landscape than most other power stations per energy produced. Wind farms sited offshore have less visual impact and have higher capacity factors, although they are generally more expensive. Offshore wind power currently has a share of about 10% of new installations. Wind power is one of the lowest-cost electricity sources per unit of energy produced. In many locations, new onshore wind farms are cheaper than new coal or gas plants. Regions in the higher northern and southern latitudes have the highest potential for wind power. In most regions, wind power generation is higher in nighttime, and in winter when solar power output is low.
I
Q119039700 QID OVERLAP 0.800
QID OVERLAP: Q119039700 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (39): "alternatives", "applications", "capacity", "chain", "conservation", "consumption", "cost", "defines", "demand", "demand-side", "district", "efficiency", "electric", "energy", "expected", "form", "full", "generation", "goal", "growth"....
alternativesapplicationscapacitychainconservationconsumptioncostdefinesdemanddemand-sidedistrictefficiencyelectricenergyexpectedformfullgenerationgoalgrowthheatingintegratedirplawlong-termmeansmethodologyplanningpowerprocess+9
production and/or purchasing the supply) to demand-side (reducing the consumption). For example, for an electric utility the US law defines IRP as a planning process that evaluates the full range of alternatives, including new generating capacity, power purchases, energy conservation and efficiency, cogeneration and district heating and cooling applications. The methodology requires the utility to be able to influence all aspects of the supply chain from production to consumption, so in the US it is used by many vertically integrated (non-deregulated) ones. IRP effectively ends with deregulation.
a planning process that evaluates the full range of alternatives, including new generating capacity, power purchases, energy conservation and efficiency, cogeneration and district heating and cooling applications. The methodology requires the utility to be able to influence all aspects of the supply chain from production to consumption, so in the US it is used by many vertically integrated (non-deregulated) ones. IRP effectively ends with deregulation.
higher electricity rates may be needed for the utility to recover the investment (IRP only gained momentum once the utilities were allowed to pass the investments into conservation onto customers through higher rates). The increased rates will affect some consumers disproportionally, creating the equity problems; government mandating the utility to directly subsidize the low-income residential customers, thus engaging in a forced charity; the energy savings and cost of the demand side management are hard to measure, unlike the expenses and results of the capacity improvements, and a too optimistic estimate of the savings can translate into problems with the resource adequacy. References Sources Almeida, Anibal T. (1994).
Net metering
Q2685471 QID OVERLAP 0.800
QID OVERLAP: Q2685471 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (29): "annual", "arrangement", "connection", "consumers", "current", "electric", "electricity", "energy", "even", "fee", "mechanism", "net", "policy", "power", "private", "procedure", "renewable", "require", "requires", "retail"....
annualarrangementconnectionconsumerscurrentelectricelectricityenergyevenfeemechanismnetpolicypowerprivateprocedurerenewablerequirerequiresretailsettlementsinglesmallsolarsolelystorageuseswholesalewind
lar, which are non-dispatchable (when not coupled to storage). Monthly net metering allows consumers to use solar power generated during the day at night, or wind from a windy day later in the month. Annual net metering rolls over a net kilowatt-hour (kWh) credit to the following month, allowing solar power that was generated in July to be used in December, or wind power from March in August. Net metering policies can vary significantly by country and by state or province: if net metering is available, if and how long banked credits can be retained, and how much the credits are worth (retail/wholesale). Most net metering laws involve monthly rollover of kWh credits, a small monthly connection fee, require a monthly payment of deficits (i.e. normal electric bill), and annual settlement of any residual credit.
ts are worth (retail/wholesale). Most net metering laws involve monthly rollover of kWh credits, a small monthly connection fee, require a monthly payment of deficits (i.e. normal electric bill), and annual settlement of any residual credit.
History Net metering originated in the United States, where small wind turbines and solar panels were connected to the electrical grid, and consumers wanted to be able to use the electricity generated at a different time or date from when it was generated. The first two projects to use net metering were an apartment complex and a solar test house in Massachusetts in 1979. Minnesota is commonly cited as passing the first net metering law, in 1983, and allowed anyone generating less than 40 kW to either roll over any credit to the next month, or be paid for the excess. In 2000 this was amended to compensation "at the average retail utility energy rate". This is the simplest and most general interpretation of net metering, and in addition allows small producers to sell electricity at the retail rate. Utilities in Idaho adopted net metering in 1980, and in Arizona in 1981. Massachusetts adopted net metering in 1982. By 1998, 22 states or utilities therein had adopted net metering. Two California utilities initially adopted a monthly "net metering" charge, which included a "standby charge", until the Public Utilities Commission (PUC) banned such charges. In 2005, all U.S. utilities were required to consider adopting rules offering net metering "upon request" by the Energy Policy Act of 2005. Excess generation is not addressed. As of 2013, 43 U.S. states have adopted net metering, as well as utilities in 3 of the remaining states, leaving only 4 states without any established procedures for implementing net metering. However, a 2017 study showed that only 3% of U.S. utilities offer full retail compensation for net metering with the remainder offering less than retail rates, having credit expire annually, or some form of indefinite rollover. Net metering was slow to be adopted in Europe, especially in the United Kingdom, because of confusion over how to address the value added tax (VAT). Only one utility company in Great Britain offers net metering. The United Kingdom government is reluctant to introduce the net metering principle because of complications in paying and refunding the value added tax that is payable on electricity, but pilot projects are underway in some areas. In Canada, some provinces have net metering programs. In the Philippines, Net Metering scheme is governed by Republic Act 9513 (Renewable Energy Act of 2008) and its implementing rules and regulation (IRR). The implementing body is the Energy Regulatory Commission (ERC) in consultation with the National Renewable Energy Board (NREB). Unfortunately, the scheme is not a true net metering scheme but in reality a net billing scheme. As the Dept of Energy's Net Metering guidelines say, "Net-metering allows customers of Distribution Utilities (DUs) to install an on-site Renewable Energy (RE) facility not exceeding 100 kilowatts (kW) in capacity so they can generate electricity for their own use. Any electricity generated that is not consumed by the customer is automatically exported to the DU's distribution system.
Smart grid
Q689855 QID OVERLAP 0.800
QID OVERLAP: Q689855 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (74): "advanced", "batteries", "behind", "capacity", "century", "code", "communications", "conditioning", "connect", "consumption", "control", "create", "current", "delivery", "demand", "demand-side", "deployment", "described", "distributed", "distribution"....
advancedbatteriesbehindcapacitycenturycodecommunicationsconditioningconnectconsumptioncontrolcreatecurrentdeliverydemanddemand-sidedeploymentdescribeddistributeddistributionefficiencyefficientelectricelectricalelectricityenergyevenfinancedfinancingflexibility+44
l residential devices that are noncritical during periods of peak power consumption, and return their function during nonpeak hours. A smart grid includes a variety of operation and energy measures: Advanced metering infrastructure (of which smart meters are a generic name for any utility side device even if it is more capable e.g. a fiber optic router) Smart distribution boards and circuit breakers integrated with home control and demand response (behind the meter from a utility perspective) Load control switches and smart appliances, often financed by efficiency gains on municipal programs (e.g. PACE financing) Renewable energy resources, including the capacity to charge parked (electric vehicle) batteries or larger arrays of batteries recycled from these, or other energy storage. Energy efficient resources Electric surplus distribution by power lines and auto-smart switch Sufficient utility grade fiber broadband to connect and monitor the above, with wireless as a backup. Sufficient spare if "dark" capacity to ensure failover, often leased for revenue. Concerns with smart grid technology mostly focus on smart meters, items enabled by them, and general security issues. Roll-out of smart grid technology also implies a fundamental re-engineering of the electricity services industry, although typical usage of the term is focused on the technical infrastructure. Smart grid policy is organized in Europe as Smart Grid European Technology Platform.
United States The first official definition of Smart Grid was provided by the Energy Independence and Security Act of 2007 (EISA-2007), which was approved by the US Congress in January 2007, and signed to law by President George W. Bush in December 2007. Title XIII of this bill provides a description, with ten characteristics, that can be considered a definition for Smart Grid, as follows:"It is the policy of the United States to support the modernization of the Nation's electricity transmission and distribution system to maintain a reliable and secure electricity infrastructure that can meet future demand growth and to achieve each of the following, which together characterize a Smart Grid: (1) Increased use of digital information and controls technology to improve reliability, security, and efficiency of the electric grid. (2) Dynamic optimization of grid operations and resources, with full cyber-security. (3) Deployment and integration of distributed resources and generation, including renewable resources. (4) Development and incorporation of demand response, demand-side resources, and energy-efficiency resources. (5) Deployment of 'smart' technologies (real-time, automated, interactive technologies that optimize the physical operation of appliances and consumer devices) for metering, communications concerning grid operations and status, and distribution automation. (6) Integration of 'smart' appliances and consumer devices. (7) Deployment and integration of advanced electricity storage and peak-shaving technologies, including plug-in electric and hybrid electric vehicles, and thermal storage air conditioning. (8) Provision to consumers of timely information and control options. (9) Development of standards for communication and interoperability of appliances and equipment connected to the electric grid, including the infrastructure serving the grid.
Early technological innovations Smart grid technologies emerged from earlier attempts at using electronic control, metering, and monitoring. In the 1980s, automatic meter reading was used for monitoring loads from large customers and evolved into the Advanced Metering Infrastructure of the 1990s, whose meters could store how electricity was used at different times of the day. Smart meters add continuous communications so that monitoring can be done in real-time, and can be used as a gateway to demand response-aware devices and "smart sockets" in the home. Early forms of such demand side management technologies were dynamic demand aware devices that passively sensed the load on the grid by monitoring changes in the power supply frequency. Devices such as industrial and domestic air conditioners, refrigerators, and heaters adjusted their duty cycle to avoid activation during times the grid was suffering a peak condition. Beginning in 2000, Italy's Telegestore Project was the first to network large numbers (27 million) of homes using smart meters connected via low bandwidth power line communication. Some experiments used the term broadband over power lines (BPL), while others used wireless technologies such as mesh networking promoted for more reliable connections to disparate devices in the home as well as supporting metering of other utilities such as gas and water. Monitoring and synchronization of wide-area networks were revolutionized in the early 1990s when the Bonneville Power Administration expanded its smart grid research with prototype sensors that are capable of very rapid analysis of anomalies in electricity quality over very large geographic areas. The culmination of this work was the first operational Wide Area Measurement System (WAMS) in 2000. Other countries are rapidly integrating this technology — China started having a comprehensive national WAMS when the past 5-year economic plan was completed in 2012. The earliest deployments of smart grids include the Italian system Telegestore (2005), the mesh network of Austin, Texas (since 2003), and the smart grid in Boulder, Colorado (2008).
Rooftop solar power
Q7366157 QID OVERLAP 0.800
QID OVERLAP: Q7366157 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (36): "analysis", "around", "battery", "building", "buildings", "capacity", "commercial", "components", "distributed", "electrical", "energy", "environment", "equipment", "form", "generation", "industrial", "large", "management", "monitoring", "net"....
analysisaroundbatterybuildingbuildingscapacitycommercialcomponentsdistributedelectricalenergyenvironmentequipmentformgenerationindustriallargemanagementmonitoringnetpanelsphotovoltaicpowerrelyresidentialrooftopscalesmallsolarstations+6
ms are small compared to utility-scale solar ground-mounted photovoltaic power stations with capacities in the megawatt range, hence being a form of distributed generation. A comprehensive life cycle analysis study showed that rooftop solar is better for the environment than utility-scale solar. Most rooftop PV stations are Grid-connected photovoltaic power systems. Rooftop PV systems on residential buildings typically feature a capacity of about 5–20 kilowatts (kW), while those mounted on commercial buildings often reach 100 kilowatts to 1 megawatt (MW). Very large roofs can house industrial scale PV systems in the range of 1–10 MW. As of 2022, around 25 million households rely on rooftop solar power worldwide.
0 kilowatts (kW), while those mounted on commercial buildings often reach 100 kilowatts to 1 megawatt (MW). Very large roofs can house industrial scale PV systems in the range of 1–10 MW. As of 2022, around 25 million households rely on rooftop solar power worldwide. Australia has by far the most rooftop solar capacity per capita. Installation The urban environment provides a large amount of empty rooftop spaces and can inherently avoid the potential land use and environmental concerns.
In the mid-2000s, solar companies used various financing plans for customers such as leases and power purchase agreements. Customers could pay for their solar panels over a span of years, and get help with payments from credits from net metering programs. As of May 2017, installation of a rooftop solar system costs an average of $20,000. In the past, it had been more expensive. Utility Dive wrote, "For most people, adding a solar system on top of other bills and priorities is a luxury" and "rooftop solar companies by and large cater to the wealthier portions of the American population." Most households that get solar arrays are "upper middle-income". The average household salary for solar customers is around $100,000. However, "a surprising number of low-income" customers appeared in a study of income and solar system purchases. "Based on the findings of the study, GTM researchers estimate that the four solar markets include more than 100,000 installations at low-income properties." A report released in June 2018 by the Consumer Energy Alliance that analyzed U.S. solar incentives, showed that a combination of federal, state and local incentives, along with the declining net cost of installing PV systems, has caused a greater usage of rooftop solar across the nation. According to Daily Energy Insider, "In 2016, residential solar PV capacity grew 20 percent over the prior year, the report said.
Photovoltaics
Q192127 QID OVERLAP 0.800
QID OVERLAP: Q192127 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (59): "additional", "applications", "availability", "capacity", "change", "cost", "current", "demand", "direct", "distribution", "earth", "efficiency", "electrical", "electricity", "energy", "expected", "financial", "financing", "gas", "generation"....
additionalapplicationsavailabilitycapacitychangecostcurrentdemanddirectdistributionearthefficiencyelectricalelectricityenergyexpectedfinancialfinancinggasgenerationgrowthhistoryincentivesinstallationinstallationsinternationallandlargelinesmajor+29
major constraints identified include competition for land use. The use of PV as a main source requires energy storage systems or global distribution by high-voltage direct current power lines causing additional costs, and also has a number of other specific disadvantages such as variable power generation which have to be balanced. Production and installation does cause some pollution and greenhouse gas emissions, though only a fraction of the emissions caused by fossil fuels. Photovoltaic systems have long been used in specialized applications as stand-alone installations and grid-connected PV systems have been in use since the 1990s. Photovoltaic modules were first mass-produced in 2000, when the German government funded a one hundred thousand roof program. Decreasing costs has allowed PV to grow as an energy source. This has been partially driven by massive Chinese government investment in developing solar production capacity since 2000, and achieving economies of scale. Improvements in manufacturing technology and efficiency have also led to decreasing costs. Net metering and financial incentives, such as preferential feed-in tariffs for solar-generated electricity, have supported solar PV installations in many countries. Panel prices dropped by a factor of 4 between 2004 and 2011. Module prices dropped by about 90% over the 2010s. In 2022, worldwide installed PV capacity increased to more than 1 terawatt (TW) covering nearly two percent of global electricity demand. After hydro and wind powers, PV is the third renewable energy source in terms of global capacity. In 2022, the International Energy Agency expected a growth by over 1 TW from 2022 to 2027. In some instances, PV has offered the cheapest source of electrical power in regions with a high solar potential, with a bid for pricing as low as 0.015 US$/kWh in Qatar in 2023.
Environmental costs of manufacture Solar photovoltaic power is not entirely "clean energy": production produces greenhouse gas emissions, materials used to build the cells are potentially unsustainable and will run out eventually, the technology uses toxic substances which cause pollution, and there are no viable technologies for recycling solar waste. Data required to investigate their impact are sometimes affected by a rather large amount of uncertainty. The values of human labor and water consumption, for example, are not precisely assessed due to the lack of systematic and accurate analyses in the scientific literature. One difficulty in determining effects due to PV is to determine if the wastes are released to the air, water, or soil during the manufacturing phase. Life-cycle assessments, which look at all different environment effects ranging from global warming potential, pollution, water depletion and others, are unavailable for PV. Instead, studies have tried to estimate the impact and potential impact of various types of PV, but these estimates are usually restricted to simply assessing energy costs of the manufacture and/or transport, because these are new technologies and the total environmental impact of their components and disposal methods are unknown, even for commercially available first generation solar cells, let alone experimental prototypes with no commercial viability. Thus, estimates of the environmental impact of PV have focused on carbon dioxide equivalents per kWh or energy pay-back time (EPBT). The EPBT describes the timespan a PV system needs to operate in order to generate the same amount of energy that was used for its manufacture. Another study includes transport energy costs in the EPBT. The EPBT has also been defined completely differently as "the time needed to compensate for the total renewable- and non-renewable primary energy required during the life cycle of a PV system" in another study, which also included installation costs. This energy amortization, given in years, is also referred to as break-even energy payback time. The lower the EPBT, the lower the environmental cost of solar power. The EPBT depends vastly on the location where the PV system is installed (e.g. the amount of sunlight available and the efficiency of the electrical grid) and on the type of system, namely the system's components. A 2015 review of EPBT estimates of first and second-generation PV suggested that there was greater variation in embedded energy than in efficiency of the cells implying that it was mainly the embedded energy that needs to reduce to have a greater reduction in EPBT. In general, the most important component of solar panels, which accounts for much of the energy use and greenhouse gas emissions, is the refining of the polysilicon. As to how much percentage of the EPBT this silicon depends on the type of system. A fully autarkic system requires additional components ('Balance of System', the power inverters, storage, etc.) which significantly increase the energy cost of manufacture, but in a simple rooftop system, some 90% of the energy cost is from silicon, with the remainder coming from the inverters and module frame. The EPBT relates closely to the concepts of net energy gain (NEG) and energy returned on energy invested (EROI). They are both used in energy economics and refer to the difference between the energy expended to harvest an energy source and the amount of energy gained from that harvest. The NEG and EROI also take the operating lifetime of a PV system into account and a working life of 25 to 30 years is typically assumed.
The levelised cost of electricity (LCOE) is the cost per kWh based on the costs distributed over the project lifetime, and is thought to be a better metric for calculating viability than price per wattage. LCOEs vary dramatically depending on the location. The LCOE can be considered the minimum price customers will have to pay the utility company in order for it to break even on the investment in a new power station. Grid parity is roughly achieved when the LCOE falls to a similar price as conventional local grid prices, although in actuality the calculations are not directly comparable. Large industrial PV installations had reached grid parity in California in 2011. Grid parity for rooftop systems was still believed to be much farther away at this time. Many LCOE calculations are not thought to be accurate, and a large amount of assumptions are required. Module prices may drop further, and the LCOE for solar may correspondingly drop in the future. Because energy demands rise and fall over the course of the day, and solar power is limited by the fact that the sun sets, solar power companies must also factor in the additional costs of supplying a more stable alternative energy supplies to the grid in order to stabilize the system, or storing the energy. These costs are not factored into LCOE calculations, nor are special subsidies or premiums that may make buying solar power more attractive. The unreliability and temporal variation in generation of solar and wind power is a major problem. Too much of these volatile power sources can cause instability of the entire grid. As of 2017 power-purchase agreement prices for solar farms below $0.05/kWh are common in the United States, and the lowest bids in some Persian Gulf countries were about $0.03/kWh.
I
Q6048868 QID OVERLAP 0.800
QID OVERLAP: Q6048868 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (31): "apprenticeship", "approximately", "association", "conducts", "construction", "contractors", "cost", "data", "deliver", "electrical", "electricians", "fields", "ibew", "inside", "install", "installers", "international", "joint", "labor", "lineworkers"....
apprenticeshipapproximatelyassociationconductsconstructioncontractorscostdatadeliverelectricalelectriciansfieldsibewinsideinstallinstallersinternationaljointlaborlineworkersnationalnetworksprogramspublicrelatedrepresentstrainingunionutilitieswork+1
ther employees of public utilities. The union also represents some workers in the computer, telecommunications, and broadcasting industries, and other fields related to electrical work. IBEW conducts apprenticeship programs for electricians, linemen, and VDV (voice, data, and video) installers (who install low-voltage wiring such as computer networks), in conjunction with the National Electrical Contractors Association, under the auspices of the National Joint Apprenticeship and Training Committee, which allows apprentices to "earn while you learn." In Canadian jurisdictions, the IBEW does not deliver apprenticeship training, but does conduct supplemental training for government trained apprentices and journeypersons, often at little or no cost to its members.
, data, and video) installers (who install low-voltage wiring such as computer networks), in conjunction with the National Electrical Contractors Association, under the auspices of the National Joint Apprenticeship and Training Committee, which allows apprentices to "earn while you learn." In Canadian jurisdictions, the IBEW does not deliver apprenticeship training, but does conduct supplemental training for government trained apprentices and journeypersons, often at little or no cost to its members.
The union went through lean times in its early years, then struggled through six years of schism during the 1910s, when two rival groups each claimed to be the duly elected leaders of the union. In 1919, as many employers were trying to drive unions out of the workplace through a national open shop campaign, the union agreed to form the Council on Industrial Relations, a bipartite body made up of equal numbers of management and union representatives with the power to resolve any collective bargaining disputes. That body still functions today, and has largely resolved strikes in the IBEW's jurisdiction in the construction industry. In September 1941, the National Apprenticeship Standards for the Electrical Construction Industry, a joint effort among the IBEW, the National Electrical Contractors Association, and the Federal Committee on Apprenticeship, were established. The IBEW added additional training programs and courses as needed to keep up with new technologies, including an industrial electronics course in 1959 and an industrial nuclear power course in 1966. The IBEW's membership peaked in 1972 at approximately 1 million members. The membership numbers were in a slow decline throughout the rest of the 1970s and the 1980s, but have since stabilized. One major loss of membership for the IBEW came about because of the court-ordered breakup at the end of 1982 of AT&T, where the IBEW was heavily organized among both telephone workers and in AT&T's manufacturing facilities. In 1988, 30 percent of American construction work was unionized while the IBEW had 40 percent of electrical-related construction.
United States Department of Energy
Q217810 QID OVERLAP 0.800
QID OVERLAP: Q217810 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (23): "additional", "building", "conservation", "current", "department", "development", "directly", "directs", "energy", "federal", "laboratories", "national", "originating", "physical", "policy", "position", "power", "production", "program", "project"....
additionalbuildingconservationcurrentdepartmentdevelopmentdirectlydirectsenergyfederallaboratoriesnationaloriginatingphysicalpolicypositionpowerproductionprogramprojectresearchservedsystem
t Secretary of energy is Chris Wright, who has served in the position since February 2025. The department's headquarters are in southwestern Washington, D.C., in the James V. Forrestal Building, with additional offices in Germantown, Maryland. History Formation and consolidation In 1942, during World War II, the United States started the Manhattan Project to develop the atomic bomb under the U.S. Army Corps of Engineers. After the war, in 1946, the Atomic Energy Commission (AEC) was created to control the future of the project. The Atomic Energy Act of 1946 also created the framework for the first National Laboratories. Among other nuclear projects, the AEC produced fabricated uranium fuel cores at locations such as Fernald Feed Materials Production Center in Cincinnati, Ohio. The Energy Reorganization Act of 1974 split the responsibilities of the AEC into the new Nuclear Regulatory Commission, which was charged with regulating the nuclear power industry, and the Energy Research and Development Administration, which was assigned to manage the nuclear weapon, naval reactor, and energy development programs. The 1973 oil crisis called attention to the need to consolidate energy policy. In 1977, President Jimmy Carter signed into law the Department of Energy Organization Act, which established the Department of Energy. The new agency, which began operations on October 1, 1977, consolidated the Federal Energy Administration, the Energy Research and Development Administration, the Federal Power Commission, and programs of various other agencies. Former Secretary of Defense James Schlesinger, who served under Presidents Nixon and Ford during the Vietnam War, was appointed as the first secretary. President Jimmy Carter proposed the Department of Energy with the goal of promoting energy conservation and energy independence, and developing alternative sources of energy to reduce the use of fossil fuels. With the future of international energy uncertain for America, Carter acted quickly to have the department come into action in the first year of his presidency. This was an extremely important issue of the time as the oil crisis was causing shortages and inflation. With the Three Mile Island accident, Carter was able to intervene with the help of the department.
Budget On May 7, 2009 President Barack Obama unveiled a $26.4 billion budget request for DOE for fiscal year (FY) 2010, including $2.3 billion for the DOE Office of Energy Efficiency and Renewable Energy (EERE). That budget aimed to substantially expand the use of renewable energy sources while improving energy transmission infrastructure. It also proposed significant investments in hybrids and plug-in hybrids, smart grid technologies, and scientific research and innovation. As part of the $789 billion economic stimulus package in the American Recovery and Reinvestment Act of 2009, Congress provided Energy with an additional $38.3 billion for fiscal years 2009 and 2010, adding about 75 percent to Energy's annual budgets. Most of the stimulus spending was in the form of grants and contracts.
Loan guarantee program of 2005 In 2001, American Solar Challenge was sponsored by the DOE and the National Renewable Energy Laboratory. After the 2005 race, the DOE discontinued its sponsorship. Title XVII of Energy Policy Act of 2005 authorizes the DOE to issue loan guarantees to eligible projects that "avoid, reduce, or sequester air pollutants or anthropogenic emissions of greenhouse gases" and "employ new or significantly improved technologies as compared to technologies in service in the United States at the time the guarantee is issued". In loan guarantees, a conditional commitment requires to meet an equity commitment, as well as other conditions, before the loan guarantee is completed. In September 2008, the DOE, the Nuclear Threat Initiative (NTI), the Institute of Nuclear Materials Management (INMM), and the International Atomic Energy Agency (IAEA) partnered to develop and launch the World Institute for Nuclear Security (WINS), an international non-governmental organization designed to provide a forum to share best practices in strengthening the security and safety of nuclear and radioactive materials and facilities. In December 2024, the Loan Programs Office announced it would extend the largest loan ever sanctioned – a $15 billion (US) low-interest loan to support the modernization of Pacific Gas & Electric’s hydroelectric power structure, enhance transmission lines critical for renewable energy integration, data center operations, and the growing fleet of electric vehicles. Initially requested as a $30 billion (US) loan, the amount was reduced due to concerns over the company’s repayment capacity. In June 2026, the DOE announced $17.5 billion in loans to speed the building of 10 new large nuclear reactors across the U.S. The reactors will use Westinghouse’s AP1000 design, each capable of generating 1.1 GW of electricity, with the combined output from all reactors projected to power nearly 10 million American households.
High-voltage direct current
Q370607 QID OVERLAP 0.800
QID OVERLAP: Q370607 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (27): "changes", "commercial", "controlled", "current", "different", "direct", "economy", "electric", "form", "grid", "independently", "installations", "lines", "load", "network", "networks", "power", "rapid", "require", "source"....
changescommercialcontrolledcurrentdifferentdirecteconomyelectricformgridindependentlyinstallationslinesloadnetworknetworkspowerrapidrequiresourcesystemsystemstechnologytransfertransmissionunionuses
re not synchronized. Since the power flow through an HVDC link can be controlled independently of the phase angle between source and load, it can stabilize a network against disturbances due to rapid changes in power. HVDC also allows the transfer of power between grid systems running at different frequencies, such as 50 and 60 Hz. This improves the stability and economy of each grid, by allowing the exchange of power between previously incompatible networks. The modern form of HVDC transmission uses technology developed extensively in the 1930s in Sweden (ASEA) and in Germany. Early commercial installations included one in the Soviet Union in 1951 between Moscow and Kashira, and a 100 kV, 20 MW system between Gotland and mainland Sweden in 1954.
Since the energy lost as heat in the wires is directly proportional to the square of the current ( energy lost as heat = current 2 ⋅ resistance ⋅ time ) , {\textstyle ({\text{energy lost as heat}}={\text{current}}^{2}\cdot {\text{resistance}}\cdot {\text{time}}),} using half the current at double the voltage reduces the line losses by a factor of 4. While energy lost in transmission can also be reduced by decreasing the resistance by increasing the conductor size, larger conductors are heavier and more expensive. High voltage cannot readily be used for lighting or motors, so transmission-level voltages must be reduced for end-use equipment. Transformers are used to change the voltage levels in alternating current (AC) transmission circuits, but cannot pass DC current. Transformers make AC voltage changes practical, and AC generators are more efficient than those using DC.
Cable systems Long undersea or underground high-voltage cables have a high electrical capacitance compared with overhead transmission lines since the live conductors within the cable are surrounded by a relatively thin layer of insulation (the dielectric), and a metal sheath. The geometry is that of a long coaxial capacitor. The total capacitance increases with the length of the cable. This capacitance is in a parallel circuit with the load. Where alternating current is used for cable transmission, additional current must flow in the cable to charge this cable capacitance. Another way to look at this is to realize, that such capacitance causes a phase shift between voltage and current, and thus decrease of the transmitted power, which is a vector product of voltage and current. Additional energy losses also occur as a result of dielectric losses in the cable insulation. For a sufficiently long AC cable, the entire current-carrying ability of the conductor would be needed to supply the charging current alone. This cable capacitance issue limits the length and power-carrying ability of AC power cables. However, if direct current is used, the cable capacitance is charged only when the cable is first energized or if the voltage level changes; there is no additional current required. DC powered cables are limited only by their temperature rise and Ohm's law.
Electrical grid
Q1096907 QID OVERLAP 0.800
QID OVERLAP: Q1096907 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (33): "become", "billion", "built", "complex", "connected", "connecting", "consumers", "current", "customers", "delivery", "distribution", "efficient", "electric", "electrical", "electricity", "electrification", "energy", "grid", "large", "markets"....
becomebillionbuiltcomplexconnectedconnectingconsumerscurrentcustomersdeliverydistributionefficientelectricelectricalelectricityelectrificationenergygridlargemarketsneedneedednetworkoperatepopulationpowerrisksmallstationssubstations+3
rical grids can be prone to malicious intrusion or attack; thus, there is a need for electric grid security. Also as electric grids modernize and introduce computer technology, cyber threats start to become a security risk. Particular concerns relate to the more complex computer systems needed to manage grids. Types (grouped by size) Microgrid A microgrid is a local grid that is usually part of the regional wide-area synchronous grid, but which can disconnect and operate autonomously. It might do this in times when the main grid is affected by outages. This is known as islanding, and it might run indefinitely on its own resources. Compared to larger grids, microgrids typically use a lower voltage distribution network and distributed generators.
A wide area synchronous grid (also called an "interconnection" in North America) is an electrical grid at a regional scale or greater that operates at a synchronized frequency and is electrically tied together during normal system conditions. For example, there are four major interconnections in North America (the Western Interconnection, the Eastern Interconnection, the Quebec Interconnection and the Texas Interconnection). In Europe, one large grid connects most of Western Europe. These are also known as synchronous zones, the largest of which is the synchronous grid of Continental Europe (ENTSO-E) with 667 gigawatts (GW) of generation, and the widest region served being that of the IPS/UPS system serving countries of the former Soviet Union. Synchronous grids with ample capacity facilitate electricity market trading across wide areas. In the ENTSO-E in 2008, over 350,000 megawatt hours were sold per day on the European Energy Exchange (EEX). Each of the interconnects in North America are run at a nominal 60 Hz, while those of Europe run at 50 Hz. Neighbouring interconnections with the same frequency and standards can be synchronized and directly connected to form a larger interconnection, or they may share power without synchronization via high-voltage direct current power transmission lines (DC ties), or with variable-frequency transformers (VFTs), which permit a controlled flow of energy while also functionally isolating the independent AC frequencies of each side. The benefits of synchronous zones include pooling of generation, resulting in lower generation costs; pooling of load, resulting in significant equalizing effects; common provisioning of reserves, resulting in cheaper primary and secondary reserve power costs; opening of the market, resulting in possibility of long-term contracts and short term power exchanges; and mutual assistance in the event of disturbances. One disadvantage of a wide-area synchronous grid is that problems in one part can have repercussions across the whole grid. For example, in 2018, Kosovo used more power than it generated due to a dispute with Serbia, leading to the phase across the whole synchronous grid of Continental Europe lagging behind what it should have been. The frequency dropped to 49.996 Hz. This caused certain kinds of clocks to become six minutes slow. Super grid A super grid or supergrid is a wide-area transmission network that is intended to make possible the trade of high volumes of electricity across great distances. It is sometimes also referred to as a mega grid. Super grids can support a global energy transition by smoothing local fluctuations of wind energy and solar energy. In this context, they are considered as a key technology to mitigate global warming. Super grids typically use high-voltage direct current (HVDC) to transmit electricity long distances. The latest generation of HVDC power lines can transmit energy with losses of only 1.6% per 1000 km. Electric utilities between regions are many times interconnected for improved economy and reliability. Electrical interconnectors allow for economies of scale, allowing energy to be purchased from large, efficient sources. Utilities can draw power from generator reserves from a different region to ensure continuing, reliable power and diversify their loads. Interconnection also allows regions to have access to cheap bulk energy by receiving power from different sources. For example, one region may be producing cheap hydro power during high water seasons, but in low water seasons, another area may be producing cheaper power through wind, allowing both regions to access cheaper energy sources from one another during different times of the year. Neighboring utilities also help others to maintain the overall system frequency and also help manage tie transfers between utility regions. Electricity Interconnection Level (EIL) of a grid is the ratio of the total interconnector power to the grid divided by the installed production capacity of the grid.
n of AC power throughout the area, connecting the electricity generators with consumers. Grids can enable more efficient electricity markets. Although electrical grids are widespread, as of 2016, 1.4 billion people worldwide were not connected to an electricity grid. As electrification increases, the number of people with access to grid electricity is growing. About 840 million people (mostly in Africa), which is ca. 11% of the World's population, had no access to grid electricity in 2017, down from 1.2 billion in 2010. Electrical grids can be prone to malicious intrusion or attack; thus, there is a need for electric grid security. Also as electric grids modernize and introduce computer technology, cyber threats start to become a security risk.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (34): "approved", "around", "assessment", "conducts", "conservation", "department", "education", "energy", "engineers", "environmental", "federal", "financial", "independent", "information", "january", "laboratories", "legal", "level", "local", "monitoring"....
approvedaroundassessmentconductsconservationdepartmenteducationenergyengineersenvironmentalfederalfinancialindependentinformationjanuarylaboratorieslegallevellocalmonitoringnationaloperationpermittingprogramsproposedprotectionpublicregionalresearchresponsibility+4
xon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Solar inverter
Q129316 QID OVERLAP 0.800
QID OVERLAP: Q129316 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (18): "commercial", "critical", "current", "direct", "electrical", "equipment", "functions", "grid", "local", "network", "off-grid", "ordinary", "photovoltaic", "power", "protection", "solar", "system", "utility".
commercialcriticalcurrentdirectelectricalequipmentfunctionsgridlocalnetworkoff-gridordinaryphotovoltaicpowerprotectionsolarsystemutility
(PV) inverter is a type of power inverter which converts the variable direct current (DC) output of a photovoltaic solar panel into a utility frequency alternating current (AC) that can be fed into a commercial electrical grid or used by a local, off-grid electrical network. It is a critical balance of system (BOS)–component in a photovoltaic system, allowing the use of ordinary AC-powered equipment.
Disadvantages The primary disadvantage of the three-phase inverter concept is that only sites with three-phase power can take advantage of these systems. Three-phase is easily available at utility-scale and commercial sites, and it was to these markets that the systems were aimed. However, the main advantages of the microinverter concept involve issues of shading and panel orientation, and in the case of large systems, these are easily addressed by simply moving the panels around. The benefits of the three-phase micro are very limited compared to the residential case, with limited space to work in. As of 2014, observers believed that three-phase micros had not yet managed to reach the price point where their advantages appeared worthwhile.
Three-phase microinverters Efficient conversion of DC power to AC requires the inverter to store energy from the panel while the grid's AC voltage is near zero, and then release it again when it rises. This requires considerable amounts of energy storage in a small package. The lowest-cost option for the required amount of storage is the electrolytic capacitor, but these have relatively short lifetimes, normally measured in years, and those lifetimes are shorter when operated hot, like on a rooftop solar panel. This has led to considerable development effort on the part of microinverter developers, who have introduced a variety of conversion topologies with lowered storage requirements, some using the much less capable but far longer lived thin film capacitors where possible. Three-phase electric power represents another solution to the problem. In a three-phase circuit, the power does not vary between (say) +120 to -120 V between two lines, but instead varies between 60 and +120 or -60 and -120 V, and the periods of variation are much shorter. Inverters designed to operate on three-phase systems require much less storage. A three-phase microinverter, using zero-voltage switching, can also offer higher circuit density and lower cost components, while improving conversion efficiency to over 98%, better than the typical one-phase peak around 96%. Three-phase systems, however, are generally only seen in industrial and commercial settings. These markets normally install larger arrays, where price sensitivity is the highest.
Electric power transmission
Q200928 QID OVERLAP 0.800
QID OVERLAP: Q200928 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (40): "bulk", "connects", "consumers", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "efficiency", "electric", "electrical", "electricity", "energy", "even", "form", "grid", "increase"....
bulkconnectsconsumerscurrentcustomersdeliverydirectdirectlydistinctdistributioneasternefficiencyelectricelectricalelectricityenergyevenformgridincreaseinterconnectionlevellineslocalmajormarketmovementnetworknorthowned+10
Electric power transmission is the bulk movement of electrical energy from a generating site, such as a power plant, to an electrical substation. A long conductor used to facilitate such movement is called a transmission line. The interconnected transmission lines form a transmission network. In the power industry, electric power transmission is distinct from the local wiring between high-voltage substations and customers, which is typically referred to as electric power distribution, even though power distribution is semantically a type of power transmission in common parlance. The combined transmission and distribution network is part of electricity delivery, known as the electrical grid. Transmission lines transmit either alternating current (AC) or direct current (DC). To increase the efficiency of long-distance electric power transmission, the voltage is often increased for transmission, then reduced for local distribution. This is because higher voltages corresponds to lower currents and lower losses caused by such currents. The AC voltage level is often changed with transformers. A wide area synchronous grid, known as an interconnection in North America, directly connects generators delivering AC power with the same relative frequency to many consumers. North America has four major interconnections: Western, Eastern, Quebec and Texas.
The 20th century's rapid industrialization made electrical transmission lines and grids critical infrastructure. Interconnection of local generation plants and small distribution networks was spurred by World War I, when large electrical generating plants were built by governments to power munitions factories. Bulk transmission These networks use components such as power lines, cables, circuit breakers, switches and transformers. The transmission network is usually administered on a regional basis by an entity such as a regional transmission organization or transmission system operator. Transmission efficiency is improved at higher voltage and lower current. The reduced current reduces heating losses. Joule's first law states that energy losses are proportional to the square of the current. Thus, reducing the current by a factor of two lowers the energy lost to conductor resistance by a factor of four for any given size of conductor. The optimum size of a conductor for a given voltage and current can be estimated by Kelvin's law for conductor size, which states that size is optimal when the annual cost of energy wasted in resistance is equal to the annual capital charges of providing the conductor. At times of lower interest rates and low commodity costs, Kelvin's law indicates that thicker wires are optimal. Otherwise, thinner conductors are indicated. Since power lines are designed for long-term use, Kelvin's law is used in conjunction with long-term estimates of the price of copper and aluminum as well as interest rates. Higher voltage is achieved in AC circuits by using a step-up transformer. High-voltage direct current (HVDC) systems require relatively costly conversion equipment that may be economically justified for particular projects such as submarine cables and longer distance high capacity point-to-point transmission. HVDC is necessary for sending energy between unsynchronized grids. A transmission grid is a network of power stations, transmission lines, and substations. Energy is usually transmitted within a grid with three-phase AC. Single-phase AC is used only for distribution to end users since it is not usable for large polyphase induction motors. In the 19th century, two-phase transmission was used but required either four wires or three wires with unequal currents.
lower currents and lower losses caused by such currents. The AC voltage level is often changed with transformers. A wide area synchronous grid, known as an interconnection in North America, directly connects generators delivering AC power with the same relative frequency to many consumers. North America has four major interconnections: Western, Eastern, Quebec and Texas.
Hells Canyon Dam
Q5709011 QID OVERLAP 0.800
QID OVERLAP: Q5709011 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (29): "boise", "built", "canyon", "capacity", "complex", "contains", "contractor", "dam", "energy", "falls", "final", "generation", "hydroelectric", "idaho", "information", "largest", "level", "megawatts", "naturally", "operated"....
boisebuiltcanyoncapacitycomplexcontainscontractordamenergyfallsfinalgenerationhydroelectricidahoinformationlargestlevelmegawattsnaturallyoperatedownedpowerprivatelyprojectreservoirriversnakeunitswestern
River is the largest privately owned hydroelectric power complex in the nation, according to the US Energy Information Administration. The contractor for the Hells Canyon Dam was Morrison-Knudsen of Boise. The Hells Canyon Dam powerhouse contains three generating units, with a total nameplate capacity of 391 megawatts (MW).
ir; its spillway elevation is 1,680 feet (512 m) above sea level. It is the third and final hydroelectric dam of the Hells Canyon Project, which includes Brownlee Dam (1959) and Oxbow Dam (1961), all built and operated by Idaho Power Company. The Hells Canyon Complex on the Snake River is the largest privately owned hydroelectric power complex in the nation, according to the US Energy Information Administration. The contractor for the Hells Canyon Dam was Morrison-Knudsen of Boise. The Hells Canyon Dam powerhouse contains three generating units, with a total nameplate capacity of 391 megawatts (MW).
s to a stretch of the Snake River drainage basin from Hells Canyon Dam up to Shoshone Falls, which naturally prevents any upstream fish passage to the upper Snake River basin. High dam proposal As built, Hells Canyon Dam is significantly lower than it was originally proposed in the 1940s, with three dams (Hells Canyon, Brownlee Dam and Oxbow Dam) taking the place of a single 710-foot (220 m) high dam. As proposed by the U.S. Army Corps of Engineers, the Hells Canyon High Dam would have been a straight-profile concrete gravity dam with two gate-controlled tunnel spillways, one in each abutment. The proposed reservoir was planned to have a capacity of 4,050,000 acre-feet (5.00 km3) with an area of 23,500 acres (36.7 mi2; 95 km2). The reservoir was to extend 89 miles (143 km) upstream. The power plant was to be capable of generating 850 MW using ten units. The project included provisions for fish hatcheries, with the intention of maintaining salmon runs. Project cost was estimated at $342,076,000. The proposals for a publicly built high dam became a big political issue in many Western states. Both of Oregon's senators Wayne Morse and Richard L. Neuberger proposed a public dam, but were blocked. Many Western moderately pro-civil rights senators supported Southern Democrats in their efforts to water down the 1957 Civil Rights Act in return for southern support for a publicly built high dam.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (18): "ada", "annual", "boise", "capital", "counties", "downtown", "home", "idaho", "level", "locally", "major", "metropolitan", "north", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownhomeidaholevellocallymajormetropolitannorthpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Building code
Q2333573 QID OVERLAP 0.800
QID OVERLAP: Q2333573 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (48): "adopted", "approved", "authority", "becomes", "building", "buildings", "case", "charges", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "district", "electrical", "engineers", "environmental"....
adoptedapprovedauthoritybecomesbuildingbuildingscasechargescodecodescomplianceconstructioncontroldepartmentsdesigndevelopersdistrictelectricalengineersenvironmentalestatefacilityintendedinternationaljurisdictionlawlevellocalmanagersmaterials+18
velopers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Grid energy storage
Q1832610 QID OVERLAP 0.800
QID OVERLAP: Q1832610 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (42): "air", "another", "batteries", "becomes", "behind-the-meter", "beyond", "capacity", "change", "connected", "cost", "demand", "economic", "economics", "electrical", "electricity", "energy", "experience", "flexibility", "form", "green"....
airanotherbatteriesbecomesbehind-the-meterbeyondcapacitychangeconnectedcostdemandeconomiceconomicselectricalelectricityenergyexperienceflexibilityformgreengridhourslargelargestloadmakingmanagementneedneededpower+12
third. Lithium-ion batteries are well suited for short-duration storage (under 8 hours), due to their lower cost and sensitivity to degradation at high states of charge. Flow batteries and compressed air energy storage may provide storage for medium-duration. Two forms of storage are suited for long-duration storage: green hydrogen, produced via electrolysis and thermal energy storage. Energy storage is one option to making grids more flexible. Another solution is the use of more dispatchable power plants that can change their output rapidly, for instance peaking power plants to fill in supply gaps. Demand response can shift load to other times and interconnections between regions can balance out fluctuations in renewables production. The price of storage technologies typically goes down with experience. For instance, lithium-ion batteries have been getting some 20% cheaper for each doubling of worldwide capacity. Systems with under 40% variable renewables need only short-term storage. At 80%, medium-duration storage becomes essential and beyond 90%, long-duration storage does too.
In redox flow batteries, energy is stored in liquids, which are placed in two separate tanks. When charging or discharging, the liquids are pumped into a cell with the electrodes. The amount of energy stored (as set by the size of the tanks) can be adjusted separately from the power output (as set by the speed of the pumps). Flow batteries have the advantages of low capital cost for charge-discharge duration over 4 h, and of long durability (many years). Flow batteries are inferior to lithium-ion batteries in terms of energy efficiency, averaging efficiencies between 60% and 75%. Vanadium redox batteries is most commercially advanced type of flow battery, with roughly 40 companies making them as of 2022. Sodium-ion batteries are a possible alternative to lithium-ion batteries, as they are less flammable, and use cheaper and less critical materials. They have a lower energy density, and possibly a shorter lifespan. If produced at the same scale as lithium-ion batteries, they may become 20% to 30% cheaper. Iron-air batteries may be suitable for even longer duration storage than flow batteries (weeks), but the technology is not yet mature. Electrical Storage in supercapacitors works well for applications where a lot of power is needed for short amount of time. In the power grid, they are therefore mostly used in short-term frequency regulation.
Alternative methods that use gravity include storing energy by moving large solid masses upward against gravity. This can be achieved inside old mine shafts or in specially constructed towers where heavy weights are winched up to store energy and allowed a controlled descent to release it. Compressed air Compressed air energy storage (CAES) stores electricity by compressing air. The compressed air is typically stored in large underground caverns. The expanding air can be used to drive turbines, converting the energy back into electricity. As air cools when expanding, some heat needs to be added in this stage to prevent freezing. This can be provided by a low-carbon source, or in the case of advanced CAES, by reusing the heat that is released when air is compressed. As of 2023, there are three advanced CAES projects in operation in China.
Battery energy storage system
Q810924 QID OVERLAP 0.800
QID OVERLAP: Q810924 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (43): "around", "batteries", "battery", "capacity", "connection", "control", "cost", "customer", "deliver", "demand", "electric", "electrical", "electricity", "energy", "even", "extending", "facility", "form", "full", "gas"....
aroundbatteriesbatterycapacityconnectioncontrolcostcustomerdeliverdemandelectricelectricalelectricityenergyevenextendingfacilityformfullgasgridhoursinsidelargelargestloadoperatingpeakpowerprice+13
By 2025, global power capacity was 267 GW with 610 GWh energy capacity. As of 2019, battery power storage is typically cheaper than open cycle gas turbine power for use up to two hours, and there was around 365 GWh of battery storage deployed worldwide, growing rapidly. Levelized cost of storage (LCOS) has fallen rapidly. From 2014 to 2024, cost halving time was 4.1 years.
Lithium-ion batteries offer a long lifespan with minimal maintenance, high energy density, and low self-discharge, which makes them ideal for modern utility-scale BESS applications. A drawback of some types of lithium-ion batteries is fire safety, mostly ones containing cobalt. The number of BESS incidents has remained around 10–20 per year (mostly within the first 2–3 years of age), despite the large increase in number and size of BESS. Thus failure rate has decreased. Failures occurred mostly in controls and balance of system, while 11% occurred in cells. Examples of BESS fire accidents include individual modules in 23 battery farms in South Korea in 2017 to 2019, a Tesla Megapack in Geelong, the fire and subsequent explosion of a battery module in Arizona, and the cooling liquid short circuiting incidents and fire at the Moss Landing LG battery. This resulted in more research in recent years for mitigation measures for fire safety. By 2024, the lithium iron phosphate (LFP) battery has become another significant type for large storages due to the high availability of its components, longer lifetime and higher safety compared to nickel-based Li-ion chemistries. An LFP-based energy storage system that was installed in Paiyun Lodge on Mt.
By 2025, global grid battery power capacity was 267 GW with 610 GWh energy capacity, compared to the other major form of grid storage, pumped-storage hydroelectricity with 200 GW power and 9000 GWh energy storage worldwide as of 2025 according to International Hydropower Association. The battery market had thus surpassed the power generation capacity of pumped-storage, but remained far smaller in terms of energy capacity. Relative to 2010, batteries and photovoltaics have followed roughly the same downward price curve due to experience curve effects. Cells are the major cost component, costing 30-40% of a full system. Batteries' rapid increase occurred as price drops, with over 100 GW added (mostly LFP) in 2025, up from 10 GW in 2021. In 2025, solar power added was down to 6 times bigger than battery power added, as battery increased much faster than solar. Average world system price was around $120/kWh in 2025. The amount of batteries and their associated operational money flow became an investible asset class by 2026, pooling several separate batteries into centrally controlled portfolios. This allows small developers with low funds to partner with groups of institutional investors without practical knowledge of the electricity business, to the benefit of both. This is a contrast to the usual single energy company approach of developing, owning and operating an electricity facility. By mid-2025, China passed 100 GW batteries (164 GW total storage) and added capacity market payments. As of May 2025, China’s cumulative BESS installations were reported at 106.9 GW and 240.3 GWh, with global battery storage deployment of nearly 9 GWh in April 2025. At the end of 2024, China had 62 GW / 141 GWh of battery power stations. In 2020, China added 1,557 MW to its battery storage capacity, while storage facilities for photovoltaics projects accounting for 27% of the capacity, to the total 3,269 MW of electrochemical energy storage capacity. The United States installed 57.6 GWh in 2025, and 12.3 GW / 37.1 GWh of batteries in 2024. USA had 70 GWh production capacity in 2025, roughly corresponding to domestic market size. In 2022, US capacity doubled to 9 GW / 25 GWh. At the end of 2021, the capacity grew to 4,588 MW. The 2021 price of a 60 MW / 240 MWh (4-hour) battery installation in the United States was US$379/usable kWh, or US$292/nameplate kWh, a 13% drop from 2020. In 2010, the United States had 59 MW of battery storage capacity from 7 battery power plants. This increased to 49 plants comprising 351 MW of capacity in 2015. In 2018, the capacity was 869 MW from 125 plants, capable of storing a maximum of 1,236 MWh of generated electricity. By the end of 2020, the battery storage capacity reached 1,756 MW. The US market for storage power plants in 2015 increased by 243% compared to 2014. In June 2024 the capacity was 4.6 GW of power and 5.9 GWh of energy in the United Kingdom. In 2022, UK capacity grew by 800 MWh, ending at 2.4 GW / 2.6 GWh. As of May 2021, 1.3 GW of battery storage was operating, with 16 GW of projects in the pipeline potentially deployable over the next few years. As of the end of 2024, Europe had reached 61 GWh of installed battery energy storage capacity, after adding 21 GWh that year. Germany and Italy each contributed approximately 6 GWh to this growth. The average installation cost during 2024 ranged between €300 and €400 per kilowatt-hour. By comparison, Europe deployed 1.9 GW of new battery capacity in 2022. Developments in Germany are closely monitored by RWTH Aachen University site battery-charts.de, reporting in September 2025 15 GW and 22 GWh mostly in over 2 million home-based systems, while 1.84 Mio. registered Battery Electric Vehicles (BEVs) in Germany have an estimated energy capacity of over 115 GWh. Japan’s energy sector has also undergone significant growth in renewable energy capacity. expanding by over 30% within five years, which has contributed to a sharp increase in demand for battery energy storage systems (BESS). More than half of the 2.4 GW of BESS capacity awarded in recent long-term low-carbon power auctions was allocated to foreign-owned companies or consortia. Projects approved in 2024 alone comprise more than 1.37 GW of power capacity and over 6.7 GWh of energy capacity. The country’s Long-Term Decarbonization Power Source Auction supports BESS deployment by guaranteeing fixed cost recovery over a 20-year period. However, constraints such as limited price volatility and a price floor in Japan’s power market may limit investment returns for storage operators, signaling the need for further regulatory reform. Worldwide in 2024, suppliers CRRC had 8% market share, Sungrow 14%, and Tesla Energy 15%. Some developers are also utilizing retired electric vehicle batteries to build second-life storage systems, with costs potentially 50% lower than those of new battery installations. Nonetheless, due to the declining cost of new batteries, buyers of second-life systems may only be willing to pay around 10% of the original cost. In 2024, a 53 MWh battery storage facility built from approximately 900 used electric vehicle batteries was commissioned in Texas. The major 2025 Iberian Peninsula blackout severed the Iberian grid from the rest of Europe on 28 April and then collapsed to a complete blackout in just five seconds, then caused some deaths plus economic losses estimated at up to €4.5 billion. The importance of system resilience has become increasingly prominent in Spain. Battery Energy Storage Systems were at a very low level at around 20 MW, but are now regarded as a key pillar of the Spanish energy transition. Major utilities such as Iberdrola and Solaria are now actively developing hybrid solar-plus-storage projects to mitigate the impact of solar overproduction and declining market prices. Solaria alone has launched eight new BESS installations in Castilla y León and Castilla-La Mancha.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (15): "ada", "behind", "boise", "capital", "district", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "northwest", "population", "private", "roads".
adabehindboisecapitaldistricthomeidahojurisdictionlargestlocalmetropolitannorthwestpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "university", "west", "western".
boisecanyoncollegehomeidahomeridianmetropolitannampanorthwestpopulationprincipaluniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Snake River Plain
Q1396049 QID OVERLAP 0.700
QID OVERLAP: Q1396049 in nuclear_clean_energy (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (10): "agricultural", "big", "idaho", "land", "largest", "major", "northwest", "river", "snake", "southern".
agriculturalbigidaholandlargestmajornorthwestriversnakesouthern
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
e of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in nuclear_clean_energy (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
190 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP190 edges
🌲 EVERGREEN3 edges
0.650
Electrician ↗ Q165029 EXACT TITLE
buildingscomponentsdataelectricalelectricianelectriciansequipmentexistinginfrastructureinstallationlinesmaintenanceplatformsrelatedtransmission
SHARED TOKENS (15): "buildings", "components", "data", "electrical", "electrician", "electricians", "equipment", "existing", "infrastructure", "installation", "lines", "maintenance", "platforms", "related", "transmission". | URL->B (1): http://www.bls.gov/ooh/construction-and-extraction/electricians.htm. | EXACT TITLE in nuclear_clean_energy: "Electrician". | EXACT TITLE in energy_utilities: "Electrician".
0.650
acresadaapproximatelyboisecanyoncapacitydamdiversionidahoirrigationmultipleriversourcedsystemtreasurevalleywaterwestern
SHARED TOKENS (18): "acres", "ada", "approximately", "boise", "canyon", "capacity", "dam", "diversion", "idaho", "irrigation", "multiple", "river", "sourced", "system", "treasure", "valley", "water", "western". | URL->B (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in energy_utilities: "New York Canal".
0.630
alternativescleancommunitydifferenteducationenergyidahoidentifyorganizationpowerriversnakewasteworking
SHARED TOKENS (14): "alternatives", "clean", "community", "different", "education", "energy", "idaho", "identify", "organization", "power", "river", "snake", "waste", "working". | URL->A (1): http://snakeriveralliance.org/. | EXACT TITLE in nuclear_clean_energy: "Snake River Alliance".
🌿 BRANCH164 edges
0.570
activityamongfallsidahomeridianpercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (11): "activity", "among", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "university". | URL->A (1): http://www.isu.edu/. | EXACT TITLE in nuclear_clean_energy: "Idaho State University".
0.500
chemicaldevelopmentdistributeddistributioneconomiceconomyelectricelectricityelectrificationenergygenerationheatheatinghistoryhouseholdindustrialpowerprocessprocessespumps
SHARED TOKENS (28): "chemical", "development", "distributed", "distribution", "economic", "economy", "electric", "electricity", "electrification", "energy", "generation", "heat", "heating", "history", "household", "industrial", "power", "process", "processes", "pumps".... | EXACT TITLE in nuclear_clean_energy: "Electrification". | EXACT TITLE in energy_utilities: "Electrification".
0.500
amongapproximatelybigboisecompetedivisionfallsidahooperatesproductionprofessionalpublicresearchruralstudentsuniversity
SHARED TOKENS (16): "among", "approximately", "big", "boise", "compete", "division", "falls", "idaho", "operates", "production", "professional", "public", "research", "rural", "students", "university". | EXACT TITLE in nuclear_clean_energy: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
anotheraquifercasechemicalconstructedconstructioncontainscreatedrillingearthenvironmentalexcavationfallsgroundwaterleastneedsplacingpotentialproviderequire
SHARED TOKENS (31): "another", "aquifer", "case", "chemical", "constructed", "construction", "contains", "create", "drilling", "earth", "environmental", "excavation", "falls", "groundwater", "least", "needs", "placing", "potential", "provide", "require".... | EXACT TITLE in nuclear_clean_energy: "Well". | EXACT TITLE in energy_utilities: "Well".
0.500
Tariff ↗ EXACT TITLE
americanamongbarrierscallconsumerconsumersconsumptiondistributedeconomiceconomyencourageexportfallsformgrowthinstrumentsintendedlocalmaterialsmeans
SHARED TOKENS (39): "american", "among", "barriers", "call", "consumer", "consumers", "consumption", "distributed", "economic", "economy", "encourage", "export", "falls", "form", "growth", "instruments", "intended", "local", "materials", "means".... | EXACT TITLE in nuclear_clean_energy: "Tariff". | EXACT TITLE in energy_utilities: "Tariff".
0.500
activitybillioncaseconsumptiondependsdirectlyenvironmentalfoodformmaintainmajorphysicalpreparationsuppliedwaterwork
SHARED TOKENS (16): "activity", "billion", "case", "consumption", "depends", "directly", "environmental", "food", "form", "maintain", "major", "physical", "preparation", "supplied", "water", "work". | EXACT TITLE in energy_utilities: "Drinking water".
0.500
activitiesagriculturalairapproximatelychangeearthgroundwaterhouseholdindustrialirrigationmultiplenaturalnorthoccurringpotentiallyrenewableresourceresourcesriversmall
SHARED TOKENS (25): "activities", "agricultural", "air", "approximately", "change", "earth", "groundwater", "household", "industrial", "irrigation", "multiple", "natural", "north", "occurring", "potentially", "renewable", "resource", "resources", "river", "small".... | EXACT TITLE in energy_utilities: "Water resources".
0.500
builtconstructedconstructioncontroldepartmentenergyfacilityidahoinstrumentationlaboratorymaterialsnationaloperatedoperationplannedprogramschedulestructuralsystemstest
SHARED TOKENS (21): "built", "constructed", "construction", "control", "department", "energy", "facility", "idaho", "instrumentation", "laboratory", "materials", "national", "operated", "operation", "planned", "program", "schedule", "structural", "systems", "test".... | EXACT TITLE in nuclear_clean_energy: "Transient Reactor Test Facility".
0.500
communitycomplexcomponentsconventionalcoordinateddifferentdistributeddistributiondistrictelectricelectricalelectricityenergyenvironmentalgasgenerationgeothermalgridhydroelectricincreasingly
SHARED TOKENS (49): "community", "complex", "components", "conventional", "coordinated", "different", "distributed", "distribution", "district", "electric", "electrical", "electricity", "energy", "environmental", "gas", "generation", "geothermal", "grid", "hydroelectric", "increasingly".... | EXACT TITLE in energy_utilities: "Distributed generation".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagricultureannuallyaquiferbecomebillioncapacitycentralchangecleancontainsdischargedisposaldistributionearthenvironmentalfieldformformationgeothermal
SHARED TOKENS (54): "agricultural", "agriculture", "annually", "aquifer", "become", "billion", "capacity", "central", "change", "clean", "contains", "discharge", "disposal", "distribution", "earth", "environmental", "field", "form", "formation", "geothermal".... | EXACT TITLE in nuclear_clean_energy: "Groundwater". | EXACT TITLE in energy_utilities: "Groundwater".
0.500
Natural gas ↗ Q40858 EXACT TITLE
adoptionairalongsideassessmentassetsbecomingchainchangechemicalcommercialconsumptiondemandelectricityenergyformedgasheatinfrastructurelargestlong-term
SHARED TOKENS (34): "adoption", "air", "alongside", "assessment", "assets", "becoming", "chain", "change", "chemical", "commercial", "consumption", "demand", "electricity", "energy", "formed", "gas", "heat", "infrastructure", "largest", "long-term".... | EXACT TITLE in nuclear_clean_energy: "Natural gas". | EXACT TITLE in energy_utilities: "Natural gas".
0.500
Pipeline ↗ Q25471856 EXACT TITLE
constructedconstructionconsumptiondesignenvironmentalevengasgenerationirrigationmarketmaterialsmovenaturalneedsnetworknorthpipelineplannedplanningpressure
SHARED TOKENS (28): "constructed", "construction", "consumption", "design", "environmental", "even", "gas", "generation", "irrigation", "market", "materials", "move", "natural", "needs", "network", "north", "pipeline", "planned", "planning", "pressure".... | EXACT TITLE in nuclear_clean_energy: "Pipeline". | EXACT TITLE in energy_utilities: "Pipeline".
0.500
actappliesenvironmentalfederalfoodintendedlawprivateprotectionpublicqualityregulatedservedstandardssystemsystemswaterwells
SHARED TOKENS (18): "act", "applies", "environmental", "federal", "food", "intended", "law", "private", "protection", "public", "quality", "regulated", "served", "standards", "system", "systems", "water", "wells". | EXACT TITLE in energy_utilities: "Safe Drinking Water Act".
0.500
commercialcomponentsconsumersdistributionfireindustrialinfrastructurenetworkplantrequirementsresidentialsupplysystemtreatmentwaterwells
SHARED TOKENS (16): "commercial", "components", "consumers", "distribution", "fire", "industrial", "infrastructure", "network", "plant", "requirements", "residential", "supply", "system", "treatment", "water", "wells". | EXACT TITLE in energy_utilities: "Water distribution system".
0.500
changecommunitycomponentsculturaldevelopmentdifferentdistincteconomiceconomyelectricalemergencyenvironmentenvironmentalfacilitiesfirmsfunctiongoalgreenimportanceindustrial
SHARED TOKENS (44): "change", "community", "components", "cultural", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "environment", "environmental", "facilities", "firms", "function", "goal", "green", "importance", "industrial".... | EXACT TITLE in nuclear_clean_energy: "Infrastructure". | EXACT TITLE in energy_utilities: "Infrastructure".
0.500
airbecomebenefitscapacitychangecleanconsumptioncostcurrentdeploymentefficientelectricityelectrificationenergyenvironmentalevenexpansionfinancialgasgeneration
SHARED TOKENS (56): "air", "become", "benefits", "capacity", "change", "clean", "consumption", "cost", "current", "deployment", "efficient", "electricity", "electrification", "energy", "environmental", "even", "expansion", "financial", "gas", "generation".... | EXACT TITLE in nuclear_clean_energy: "Renewable energy". | EXACT TITLE in energy_utilities: "Renewable energy".
0.500
Journeyman ↗ Q582096 EXACT TITLE
apprenticeshipbecomebuildingbusinesscontinuededucationevaluationexperiencefieldjourneymanlicenseofficialpublicqualificationqualifiedresponsibleworkworkersworking
SHARED TOKENS (19): "apprenticeship", "become", "building", "business", "continued", "education", "evaluation", "experience", "field", "journeyman", "license", "official", "public", "qualification", "qualified", "responsible", "work", "workers", "working". | EXACT TITLE in nuclear_clean_energy: "Journeyman". | EXACT TITLE in energy_utilities: "Journeyman".
0.500
chemicalcontrolconventionalefficiencyenergyengineeringfieldformheatphysicalprocessprocessesproductionreliabilitysafetyscale
SHARED TOKENS (16): "chemical", "control", "conventional", "efficiency", "energy", "engineering", "field", "form", "heat", "physical", "process", "processes", "production", "reliability", "safety", "scale". | EXACT TITLE in nuclear_clean_energy: "Microreactor".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddirectlyfallsgroundwaterlandlargemajornaturalpopulationpotentialpotentiallyreducerelatedresourcerightsurfacetimingtreatment
SHARED TOKENS (22): "become", "create", "demand", "directly", "falls", "groundwater", "land", "large", "major", "natural", "population", "potential", "potentially", "reduce", "related", "resource", "right", "surface", "timing", "treatment".... | EXACT TITLE in energy_utilities: "Stormwater".
0.500
Drought ↗ Q43059 EXACT TITLE
activityagricultureairannualavailabilitybecomebecomingchangedirectlyeconomiceconomyelectricenvironmentalexperiencefoodfutureheathistoryhydropowerincrease
SHARED TOKENS (35): "activity", "agriculture", "air", "annual", "availability", "become", "becoming", "change", "directly", "economic", "economy", "electric", "environmental", "experience", "food", "future", "heat", "history", "hydropower", "increase".... | EXACT TITLE in nuclear_clean_energy: "Drought".
0.500
actualannualcapacitychargescommercialconsumersconsumptioncostcustomercustomersdemandelectricelectricalelectricityenergyevenexpectedgridheatingindustrial
SHARED TOKENS (33): "actual", "annual", "capacity", "charges", "commercial", "consumers", "consumption", "cost", "customer", "customers", "demand", "electric", "electrical", "electricity", "energy", "even", "expected", "grid", "heating", "industrial".... | EXACT TITLE in nuclear_clean_energy: "Peak demand". | EXACT TITLE in energy_utilities: "Peak demand".
0.500
Heat pump ↗ Q131313 EXACT TITLE
adoptionairalternativesanotherbuildingchangecostdependsdistrictefficiencyelectricelectricalelectricityenergyfallsgasheatheatinglimitedmeans
SHARED TOKENS (44): "adoption", "air", "alternatives", "another", "building", "change", "cost", "depends", "district", "efficiency", "electric", "electrical", "electricity", "energy", "falls", "gas", "heat", "heating", "limited", "means".... | EXACT TITLE in nuclear_clean_energy: "Heat pump". | EXACT TITLE in energy_utilities: "Heat pump".
0.500
agriculturalanothercasechemicaldisposalenvironmentfacilityindustrialmunicipalplantprocessprocessespurposeseparationtreatmentuseswastewastewaterwater
SHARED TOKENS (19): "agricultural", "another", "case", "chemical", "disposal", "environment", "facility", "industrial", "municipal", "plant", "process", "processes", "purpose", "separation", "treatment", "uses", "waste", "wastewater", "water". | EXACT TITLE in energy_utilities: "Wastewater treatment".
0.500
applicationapproximatelybuiltcomplexcurrentdepartmenteasternelectricityenergyengineeringenvironmentalfacilitiesfacilityfallshistoryidahoinvolvedknowledgelaboratorieslaboratory
SHARED TOKENS (31): "application", "approximately", "built", "complex", "current", "department", "eastern", "electricity", "energy", "engineering", "environmental", "facilities", "facility", "falls", "history", "idaho", "involved", "knowledge", "laboratories", "laboratory".... | EXACT TITLE in nuclear_clean_energy: "Idaho National Laboratory".
0.500
Lineworker ↗ Q691225 EXACT TITLE
buildingscasecommercialdeliverdistributionelectricelectricalelectriciansemergencyenergyfacilitiesindustrialinsideinstallinstallationslineslineworkersmaintainmaintainsresidential
SHARED TOKENS (23): "buildings", "case", "commercial", "deliver", "distribution", "electric", "electrical", "electricians", "emergency", "energy", "facilities", "industrial", "inside", "install", "installations", "lines", "lineworkers", "maintain", "maintains", "residential".... | EXACT TITLE in nuclear_clean_energy: "Lineworker". | EXACT TITLE in energy_utilities: "Lineworker".
0.500
agricultureamericanboisecivilcountiesdamdesignatedengineeringengineersidahoirrigationlevelnationaloperatedpeakprovidepurposereclamationreservoirriver
SHARED TOKENS (22): "agriculture", "american", "boise", "civil", "counties", "dam", "designated", "engineering", "engineers", "idaho", "irrigation", "level", "national", "operated", "peak", "provide", "purpose", "reclamation", "reservoir", "river".... | EXACT TITLE in energy_utilities: "Arrowrock Dam".
0.500
airapplicationsassociatedbuiltcapacityconstructioncontrolledelectricityenergyenvironmentexpectedfleetfuturegasgenerationhourslargestmovementnaturalnear
SHARED TOKENS (37): "air", "applications", "associated", "built", "capacity", "construction", "controlled", "electricity", "energy", "environment", "expected", "fleet", "future", "gas", "generation", "hours", "largest", "movement", "natural", "near".... | EXACT TITLE in nuclear_clean_energy: "Nuclear power".
0.500
analysisassessmentbroaderbuildingchangechangescontrolengineeringfloodincreaseinfrastructurelevelmanagementnaturalpotentialpracticesprocessesreducereducingrelated
SHARED TOKENS (28): "analysis", "assessment", "broader", "building", "change", "changes", "control", "engineering", "flood", "increase", "infrastructure", "level", "management", "natural", "potential", "practices", "processes", "reduce", "reducing", "related".... | EXACT TITLE in nuclear_clean_energy: "Flood management".
0.500
americanbusinessesconductscoordinationcurrentdatadepartmenteconomiceconomicsfederalfieldlaborlocalmaintainmajormanagementneedofficeprincipalprocesses
SHARED TOKENS (28): "american", "businesses", "conducts", "coordination", "current", "data", "department", "economic", "economics", "federal", "field", "labor", "local", "maintain", "major", "management", "need", "office", "principal", "processes".... | EXACT TITLE in energy_utilities: "Bureau of Labor Statistics".
0.500
Aquifer ↗ Q208791 EXACT TITLE
aquiferbeyondenvironmentformationgroundwaterhomeindustriallandlayermajormaterialspressureregionrelatedsourcestudywaterwells
SHARED TOKENS (18): "aquifer", "beyond", "environment", "formation", "groundwater", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "related", "source", "study", "water", "wells". | EXACT TITLE in nuclear_clean_energy: "Aquifer". | EXACT TITLE in energy_utilities: "Aquifer".
0.500
activityannuallybillioncomplianceevenformgroundwaterhazardousindustrialmakingmunicipaloperationsprocessprocessesregimeswastewater
SHARED TOKENS (17): "activity", "annually", "billion", "compliance", "even", "form", "groundwater", "hazardous", "industrial", "making", "municipal", "operations", "process", "processes", "regimes", "waste", "water". | EXACT TITLE in energy_utilities: "Industrial waste".
0.500
actactivitiesapplicantsapproximatelycertificationcommissioncomponentsconcentratesdecisionsdefinesdepartmentdifferentenergyenvironmentalevaluateexperiencefacilitiesfacilityformguidance
SHARED TOKENS (55): "act", "activities", "applicants", "approximately", "certification", "commission", "components", "concentrates", "decisions", "defines", "department", "different", "energy", "environmental", "evaluate", "experience", "facilities", "facility", "form", "guidance".... | EXACT TITLE in nuclear_clean_energy: "Nuclear material".
0.500
assetsbroaderbuildingscapitalcategorycommunityconstructedconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesfinancedgridhabitathospitalsinfrastructurelong-term
SHARED TOKENS (35): "assets", "broader", "buildings", "capital", "category", "community", "constructed", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "financed", "grid", "habitat", "hospitals", "infrastructure", "long-term".... | EXACT TITLE in nuclear_clean_energy: "Public works". | EXACT TITLE in energy_utilities: "Public works".
0.500
advancedbecomescomponentsefficiencyenergyenvironmentenvironmentalindustrialirrigationmaintenancematerialsprocessprocessesqualityreceivingrecoveryrecreationreducesresourceriver
SHARED TOKENS (25): "advanced", "becomes", "components", "efficiency", "energy", "environment", "environmental", "industrial", "irrigation", "maintenance", "materials", "process", "processes", "quality", "receiving", "recovery", "recreation", "reduces", "resource", "river".... | EXACT TITLE in energy_utilities: "Water treatment".
0.500
activitiesaffectanothercomplexcomponentsconservationconsumptionconvertcosteconomicefficiencyefficientenergyengineeringenvironmentalformgasgreengrowthheating
SHARED TOKENS (37): "activities", "affect", "another", "complex", "components", "conservation", "consumption", "convert", "cost", "economic", "efficiency", "efficient", "energy", "engineering", "environmental", "form", "gas", "green", "growth", "heating".... | EXACT TITLE in nuclear_clean_energy: "Energy conservation".
0.500
Microgrid ↗ Q5762595 EXACT TITLE
boundariesbuildingconnectedcontroldistributeddistributioneconomicefficiencyefficientelectricelectricalelectricityelectrificationemergencyenergyentityevenfunctiongenerationgrid
SHARED TOKENS (55): "boundaries", "building", "connected", "control", "distributed", "distribution", "economic", "efficiency", "efficient", "electric", "electrical", "electricity", "electrification", "emergency", "energy", "entity", "even", "function", "generation", "grid".... | EXACT TITLE in energy_utilities: "Microgrid".
0.500
associationcertificationcontractorsengineersgroundwaterinternationalmonitoringnationaloperatesorganizationprogramspromotespublicpublishesrelatedresearchresponsibleseparatewater
SHARED TOKENS (19): "association", "certification", "contractors", "engineers", "groundwater", "international", "monitoring", "national", "operates", "organization", "programs", "promotes", "public", "publishes", "related", "research", "responsible", "separate", "water". | EXACT TITLE in energy_utilities: "National Ground Water Association".
0.500
airamericanbecomeboardcertificationcertifiedconditioningconsumercontractordesignefficiencyelectricalenergyfieldfieldsformedfundsheatheatingincentives
SHARED TOKENS (56): "air", "american", "become", "board", "certification", "certified", "conditioning", "consumer", "contractor", "design", "efficiency", "electrical", "energy", "field", "fields", "formed", "funds", "heat", "heating", "incentives".... | EXACT TITLE in nuclear_clean_energy: "North American Board of Certified Energy Practitioners".
0.500
distributionelectricelectricityenergyentitiesfacilitiesgenerationinfrastructurelargestlocalmajormarketmarketsnationaloperateownedpowerproviderspublicregulated
SHARED TOKENS (25): "distribution", "electric", "electricity", "energy", "entities", "facilities", "generation", "infrastructure", "largest", "local", "major", "market", "markets", "national", "operate", "owned", "power", "providers", "public", "regulated".... | EXACT TITLE in energy_utilities: "Electric utility".
0.500
applicationdemonstratesdependseducationenvironmentenvironmentalexperiencefacilitiesfieldknowledgemakingpotentialpowerprincipallyprofessionalprotectionqualifyingrelatedrequireresearch
SHARED TOKENS (22): "application", "demonstrates", "depends", "education", "environment", "environmental", "experience", "facilities", "field", "knowledge", "making", "potential", "power", "principally", "professional", "protection", "qualifying", "related", "require", "research".... | EXACT TITLE in nuclear_clean_energy: "Health physics".
0.500
barrierscurrentdepartmentdevelopmentenergyenvironmentalnationalneedsofficepowerpromotesregulatoryresearchresourcetechnical
SHARED TOKENS (15): "barriers", "current", "department", "development", "energy", "environmental", "national", "needs", "office", "power", "promotes", "regulatory", "research", "resource", "technical". | EXACT TITLE in nuclear_clean_energy: "Office of Nuclear Energy".
0.500
activitiesagriculturalairamongapplicationbenefitschangechargesdevelopmentelectricenvironmentalformationheathistoryincreaselegalmaterialsnationaloccurringownership
SHARED TOKENS (28): "activities", "agricultural", "air", "among", "application", "benefits", "change", "charges", "development", "electric", "environmental", "formation", "heat", "history", "increase", "legal", "materials", "national", "occurring", "ownership".... | EXACT TITLE in nuclear_clean_energy: "Cloud seeding".
0.500
actcommissiondisposalenergyfacilitiesfunctionsjanuarylicensingmaterialsoperationsoversightpublicrecyclingregulationregulatoryrelatedrenewalsafetystorage
SHARED TOKENS (19): "act", "commission", "disposal", "energy", "facilities", "functions", "january", "licensing", "materials", "operations", "oversight", "public", "recycling", "regulation", "regulatory", "related", "renewal", "safety", "storage". | EXACT TITLE in nuclear_clean_energy: "Nuclear Regulatory Commission".
0.500
amongbarriersbehind-the-meterbuiltcapacitycentercenterscommercialconstructionconventionalcustomersdatadeliverdemanddesignelectricalelectricityemergencyexpectedfinancial
SHARED TOKENS (44): "among", "barriers", "behind-the-meter", "built", "capacity", "center", "centers", "commercial", "construction", "conventional", "customers", "data", "deliver", "demand", "design", "electrical", "electricity", "emergency", "expected", "financial".... | EXACT TITLE in nuclear_clean_energy: "Small modular reactor".
0.500
annualbillionchemicalcurrentdedicatedefficiencyelectricityenergyexpectedgasgenerationgreengrowthindustriallargemarketnaturalprocessproducingproduct
SHARED TOKENS (27): "annual", "billion", "chemical", "current", "dedicated", "efficiency", "electricity", "energy", "expected", "gas", "generation", "green", "growth", "industrial", "large", "market", "natural", "process", "producing", "product".... | EXACT TITLE in nuclear_clean_energy: "Hydrogen production".
0.500
Cold War ↗ Q8683 EXACT TITLE
anotherchangecontactsconventionaldirectdivisioneasterneconomicfundinginternationalmajornorthplanrecoveryregimeregionalsupportthoughunionwestern
SHARED TOKENS (20): "another", "change", "contacts", "conventional", "direct", "division", "eastern", "economic", "funding", "international", "major", "north", "plan", "recovery", "regime", "regional", "support", "though", "union", "western". | EXACT TITLE in nuclear_clean_energy: "Cold War".
0.500
businessconstructioncontractordesigndifferentdirectlyelectricalelectricianelectriciansfirmhomeinstallationmaintenanceoperateownersprofessionalrelatedrequirementsspecializedsystems
SHARED TOKENS (21): "business", "construction", "contractor", "design", "different", "directly", "electrical", "electrician", "electricians", "firm", "home", "installation", "maintenance", "operate", "owners", "professional", "related", "requirements", "specialized", "systems".... | EXACT TITLE in nuclear_clean_energy: "Electrical contractor". | EXACT TITLE in energy_utilities: "Electrical contractor".
0.500
acresamericancentercentersdisposalenergyenvironmentalfacilitiesinvolvedlandfilllargestmanagementmaterialsnearnorthoperatedoperatesoperationsownedprojects
SHARED TOKENS (36): "acres", "american", "center", "centers", "disposal", "energy", "environmental", "facilities", "involved", "landfill", "largest", "management", "materials", "near", "north", "operated", "operates", "operations", "owned", "projects".... | EXACT TITLE in energy_utilities: "Republic Services".
0.500
associatedbuildingcapabilitycodecodescommissioncontrolcurrentdesigndistributionelectricelectricalenvironmentalfireinstallationinternationallargelocalmodelnational
SHARED TOKENS (31): "associated", "building", "capability", "code", "codes", "commission", "control", "current", "design", "distribution", "electric", "electrical", "environmental", "fire", "installation", "international", "large", "local", "model", "national".... | EXACT TITLE in nuclear_clean_energy: "Electrical code".
0.500
Compost ↗ Q212254 EXACT TITLE
agricultureairbenefitschemicalcommercialconstructiondependencyeconomicenvironmentalfoodgreenheatlandlandfilllevelmanagementmaterialsphysicalplantprocess
SHARED TOKENS (29): "agriculture", "air", "benefits", "chemical", "commercial", "construction", "dependency", "economic", "environmental", "food", "green", "heat", "land", "landfill", "level", "management", "materials", "physical", "plant", "process".... | EXACT TITLE in energy_utilities: "Compost".
0.500
Landfill ↗ Q152810 EXACT TITLE
changeconsolidationdischargedisposalenvironmentalfinalformfulllandlandfillmanagementmaterialsmunicipalrecyclingsitesitesstoragetransfertreatmentunless
SHARED TOKENS (22): "change", "consolidation", "discharge", "disposal", "environmental", "final", "form", "full", "land", "landfill", "management", "materials", "municipal", "recycling", "site", "sites", "storage", "transfer", "treatment", "unless".... | EXACT TITLE in nuclear_clean_energy: "Landfill". | EXACT TITLE in energy_utilities: "Landfill".
0.500
cannotcleancommissioncommunicationscompetecontroldifferentdisposalelectricityenergyentityfederalgasinfrastructureinstitutionlargelineslocalmaintainsmarket
SHARED TOKENS (46): "cannot", "clean", "commission", "communications", "compete", "control", "different", "disposal", "electricity", "energy", "entity", "federal", "gas", "infrastructure", "institution", "large", "lines", "local", "maintains", "market".... | EXACT TITLE in nuclear_clean_energy: "Public utility". | EXACT TITLE in energy_utilities: "Public utility".
0.500
affectsalternativesbusinesscertificationcompensationconsumerconsumerscreatescustomercustomerseconomicentryformgrowthinspectionslawleastlicenselicensedlicensing
SHARED TOKENS (44): "affects", "alternatives", "business", "certification", "compensation", "consumer", "consumers", "creates", "customer", "customers", "economic", "entry", "form", "growth", "inspections", "law", "least", "license", "licensed", "licensing".... | EXACT TITLE in nuclear_clean_energy: "Occupational licensing". | EXACT TITLE in energy_utilities: "Occupational licensing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangesconsolidationcontributioncontrolcontrolleddirectlydischargedistributeddistributiondownstreamenvironmentalfieldfieldsformfull
SHARED TOKENS (55): "agricultural", "agriculture", "application", "applies", "central", "changes", "consolidation", "contribution", "control", "controlled", "directly", "discharge", "distributed", "distribution", "downstream", "environmental", "field", "fields", "form", "full".... | EXACT TITLE in nuclear_clean_energy: "Irrigation". | EXACT TITLE in energy_utilities: "Irrigation".
0.500
Veolia ↗ Q1632461 EXACT TITLE
activitiesadoptedbillionboardbusinessenergyenvironmentenvironmentalmajormanagedmanagementoperationspublicrevenuesectorsingleutilitywastewater
SHARED TOKENS (19): "activities", "adopted", "billion", "board", "business", "energy", "environment", "environmental", "major", "managed", "management", "operations", "public", "revenue", "sector", "single", "utility", "waste", "water". | EXACT TITLE in energy_utilities: "Veolia".
0.500
Pipefitter ↗ Q5407416 EXACT TITLE
apprenticeshipapprenticeshipsbecomingcasescentercertifiedcommercialconcentratesconstructioncontrolleddifferenteducationheatingindustrialinstitutionaljourneymanlicensedmaintainsmechanicalnational
SHARED TOKENS (39): "apprenticeship", "apprenticeships", "becoming", "cases", "center", "certified", "commercial", "concentrates", "construction", "controlled", "different", "education", "heating", "industrial", "institutional", "journeyman", "licensed", "maintains", "mechanical", "national".... | EXACT TITLE in nuclear_clean_energy: "Pipefitter". | EXACT TITLE in energy_utilities: "Pipefitter".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcasescontrolcreatecurrentdeliverdividefloodincreaseirrigationlevelmanagementnaturalneededpressurereservoirsresourcesriversource
SHARED TOKENS (25): "building", "built", "cases", "control", "create", "current", "deliver", "divide", "flood", "increase", "irrigation", "level", "management", "natural", "needed", "pressure", "reservoirs", "resources", "river", "source".... | EXACT TITLE in energy_utilities: "Canal".
0.500
batterybulkchemicalconventionaldamdemandelectricalelectricityenergyfoodformgridheathydroelectriclargemultipleoperatepeakpotentialpower
SHARED TOKENS (27): "battery", "bulk", "chemical", "conventional", "dam", "demand", "electrical", "electricity", "energy", "food", "form", "grid", "heat", "hydroelectric", "large", "multiple", "operate", "peak", "potential", "power".... | EXACT TITLE in nuclear_clean_energy: "Energy storage".
0.500
Recycling ↗ Q132580 EXACT TITLE
airanotherbatteriescentercomplexconservationconsumptioncontrolconventionaldelivereddependsdifferentdisposaleconomicenergyenvironmentalfoodformgashazardous
SHARED TOKENS (43): "air", "another", "batteries", "center", "complex", "conservation", "consumption", "control", "conventional", "delivered", "depends", "different", "disposal", "economic", "energy", "environmental", "food", "form", "gas", "hazardous".... | EXACT TITLE in nuclear_clean_energy: "Recycling". | EXACT TITLE in energy_utilities: "Recycling".
0.500
builtcapacityclassificationcommunitydamdatadistributedelectricityenergyenvironmentalexactfundinggenerationgridhydroelectricinstallationsintegrationisolatedlevellocal
SHARED TOKENS (38): "built", "capacity", "classification", "community", "dam", "data", "distributed", "electricity", "energy", "environmental", "exact", "funding", "generation", "grid", "hydroelectric", "installations", "integration", "isolated", "level", "local".... | EXACT TITLE in energy_utilities: "Small hydro".
0.500
adaboardboisecanyoncollegecommunitycountiescwidevelopmenteasterneducationgovernedidaholargenampanorthpopulationprogramspublicreported
SHARED TOKENS (31): "ada", "board", "boise", "canyon", "college", "community", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "north", "population", "programs", "public", "reported".... | EXACT TITLE in nuclear_clean_energy: "College of Western Idaho". | EXACT TITLE in energy_utilities: "College of Western Idaho".
0.500
Data center ↗ Q671224 EXACT TITLE
actalonearoundassociatedbillionbuildingcentercenterscleancomponentsconnectionconsumptioncontainscontroldatadefinesdemanddifferentedgeelectrical
SHARED TOKENS (68): "act", "alone", "around", "associated", "billion", "building", "center", "centers", "clean", "components", "connection", "consumption", "contains", "control", "data", "defines", "demand", "different", "edge", "electrical".... | EXACT TITLE in nuclear_clean_energy: "Data center".
0.500
activityadvancedapplicationsapproximatelycoredesigndifferentenvironmentidahoindustrialisolatedlaboratorymaterialsmultiplenationaloperateoperatesphysicalpositionspower
SHARED TOKENS (28): "activity", "advanced", "applications", "approximately", "core", "design", "different", "environment", "idaho", "industrial", "isolated", "laboratory", "materials", "multiple", "national", "operate", "operates", "physical", "positions", "power".... | EXACT TITLE in nuclear_clean_energy: "Advanced Test Reactor".
0.500
adoptedassociationauthoritycasescodecomplianceelectricelectricalengineersequipmentevenfederalfiregoverninginstallationjurisdictionlawlineslocalnational
SHARED TOKENS (30): "adopted", "association", "authority", "cases", "code", "compliance", "electric", "electrical", "engineers", "equipment", "even", "federal", "fire", "governing", "installation", "jurisdiction", "law", "lines", "local", "national".... | EXACT TITLE in nuclear_clean_energy: "National Electrical Code".
0.500
americanbuiltenergyfacilitiesgeothermalheatindexinternationaljanuarynorthoperatespowerproductionrenewablesharesuppliedsuppliestechnology
SHARED TOKENS (18): "american", "built", "energy", "facilities", "geothermal", "heat", "index", "international", "january", "north", "operates", "power", "production", "renewable", "share", "supplied", "supplies", "technology". | EXACT TITLE in nuclear_clean_energy: "Ormat Technologies".
0.480
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommunityindustrialmunicipalprocessessewersurfacewastewastewaterwater
SHARED TOKENS (14): "activities", "agricultural", "another", "applications", "commercial", "community", "industrial", "municipal", "processes", "sewer", "surface", "waste", "wastewater", "water". | EXACT TITLE in nuclear_clean_energy: "Wastewater". | EXACT TITLE in energy_utilities: "Wastewater".
0.480
americanbigboiseconsumerdatademandidahomajormarketownedsemiconductorservedstoragetechnology
SHARED TOKENS (14): "american", "big", "boise", "consumer", "data", "demand", "idaho", "major", "market", "owned", "semiconductor", "served", "storage", "technology". | EXACT TITLE in nuclear_clean_energy: "Micron Technology".
0.480
anotherapplicationchemicalelectricityenergyengineeringexpectedfuturegallonsgenerationmeanspercentprocessessystems
SHARED TOKENS (14): "another", "application", "chemical", "electricity", "energy", "engineering", "expected", "future", "gallons", "generation", "means", "percent", "processes", "systems". | EXACT TITLE in nuclear_clean_energy: "Nuclear engineering".
0.480
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclassificationcontributiondifferentformationphysicalplantprovideremoteresourcestudywater
SHARED TOKENS (14): "agriculture", "annual", "change", "classification", "contribution", "different", "formation", "physical", "plant", "provide", "remote", "resource", "study", "water". | EXACT TITLE in nuclear_clean_energy: "Snowpack".
0.460
connectioncustomerequipmentfacilitiesinterconnectionlawmarketsnetworknetworksphysicalregulatoryrequirementstraffic
SHARED TOKENS (13): "connection", "customer", "equipment", "facilities", "interconnection", "law", "markets", "network", "networks", "physical", "regulatory", "requirements", "traffic". | EXACT TITLE in nuclear_clean_energy: "Interconnection". | EXACT TITLE in energy_utilities: "Interconnection".
0.440
agriculturaldivisionidahomajornationalnearnorthrecreationriversnakevalleywest
SHARED TOKENS (12): "agricultural", "division", "idaho", "major", "national", "near", "north", "recreation", "river", "snake", "valley", "west". | EXACT TITLE in nuclear_clean_energy: "Payette River".
0.440
acrescanyoneasternidahonationalnorthrecreationriversmallsnakewestwestern
SHARED TOKENS (12): "acres", "canyon", "eastern", "idaho", "national", "north", "recreation", "river", "small", "snake", "west", "western". | EXACT TITLE in energy_utilities: "Hells Canyon".
0.440
criticaldescribesdistincteconomyimportanceinfrastructurenationalprivateprotectionscopesectorstrategic
SHARED TOKENS (12): "critical", "describes", "distinct", "economy", "importance", "infrastructure", "national", "private", "protection", "scope", "sector", "strategic". | EXACT TITLE in nuclear_clean_energy: "Critical infrastructure".
0.420
annuallybatteriesenvironmenthazardousinternationallocalmaterialsnationalproducesregulatedwaste
SHARED TOKENS (11): "annually", "batteries", "environment", "hazardous", "international", "local", "materials", "national", "produces", "regulated", "waste". | EXACT TITLE in nuclear_clean_energy: "Hazardous waste".
0.420
assessmentchemicalcomplianceconditionphysicalqualitysafetystandardssupplytreatmentwater
SHARED TOKENS (11): "assessment", "chemical", "compliance", "condition", "physical", "quality", "safety", "standards", "supply", "treatment", "water". | EXACT TITLE in energy_utilities: "Water quality".
0.400
airchemicalcontainselectricityenergyheatpowerproducessinglestation
SHARED TOKENS (10): "air", "chemical", "contains", "electricity", "energy", "heat", "power", "produces", "single", "station". | EXACT TITLE in nuclear_clean_energy: "Nuclear fuel".
0.380
constructioncontrolcontrolsmanagementneedreduceriversitewater
SHARED TOKENS (9): "construction", "control", "controls", "management", "need", "reduce", "river", "site", "water". | EXACT TITLE in energy_utilities: "Sediment control".
0.380
buildingcontinuedelectricityidaholabornationalpowerresearchsoutheast
SHARED TOKENS (9): "building", "continued", "electricity", "idaho", "labor", "national", "power", "research", "southeast". | EXACT TITLE in nuclear_clean_energy: "Experimental Breeder Reactor I".
0.380
aprilcommercialcompleteconventionalcreateeconomymaterialsoperatedoperating
SHARED TOKENS (9): "april", "commercial", "complete", "conventional", "create", "economy", "materials", "operated", "operating". | EXACT TITLE in nuclear_clean_energy: "Breeder reactor".
0.340
formalprocesspublicratesregulatoryutilitiesutility
SHARED TOKENS (7): "formal", "process", "public", "rates", "regulatory", "utilities", "utility". | EXACT TITLE in nuclear_clean_energy: "Utility ratemaking".
0.340
organizationorganizationspublicregulatorysystemutilitieswater
SHARED TOKENS (7): "organization", "organizations", "public", "regulatory", "system", "utilities", "water". | EXACT TITLE in energy_utilities: "Public water system".
0.340
applicationformheatindustrialprocessprocessesprovide
SHARED TOKENS (7): "application", "form", "heat", "industrial", "process", "processes", "provide". | EXACT TITLE in nuclear_clean_energy: "Process heat".
0.300
anotherapplicationbarriersconstructioncreatedependdevelopersdevelopmentdisposalenvironmentalfieldgroundwaterhazardousincentiveslandmaterialsmediamunicipalphysicalpressure
SHARED TOKENS (29): "another", "application", "barriers", "construction", "create", "depend", "developers", "development", "disposal", "environmental", "field", "groundwater", "hazardous", "incentives", "land", "materials", "media", "municipal", "physical", "pressure"....
0.300
Nuclear fusion ↗ Q13082 KW CROSS HIGH
advancedamongapplicationsenergyformlargepathwayspowerprocessprocessesproducesproductproductionrequireresult
SHARED TOKENS (15): "advanced", "among", "applications", "energy", "form", "large", "pathways", "power", "process", "processes", "produces", "product", "production", "require", "result".
0.300
Project finance ↗ KW CROSS HIGH
agreementsallocationamongassetsassociatedcapitalcashcommitmentscomplexconstructioncontractscontributioncontrolcorporatedeliverydevelopmentdistributedeconomicentityenvironmental
SHARED TOKENS (55): "agreements", "allocation", "among", "assets", "associated", "capital", "cash", "commitments", "complex", "construction", "contracts", "contribution", "control", "corporate", "delivery", "development", "distributed", "economic", "entity", "environmental"....
0.300
aloneapplicationsaroundbatteriesbatterycostdemandenergyexpectedlevelmarketmodeloperatingpowerproductionsafetyshareutility-scalevalue
SHARED TOKENS (19): "alone", "applications", "around", "batteries", "battery", "cost", "demand", "energy", "expected", "level", "market", "model", "operating", "power", "production", "safety", "share", "utility-scale", "value".
0.300
acresactamericanamongapproximatelybillioncombiningconservationdepartmentdescribeddiversityenergyestateexistingfederalfuturegasidaholandmanagement
SHARED TOKENS (32): "acres", "act", "american", "among", "approximately", "billion", "combining", "conservation", "department", "described", "diversity", "energy", "estate", "existing", "federal", "future", "gas", "idaho", "land", "management"....
0.300
actsassociatedcannotdefinesdifferentenergyenvironmentfacilitiesinternationalmaterialsoperatingpotentialpowerproposedprotectionpublicresearchresponsesafetystorage
SHARED TOKENS (25): "acts", "associated", "cannot", "defines", "different", "energy", "environment", "facilities", "international", "materials", "operating", "potential", "power", "proposed", "protection", "public", "research", "response", "safety", "storage"....
0.300
amongapproximatelybarriersbehindconcerningcontainscontrolcostdisposalevaluationfeasibilityformationfuturegroundwaterinstitutionslong-termmaintenancemanagementmaterialsmeans
SHARED TOKENS (40): "among", "approximately", "barriers", "behind", "concerning", "contains", "control", "cost", "disposal", "evaluation", "feasibility", "formation", "future", "groundwater", "institutions", "long-term", "maintenance", "management", "materials", "means"....
0.300
electricenergyentityfacilitiesindependentindustrialoperatespowerprocesspublicruralsolarsystemutilitiesutilitywaterwind
SHARED TOKENS (17): "electric", "energy", "entity", "facilities", "independent", "industrial", "operates", "power", "process", "public", "rural", "solar", "system", "utilities", "utility", "water", "wind".
0.300
americanbehindbillionbuildingcommissioncomplexcontrolcostdesigndesignateddevelopmentdistrictdocumentsenergyengineerengineersfacilitiesformationfoundationsintelligence
SHARED TOKENS (45): "american", "behind", "billion", "building", "commission", "complex", "control", "cost", "design", "designated", "development", "district", "documents", "energy", "engineer", "engineers", "facilities", "formation", "foundations", "intelligence"....
0.300
aroundcenturychangechangescustomersdemanddistributionelectricelectricalelectricityenergygasgenerationgridintegratedlargemanagementmarketmarketsmechanisms
SHARED TOKENS (30): "around", "century", "change", "changes", "customers", "demand", "distribution", "electric", "electrical", "electricity", "energy", "gas", "generation", "grid", "integrated", "large", "management", "market", "markets", "mechanisms"....
0.300
actualavailabilitycapacitydesigndifferentelectricalelectricityenergyfullhoursinstallationinstallationsloadlocalmaintenancemarketnetoperationoperationalplant
SHARED TOKENS (31): "actual", "availability", "capacity", "design", "different", "electrical", "electricity", "energy", "full", "hours", "installation", "installations", "load", "local", "maintenance", "market", "net", "operation", "operational", "plant"....
0.300
coredepartmentenergyfacilityfallsfleetidaholaboratorynationalnorthwestoperateoperatespersonnelpowerreceivingstoragesurfacetraining
SHARED TOKENS (18): "core", "department", "energy", "facility", "falls", "fleet", "idaho", "laboratory", "national", "northwest", "operate", "operates", "personnel", "power", "receiving", "storage", "surface", "training".
0.300
Black start ↗ Q655257 KW CROSS HIGH
agreementanothercomplexelectricelectricalelectricityemergencyenergyfacilitygridindustriallargeloadsnetworkoperationperformplantpowerprocessrequires
SHARED TOKENS (24): "agreement", "another", "complex", "electric", "electrical", "electricity", "emergency", "energy", "facility", "grid", "industrial", "large", "loads", "network", "operation", "perform", "plant", "power", "process", "requires"....
0.300
Nuclear reactor ↗ Q80877 KW CROSS HIGH
builtchaincommercialcontrolledcorecostcriticaldesigndiscoverydistrictefficiencyelectricalelectricityenergyheatheatingindustriallaboratorylevelmajor
SHARED TOKENS (44): "built", "chain", "commercial", "controlled", "core", "cost", "critical", "design", "discovery", "district", "efficiency", "electrical", "electricity", "energy", "heat", "heating", "industrial", "laboratory", "level", "major"....
0.300
baseconsumercontrolcontrollingcriticaldemanddemand-sidedevelopmentdirectefficientelectricalelectricityentitiesevenloadmakesmanagementneednetworkpeak
SHARED TOKENS (33): "base", "consumer", "control", "controlling", "critical", "demand", "demand-side", "development", "direct", "efficient", "electrical", "electricity", "entities", "even", "load", "makes", "management", "need", "network", "peak"....
0.300
aprilaroundauthoritybasebatterycapitalcleancostdemandefficiencyefficientelectricityenergygasgenerationheathoursloadpeakplant
SHARED TOKENS (28): "april", "around", "authority", "base", "battery", "capital", "clean", "cost", "demand", "efficiency", "efficient", "electricity", "energy", "gas", "generation", "heat", "hours", "load", "peak", "plant"....
0.300
advancedairapplicationscentralcleancomponentscontrolcreateenvironmentequipmentfacilitiesindustrialinsideintegratedlargemaintainmaterialsmoduleneedprocess
SHARED TOKENS (29): "advanced", "air", "applications", "central", "clean", "components", "control", "create", "environment", "equipment", "facilities", "industrial", "inside", "integrated", "large", "maintain", "materials", "module", "need", "process"....
0.300
actamericanamongassociationauthorityconstructioncontractsdepartmentfederalirrigationlandlawmaintenancemajormeridiannationalorganizationprogramprojectprojects
SHARED TOKENS (32): "act", "american", "among", "association", "authority", "construction", "contracts", "department", "federal", "irrigation", "land", "law", "maintenance", "major", "meridian", "national", "organization", "program", "project", "projects"....
0.300
associationauthoritybecomebehindcapacitychangesconstructiondamelectricityenergyenvironmentalevenfacilitiesgenerationhydroelectrichydropowerinternationallargelargestleast
SHARED TOKENS (38): "association", "authority", "become", "behind", "capacity", "changes", "construction", "dam", "electricity", "energy", "environmental", "even", "facilities", "generation", "hydroelectric", "hydropower", "international", "large", "largest", "least"....
0.300
applicationsconventionalcoredevelopmentexistinggenerationheathigh-temperatureoperatesoperatingoperationplantpotentiallypowerprocessproductionproposeduses
SHARED TOKENS (18): "applications", "conventional", "core", "development", "existing", "generation", "heat", "high-temperature", "operates", "operating", "operation", "plant", "potentially", "power", "process", "production", "proposed", "uses".
0.300
adaboisecanyoncountiesdesignatedhomeidaholargestmeridianmetropolitannampanorthwestpercentpopulationtreasurevalleywider
SHARED TOKENS (17): "ada", "boise", "canyon", "counties", "designated", "home", "idaho", "largest", "meridian", "metropolitan", "nampa", "northwest", "percent", "population", "treasure", "valley", "wider".
0.300
activitiesadvancedagriculturalagriculturebusinessescasecostdirectdistributionenvironmentalfieldsgroundwaterimportanceindustrialirrigationmanagementmunicipalnaturalneedsnorth
SHARED TOKENS (38): "activities", "advanced", "agricultural", "agriculture", "businesses", "case", "cost", "direct", "distribution", "environmental", "fields", "groundwater", "importance", "industrial", "irrigation", "management", "municipal", "natural", "needs", "north"....
0.300
approximatelyaroundassociationbuildcommercialconnectedcostdesigndevelopmentefficiencyefficientenergyfacilitiesfundingfuturegenerationgridhigh-temperatureintendedinternational
SHARED TOKENS (38): "approximately", "around", "association", "build", "commercial", "connected", "cost", "design", "development", "efficiency", "efficient", "energy", "facilities", "funding", "future", "generation", "grid", "high-temperature", "intended", "international"....
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
applicationbuildcenturycustomersdifferentdistributionelectricalequipmentincreasinglylargelinespowerpublicreducerelatedresidentialsafetysubstationssupportsystem
SHARED TOKENS (25): "application", "build", "century", "customers", "different", "distribution", "electrical", "equipment", "increasingly", "large", "lines", "power", "public", "reduce", "related", "residential", "safety", "substations", "support", "system"....
0.300
advantagebarrierscapitalcasecenturycostcreatingeconomicselectricityentryfirmfirmsforminfrastructurelargelargestmarketmultiplenaturaloperate
SHARED TOKENS (29): "advantage", "barriers", "capital", "case", "century", "cost", "creating", "economics", "electricity", "entry", "firm", "firms", "form", "infrastructure", "large", "largest", "market", "multiple", "natural", "operate"....
0.300
approximatelyaroundbulkcapacitycenturycomponentscostcreatecreatescreatingdevelopmentdownstreamenergyexportformgaslevellocallong-termmarket
SHARED TOKENS (37): "approximately", "around", "bulk", "capacity", "century", "components", "cost", "create", "creates", "creating", "development", "downstream", "energy", "export", "form", "gas", "level", "local", "long-term", "market"....
0.300
Combined sewer ↗ Q361472 KW CROSS HIGH
buildingbuildingscapacityconstructedconstructionconsumptioncontactsdesigndisposalenvironmentalexperiencefacilitiesgreenindustrialinfrastructureirrigationlargeloadmeansoperate
SHARED TOKENS (40): "building", "buildings", "capacity", "constructed", "construction", "consumption", "contacts", "design", "disposal", "environmental", "experience", "facilities", "green", "industrial", "infrastructure", "irrigation", "large", "load", "means", "operate"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsculturaldevelopmentenvironmentenvironmentalgrowthindustrialnaturallyprocessprogramreduceresultriversourcesurfacewastewaterwater
SHARED TOKENS (18): "agriculture", "controls", "cultural", "development", "environment", "environmental", "growth", "industrial", "naturally", "process", "program", "reduce", "result", "river", "source", "surface", "wastewater", "water".
0.300
agriculturalamericanconstitutefullhouseholdindustriallegalmerelyownershippurposerightrightssourcesubsequentsystemwater
SHARED TOKENS (16): "agricultural", "american", "constitute", "full", "household", "industrial", "legal", "merely", "ownership", "purpose", "right", "rights", "source", "subsequent", "system", "water".
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
connectedefficiencyenvironmentfacilityfieldgroundwaterprocessesratereduceruralsystemsystemsthereforetreatmentunitswastewastewater
SHARED TOKENS (17): "connected", "efficiency", "environment", "facility", "field", "groundwater", "processes", "rate", "reduce", "rural", "system", "systems", "therefore", "treatment", "units", "waste", "wastewater".
0.300
Solar tracker ↗ Q938237 KW CROSS HIGH
applicationscapacitycomponentsdirectefficiencyenergymarketpanelsphotovoltaicpowerprojectsreducingreliabilitysolarsystemsthereforetowardutility-scale
SHARED TOKENS (18): "applications", "capacity", "components", "direct", "efficiency", "energy", "market", "panels", "photovoltaic", "power", "projects", "reducing", "reliability", "solar", "systems", "therefore", "toward", "utility-scale".
0.300
actactivitiesadministrativecommissiondepartmentdevelopmentenergyfacilitiesfederalfunctionslaborlawmajormaterialsoversightpowerproductionregulationregulatoryresearch
SHARED TOKENS (26): "act", "activities", "administrative", "commission", "department", "development", "energy", "facilities", "federal", "functions", "labor", "law", "major", "materials", "oversight", "power", "production", "regulation", "regulatory", "research"....
0.300
americanbuiltcontroldamfallsfloodidahoirrigationitselfnearpowerprojectreclamationrecreationreservoirresidentsriversnakestructurewestern
SHARED TOKENS (20): "american", "built", "control", "dam", "falls", "flood", "idaho", "irrigation", "itself", "near", "power", "project", "reclamation", "recreation", "reservoir", "residents", "river", "snake", "structure", "western".
0.300
Cogeneration ↗ Q221620 KW CROSS HIGH
buildingbuildingscenterscentralchemicalcontinuedcostdistributeddistrictefficiencyefficientelectricalelectricityenergygasgenerationgeothermalheatheatinghigh-temperature
SHARED TOKENS (36): "building", "buildings", "centers", "central", "chemical", "continued", "cost", "distributed", "district", "efficiency", "efficient", "electrical", "electricity", "energy", "gas", "generation", "geothermal", "heat", "heating", "high-temperature"....
0.300
advantageamongbuildingsdrillingearthefficiencyelectricelectricityenergygeothermalground-sourceheatheatinghvacinstallinglargenorthprovidepumpssource
SHARED TOKENS (25): "advantage", "among", "buildings", "drilling", "earth", "efficiency", "electric", "electricity", "energy", "geothermal", "ground-source", "heat", "heating", "hvac", "installing", "large", "north", "provide", "pumps", "source"....
0.300
alternativesanotherapplicationsbatteriesbatterycapacityconsumercostdemanddevelopmentdifferentdischargeefficiencyelectricelectrificationenergyenvironmentalfireformgas
SHARED TOKENS (36): "alternatives", "another", "applications", "batteries", "battery", "capacity", "consumer", "cost", "demand", "development", "different", "discharge", "efficiency", "electric", "electrification", "energy", "environmental", "fire", "form", "gas"....
0.300
activityamongapproximatelyassociationboisecanyoncapacitycenterconservationcontainscountiescreatesdamdirectlyedgefederalformationidaholargestlevel
SHARED TOKENS (39): "activity", "among", "approximately", "association", "boise", "canyon", "capacity", "center", "conservation", "contains", "counties", "creates", "dam", "directly", "edge", "federal", "formation", "idaho", "largest", "level"....
0.300
amongassociationavailabilitybecomeconsumptiondeploymentdevelopmentdistributionefficiencyenergyhouseholdincreaseinternationallimitednationalnaturalpowerrapidrenewableresources
SHARED TOKENS (24): "among", "association", "availability", "become", "consumption", "deployment", "development", "distribution", "efficiency", "energy", "household", "increase", "international", "limited", "national", "natural", "power", "rapid", "renewable", "resources"....
0.300
actapproximatelybillioncasecompensationconstructeddescribedelectricenvironmentalestablishesfacilitiesfederalgovernsincreaselawpolicypowerpriceprivateproduction
SHARED TOKENS (26): "act", "approximately", "billion", "case", "compensation", "constructed", "described", "electric", "environmental", "establishes", "facilities", "federal", "governs", "increase", "law", "policy", "power", "price", "private", "production"....
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcommissionconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesentityfederalgoverned
SHARED TOKENS (45): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "commission", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "entity", "federal", "governed"....
0.300
administrativeanotherapprovedcompletecontroldisposalenvironmentfacilitiesfacilityfinalfundsfuturehundredsindustriallicensematerialsoperatingownerplanplant
SHARED TOKENS (33): "administrative", "another", "approved", "complete", "control", "disposal", "environment", "facilities", "facility", "final", "funds", "future", "hundreds", "industrial", "license", "materials", "operating", "owner", "plan", "plant"....
0.300
assessmentcategoriescommissiondataemergencyenergyinternationallevellimitedmeansmeasurementsoccupationalprotectionsafetysourceunits
SHARED TOKENS (16): "assessment", "categories", "commission", "data", "emergency", "energy", "international", "level", "limited", "means", "measurements", "occupational", "protection", "safety", "source", "units".
0.300
airbillionbuildingchemicalcleanconstructedconstructioncontainscontrolcontrolledcontrollingcostcreatecriticaldeliverydischargeelectricalelectricityenvironmentequipment
SHARED TOKENS (39): "air", "billion", "building", "chemical", "clean", "constructed", "construction", "contains", "control", "controlled", "controlling", "cost", "create", "critical", "delivery", "discharge", "electrical", "electricity", "environment", "equipment"....
0.300
Power station ↗ Q159719 KW CROSS HIGH
connectedcreatescurrentelectricelectricalelectricityenergyfacilityfieldgasgenerationgeothermalgridhydroelectricindustrialmechanicalnaturalplantpowerrenewables
SHARED TOKENS (25): "connected", "creates", "current", "electric", "electrical", "electricity", "energy", "facility", "field", "gas", "generation", "geothermal", "grid", "hydroelectric", "industrial", "mechanical", "natural", "plant", "power", "renewables"....
0.300
americanaprilbehindcapacitycentercentraldevelopmentelectricityenergyfarmsfederalgenerationgrowthhomehydroelectricjanuarylargestmegawattsnorthoverview
SHARED TOKENS (32): "american", "april", "behind", "capacity", "center", "central", "development", "electricity", "energy", "farms", "federal", "generation", "growth", "home", "hydroelectric", "january", "largest", "megawatts", "north", "overview"....
0.300
alongsidecategorychaincommercialconstructedconvertdeliverefficiencyexistingfuturelaboratorylargestmaintainnationalneedsoperatedoperationalpowerproposedreducing
SHARED TOKENS (27): "alongside", "category", "chain", "commercial", "constructed", "convert", "deliver", "efficiency", "existing", "future", "laboratory", "largest", "maintain", "national", "needs", "operated", "operational", "power", "proposed", "reducing"....
0.300
becomebusinesscentralcommercialcreatingdevelopmentfinancialfundshistoryindependentinstitutionsmultipleorganizationsownerspersonsprojectprojectsrisksharesmall
SHARED TOKENS (21): "become", "business", "central", "commercial", "creating", "development", "financial", "funds", "history", "independent", "institutions", "multiple", "organizations", "owners", "persons", "project", "projects", "risk", "share", "small"....
0.300
actactivitiesadministeredadministrativeairamongassociatedbenefitschangecleancomplexcontrolcoordinationcreatedependenvironmentalexactfacilitiesfederalhazardous
SHARED TOKENS (41): "act", "activities", "administered", "administrative", "air", "among", "associated", "benefits", "change", "clean", "complex", "control", "coordination", "create", "depend", "environmental", "exact", "facilities", "federal", "hazardous"....
0.300
acresboisecenturycontainscontinuedfacilitieshomeidaholandmaintainmanagedmultiplenationalpercentplantreachesrecreationreservoirsresourcesriver
SHARED TOKENS (23): "acres", "boise", "century", "contains", "continued", "facilities", "home", "idaho", "land", "maintain", "managed", "multiple", "national", "percent", "plant", "reaches", "recreation", "reservoirs", "resources", "river"....
0.300
accountapproximatelyfacilitiesfacilityinfrastructuremunicipalproducespropertypublicservedsystemstreatmentunitswastewaterwestern
SHARED TOKENS (15): "account", "approximately", "facilities", "facility", "infrastructure", "municipal", "produces", "property", "public", "served", "systems", "treatment", "units", "wastewater", "western".
0.300
amongcapacitycommunitydistributedelectricelectricityemploymentenergyfarmsgasgenerationincreasinglyinstallationslargestlocalnearoverviewpercentphotovoltaicplans
SHARED TOKENS (37): "among", "capacity", "community", "distributed", "electric", "electricity", "employment", "energy", "farms", "gas", "generation", "increasingly", "installations", "largest", "local", "near", "overview", "percent", "photovoltaic", "plans"....
0.300
adaboisebuiltconstructioncontroldamdirectlydownstreamearthelectricityengineersfederalfloodfullgenerationhydroelectricidahoirrigationlevelmultiple
SHARED TOKENS (34): "ada", "boise", "built", "construction", "control", "dam", "directly", "downstream", "earth", "electricity", "engineers", "federal", "flood", "full", "generation", "hydroelectric", "idaho", "irrigation", "level", "multiple"....
0.300
Off-the-grid ↗ Q267162 KW CROSS HIGH
buildingbuildingscannotconnectedcostelectricalenergyenvironmentalfoodgasgridhomesindependentisolateditselfoff-gridpublicreduceresidentialscale
SHARED TOKENS (28): "building", "buildings", "cannot", "connected", "cost", "electrical", "energy", "environmental", "food", "gas", "grid", "homes", "independent", "isolated", "itself", "off-grid", "public", "reduce", "residential", "scale"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
americanassociationbuildingcommercialdeterminegallonsmechanicalnorthoutsideprocesspublicrapidlyratesrequirementsresidentialstandardssuppliedsupplysystemtechnology
SHARED TOKENS (23): "american", "association", "building", "commercial", "determine", "gallons", "mechanical", "north", "outside", "process", "public", "rapidly", "rates", "requirements", "residential", "standards", "supplied", "supply", "system", "technology"....
0.300
activitiesactivityanalysisbecomesboundariescasesdesignencourageengineerengineeringengineersenvironmentlegallicenselicensedlocalmaintenanceoverviewperformplans
SHARED TOKENS (37): "activities", "activity", "analysis", "becomes", "boundaries", "cases", "design", "encourage", "engineer", "engineering", "engineers", "environment", "legal", "license", "licensed", "local", "maintenance", "overview", "perform", "plans"....
0.300
Sewage treatment ↗ KW CROSS HIGH
accountadvancedapplicationapproximatelyaroundavailabilitybusinessesconnectedconstructioncontainsdemanddesigndifferentdischargeenergyengineersenvironmentevenexpectedfield
SHARED TOKENS (50): "account", "advanced", "application", "approximately", "around", "availability", "businesses", "connected", "construction", "contains", "demand", "design", "different", "discharge", "energy", "engineers", "environment", "even", "expected", "field"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactivitiesactualadditionaladministeredapproximatelyassessmentauthorizesbusinesscannotchemicalcleancompensationconservationcontainscontrolscostculturaldepartment
SHARED TOKENS (64): "acquisition", "act", "activities", "actual", "additional", "administered", "approximately", "assessment", "authorizes", "business", "cannot", "chemical", "clean", "compensation", "conservation", "contains", "controls", "cost", "cultural", "department"....
0.300
aroundassociatedcommercialconnectedcoredesignelectricenergyfleetgasgenerationgridheatedinsidemaintainoperateoperatedplantpowerpressure
SHARED TOKENS (22): "around", "associated", "commercial", "connected", "core", "design", "electric", "energy", "fleet", "gas", "generation", "grid", "heated", "inside", "maintain", "operate", "operated", "plant", "power", "pressure"....
0.300
actaroundauthoritydecisionsenvironmentenvironmentalevaluatefederalfinaljanuarylawmodelednationalpolicypotentialproposedqualityrequirementsrequiresresponsibility
SHARED TOKENS (21): "act", "around", "authority", "decisions", "environment", "environmental", "evaluate", "federal", "final", "january", "law", "modeled", "national", "policy", "potential", "proposed", "quality", "requirements", "requires", "responsibility"....
0.300
becomecoredifferentdisposalfuturemajormakesordinaryplantpowersourcestorageunlesswastewater
SHARED TOKENS (15): "become", "core", "different", "disposal", "future", "major", "makes", "ordinary", "plant", "power", "source", "storage", "unless", "waste", "water".
0.300
airbuildingbuildingsconditioningcontroldesignefficiencyelectricalenergyengineersenvironmentalevaluategreenheatheatinghvacintegratemaintenancemechanicalmodeling
SHARED TOKENS (29): "air", "building", "buildings", "conditioning", "control", "design", "efficiency", "electrical", "energy", "engineers", "environmental", "evaluate", "green", "heat", "heating", "hvac", "integrate", "maintenance", "mechanical", "modeling"....
0.300
actualcaseschangechangescontrolcontrolledcontrolsdownstreamequipmentgasintendedlevelmaintainmaintainsmechanismmechanismsplacingpressureprovidereduces
SHARED TOKENS (26): "actual", "cases", "change", "changes", "control", "controlled", "controls", "downstream", "equipment", "gas", "intended", "level", "maintain", "maintains", "mechanism", "mechanisms", "placing", "pressure", "provide", "reduces"....
0.300
advantagebuildingscommercialdirectlydisposalgroundwaterindustrialinfrastructureplantseparateservedservingsewersurfacesystemsystemstreatmenturbanwastewater
SHARED TOKENS (19): "advantage", "buildings", "commercial", "directly", "disposal", "groundwater", "industrial", "infrastructure", "plant", "separate", "served", "serving", "sewer", "surface", "system", "systems", "treatment", "urban", "wastewater".
0.300
airapproximatelyconstructioncoredesigndirectlyelectricelectricalenergyformgenerationheatinsidelaboratorynationalplantpowerpressureriverseparation
SHARED TOKENS (22): "air", "approximately", "construction", "core", "design", "directly", "electric", "electrical", "energy", "form", "generation", "heat", "inside", "laboratory", "national", "plant", "power", "pressure", "river", "separation"....
0.300
agriculturalaquifereasternfallsgroundwateridahoirrigationlargereservoirriverseparatesnakesourcesouthernwaterwestwestern
SHARED TOKENS (17): "agricultural", "aquifer", "eastern", "falls", "groundwater", "idaho", "irrigation", "large", "reservoir", "river", "separate", "snake", "source", "southern", "water", "west", "western".
0.300
actdepartmenteducationemploymentfederalfirminspectionslaborlawoccupationalratesratingsreduceregulatorysafetysalesstandardstrainingworking
SHARED TOKENS (19): "act", "department", "education", "employment", "federal", "firm", "inspections", "labor", "law", "occupational", "rates", "ratings", "reduce", "regulatory", "safety", "sales", "standards", "training", "working".
0.300
aroundassociationbatterycapacityconsumerconventionaldemandefficiencyelectricelectricalelectricityenergyformgenerationgridhydroelectrichydropowerinstallationsinternationalload
SHARED TOKENS (41): "around", "association", "battery", "capacity", "consumer", "conventional", "demand", "efficiency", "electric", "electrical", "electricity", "energy", "form", "generation", "grid", "hydroelectric", "hydropower", "installations", "international", "load"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancialfinancingfirmfirmsfundslimitedlong-termmanagementoperationalownershipprivate
SHARED TOKENS (27): "business", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financial", "financing", "firm", "firms", "funds", "limited", "long-term", "management", "operational", "ownership", "private"....
0.300
advancedalternativesassociatedbeyondchemicalcontrolledcostenergyfacilitiesformgasheatingmeansnaturalpersonnelplanspotentiallypowerprocessprocesses
SHARED TOKENS (33): "advanced", "alternatives", "associated", "beyond", "chemical", "controlled", "cost", "energy", "facilities", "form", "gas", "heating", "means", "natural", "personnel", "plans", "potentially", "power", "process", "processes"....
0.300
agreementagreementsassetassetsbuildingbuiltbusinessbusinessescasecommercialcontractcontractscustomerdirectlydistributedelectricityenergyfarmsfinancingfirms
SHARED TOKENS (41): "agreement", "agreements", "asset", "assets", "building", "built", "business", "businesses", "case", "commercial", "contract", "contracts", "customer", "directly", "distributed", "electricity", "energy", "farms", "financing", "firms"....
0.300
buildingsbuiltcivilcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsinfrastructurelocallymaintenancemunicipalnationalnaturallyphysicalprivateprofessional
SHARED TOKENS (26): "buildings", "built", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "infrastructure", "locally", "maintenance", "municipal", "national", "naturally", "physical", "private", "professional"....
0.300
acresboisecapacitycomponentsdamdistrictdiversiongenerationhydroelectricidahoirrigationnampanationalnearprogramprojectprovidereclamationrivertreasure
SHARED TOKENS (23): "acres", "boise", "capacity", "components", "dam", "district", "diversion", "generation", "hydroelectric", "idaho", "irrigation", "nampa", "national", "near", "program", "project", "provide", "reclamation", "river", "treasure"....
0.300
actagricultureamericanapproximatelybehindboardboisecapacitycenterconstructiondamdesignearthfallshomehydroelectricidahoirrigationlaborlaw
SHARED TOKENS (40): "act", "agriculture", "american", "approximately", "behind", "board", "boise", "capacity", "center", "construction", "dam", "design", "earth", "falls", "home", "hydroelectric", "idaho", "irrigation", "labor", "law"....
0.300
activitiesboundariescannotcategorieschemicalcontainscurrentdependsdisposaleartheconomicenergyenvironmentgenerationhazardousheathundredsinternationaljointlong-term
SHARED TOKENS (40): "activities", "boundaries", "cannot", "categories", "chemical", "contains", "current", "depends", "disposal", "earth", "economic", "energy", "environment", "generation", "hazardous", "heat", "hundreds", "international", "joint", "long-term"....
0.300
announcedcenterdepartmentdevelopmentefficiencyenergyhomeintegrationjointlaboratorynationaloperatedrenewableresearchsystemstechnologytransportationwind
SHARED TOKENS (18): "announced", "center", "department", "development", "efficiency", "energy", "home", "integration", "joint", "laboratory", "national", "operated", "renewable", "research", "systems", "technology", "transportation", "wind".
0.300
capacitycategoriescustomersdistributionelectricelectricalelectricitylinesneededpowerstationsstructuresubstationssupporttransmissionutilitywater
SHARED TOKENS (17): "capacity", "categories", "customers", "distribution", "electric", "electrical", "electricity", "lines", "needed", "power", "stations", "structure", "substations", "support", "transmission", "utility", "water".
0.300
activitiescomplexdesigndisposaleartheconomicseconomyenergyengineeringenvironmentfieldfunctionindustrialintegratedmultiplenaturalneedsnetworkprocessesresearch
SHARED TOKENS (27): "activities", "complex", "design", "disposal", "earth", "economics", "economy", "energy", "engineering", "environment", "field", "function", "industrial", "integrated", "multiple", "natural", "needs", "network", "processes", "research"....
0.300
authoritybasebecomesbusinesscapitalcommunityconsumercostcustomerdeliverydistributedelectricelectricityenergyformformedgenerationgovernedgrowthinfrastructure
SHARED TOKENS (48): "authority", "base", "becomes", "business", "capital", "community", "consumer", "cost", "customer", "delivery", "distributed", "electric", "electricity", "energy", "form", "formed", "generation", "governed", "growth", "infrastructure"....
0.300
actcommissiondatadescribeddevelopmentdisposalenergyfacilitiesfederalinformationlawmaterialsprivateprocessesproductionprogramprovisionsregulationregulatorysupport
SHARED TOKENS (22): "act", "commission", "data", "described", "development", "disposal", "energy", "facilities", "federal", "information", "law", "materials", "private", "processes", "production", "program", "provisions", "regulation", "regulatory", "support"....
0.300
batteriesbatterychargingcostcurrentdelivereddirectdirectlyelectricelectricalelectricityequipmentgridinstallationpowerproviderequiresstationstationssupplied
SHARED TOKENS (22): "batteries", "battery", "charging", "cost", "current", "delivered", "direct", "directly", "electric", "electrical", "electricity", "equipment", "grid", "installation", "power", "provide", "requires", "station", "stations", "supplied"....
0.300
commercialconnectconnectedconsumerscustomercustomersdeliverydirectlydistributionelectricelectricityequipmentfinalfunctionsgridhouseholdindustriallevellightinglines
SHARED TOKENS (32): "commercial", "connect", "connected", "consumers", "customer", "customers", "delivery", "directly", "distribution", "electric", "electricity", "equipment", "final", "functions", "grid", "household", "industrial", "level", "lighting", "lines"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
agriculturearoundcapitalcommercialcommunitycostdependdifferentenergyinstitutionalirrigationlargepersonnelpolicypressureproviderspublicpumpsqualityregulation
SHARED TOKENS (33): "agriculture", "around", "capital", "commercial", "community", "cost", "depend", "different", "energy", "institutional", "irrigation", "large", "personnel", "policy", "pressure", "providers", "public", "pumps", "quality", "regulation"....
🫐 BERRY23 edges
0.280
capitalcostdistributionelectricelectricalincreaselinesoperatingpowerqualityreducerisksupplytransmission
SHARED TOKENS (14): "capital", "cost", "distribution", "electric", "electrical", "increase", "lines", "operating", "power", "quality", "reduce", "risk", "supply", "transmission".
0.280
competedistributionelectricitygaslinesmajornationalnaturalprocesspublictrafficutilitywastewaterwater
SHARED TOKENS (14): "compete", "distribution", "electricity", "gas", "lines", "major", "national", "natural", "process", "public", "traffic", "utility", "wastewater", "water".
0.260
americanbuiltdeliveredequipmenthospitalsinformationinstitutionsmajorpreferredprogramresearchsuppliedtitle
SHARED TOKENS (13): "american", "built", "delivered", "equipment", "hospitals", "information", "institutions", "major", "preferred", "program", "research", "supplied", "title".
0.260
authorityboundariesdesignateddistrictentityirrigationlargelocalorganizedpowerprojectspublicwater
SHARED TOKENS (13): "authority", "boundaries", "designated", "district", "entity", "irrigation", "large", "local", "organized", "power", "projects", "public", "water".
0.260
actaprildesignationdisposaldistrictfederaljurisdictionlawleastnationalpolicyprogramwaste
SHARED TOKENS (13): "act", "april", "designation", "disposal", "district", "federal", "jurisdiction", "law", "least", "national", "policy", "program", "waste".
0.260
agricultureconstructioncontrolcontrollingcontrolsdevelopmenthabitatlandpropertyriversurfacewaterwind
SHARED TOKENS (13): "agriculture", "construction", "control", "controlling", "controls", "development", "habitat", "land", "property", "river", "surface", "water", "wind".
0.240
builteasternelectricalgrididaholaboratorynationalpowersafetystationsupplywater
SHARED TOKENS (12): "built", "eastern", "electrical", "grid", "idaho", "laboratory", "national", "power", "safety", "station", "supply", "water".
0.240
disposaldiversionfacilitylandfillmanagementmaterialsmunicipalprocessprogramtransfertreatmentwaste
SHARED TOKENS (12): "disposal", "diversion", "facility", "landfill", "management", "materials", "municipal", "process", "program", "transfer", "treatment", "waste".
0.220
basecapacityconstructioncostdemandefficiencyelectricityloadplantpowerproducing
SHARED TOKENS (11): "base", "capacity", "construction", "cost", "demand", "efficiency", "electricity", "load", "plant", "power", "producing".
0.220
centuryfullgenerationmultipleoperatedoperationplantpowerprojectsresearchtechnology
SHARED TOKENS (11): "century", "full", "generation", "multiple", "operated", "operation", "plant", "power", "projects", "research", "technology".
0.210
December 20 ↗ Q2455 EXACT TITLE
remain
SHARED TOKENS (1): "remain". | EXACT TITLE in nuclear_clean_energy: "December 20".
0.200
EXACT TITLE in energy_utilities: "Suez (disambiguation)".
0.200
actconservationdisposalfederalgoverninghazardouslawrecoveryresourcewaste
SHARED TOKENS (10): "act", "conservation", "disposal", "federal", "governing", "hazardous", "law", "recovery", "resource", "waste".
0.200
codedisposalfoodmunicipalmunicipalitypublicroleseparatelyunionwaste
SHARED TOKENS (10): "code", "disposal", "food", "municipal", "municipality", "public", "role", "separately", "union", "waste".
0.180
Brownlee Dam ↗ Q4976595 KW CROSS HIGH
canyondamearthhydroelectricidahoreservoirriversnakewestern
SHARED TOKENS (9): "canyon", "dam", "earth", "hydroelectric", "idaho", "reservoir", "river", "snake", "western".
0.180
Effluent ↗ Q1057706 KW CROSS HIGH
differentdirectlyfacilityindustrialriversourcesurfacewastewastewater
SHARED TOKENS (9): "different", "directly", "facility", "industrial", "river", "source", "surface", "waste", "wastewater".
0.140
chaindisposaloperationpreparationprocessproductionrecycling
SHARED TOKENS (7): "chain", "disposal", "operation", "preparation", "process", "production", "recycling".
0.140
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboisedowntowneagleidahonorthwestpopulation
SHARED TOKENS (7): "ada", "boise", "downtown", "eagle", "idaho", "northwest", "population".
0.120
commissionenergypowerprogramsafetytest
SHARED TOKENS (6): "commission", "energy", "power", "program", "safety", "test".
0.120
Oxbow Dam ↗ Q7115136 KW CROSS HIGH
canyondamhydroelectricriversnakewestern
SHARED TOKENS (6): "canyon", "dam", "hydroelectric", "river", "snake", "western".
0.120
Plumber ↗ Q252924 KW CROSS HIGH
hot-waterinstallingplumbingproductionsystemswater
SHARED TOKENS (6): "hot-water", "installing", "plumbing", "production", "systems", "water".
0.100
managementstationtransfertransportationwaste
SHARED TOKENS (5): "management", "station", "transfer", "transportation", "waste".
0.100
developmentelectricityhistorypowerproject
SHARED TOKENS (5): "development", "electricity", "history", "power", "project".
◈ Frequently Asked Questions
Nuclear Clean Energy × Energy Utilities — Treasure Valley
HAIKU · HIGH GATE
How would nuclear generation capacity change Idaho Power's role in the Treasure Valley electricity supply?
Idaho Power currently relies on hydroelectricity from Snake River dams and thermal generation to serve Boise and surrounding areas. Adding nuclear generation capacity would allow Idaho Power to reduce dependence on seasonal water availability managed by the Bureau of Reclamation while maintaining consistent electricity supply to Treasure Valley substations year-round.
What regulatory authority oversees nuclear energy projects affecting Treasure Valley utilities?
The Idaho Public Utilities Commission regulates how Idaho Power integrates any new generation sources, including nuclear facilities, into the regional electricity system serving the Treasure Valley. Commission approval is required before Idaho Power can invest in nuclear capacity or modify rates affecting Boise customers.
How could nuclear energy support demand response programs in the Treasure Valley?
Nuclear plants provide stable baseload electricity generation that allows Idaho Power to implement demand response initiatives at Treasure Valley substations and industrial facilities. This consistent power supply reduces strain during peak demand periods, enabling more effective electricity management across Boise and surrounding communities.
What workforce development would nuclear energy require from Treasure Valley utilities?
Nuclear facilities require specialized apprenticeship training and technical expertise that Boise State University and Idaho Power could help develop through partnership programs. The Treasure Valley workforce would need training in reactor operations, maintenance, and grid integration to support nuclear generation operations serving regional electricity demand.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Nuclear Clean Energy × Energy Utilities 47 QID bridges 237 edges 6,243 ext links 2026-07-17 22:31:16 UTC 6d855e7e1226a928
Nuclear Clean Energy corridor ↗ Energy Utilities corridor ↗ Energy Utilities × Nuclear Clean Energy ↗ boisestandard.org/standard ↗
Parent Corridors
Nuclear Clean Energy × All Other Verticals