—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

History ↔ relates to ↔ Wildlife Landscape

15 Wikipedia bridge articles confirmed in both vertical ledgers. 206 deterministic cross-vertical edges. 5,114 external source links harvested. Every edge provenance-stamped. Every claim auditable.

15 QID Bridge Articles
206 Cross Edges
5,114 External Sources
234 Wikipedia Articles
18 🌲 Evergreen
155 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
History
× Wildlife Landscape
QID Bridge Articles
15
confirmed Wikipedia overlap
Total Cross Edges
206
External Sources Harvested
5,114
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Bureau of Reclamation
score: 1.0000  ·  type: exact_title_cross  ·  36 shared tokens
QID Bridge Titles (15)
Bureau of ReclamationUnited States Forest ServiceTreasure ValleyArrowrock DamSnake RiverBoise, IdahoAnderson Ranch DamSnake River PlainEndangered Species Act of 1973Diversion Dam and Deer Flat EmbankmentsAda County, IdahoNampa, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boisewesternrivernationalmetropolitansouthwesterneastmilespopulationbureauirrigationlargesthydroelectricreclamationwatermajororegonvalleydamcanyon
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:17:42 UTC
Content Hash
de92c9c71eb63a7a
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
15 BRIDGES
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (36): "acres", "act", "agency", "become", "built", "bureau", "congress", "department", "development", "established", "farmers", "farmland", "federal", "funding", "generation", "geological", "government", "hydroelectric", "irrigation", "lands".... | EXACT TITLE in history: "Bureau of Reclamation". | EXACT TITLE in wildlife_landscape: "Bureau of Reclamation".
acresactagencybecomebuiltbureaucongressdepartmentdevelopmentestablishedfarmersfarmlandfederalfundinggenerationgeologicalgovernmenthydroelectricirrigationlandslargestlawmanagementmillionpeoplepowerprogramprojectsprovidingreclamation+6
power generation. It is currently the U.S.'s largest wholesaler of water, bringing water to more than 31 million people, and providing one in five Western farmers with irrigation water for 10 million acres of farmland, which produce 60% of the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
United States Forest Service
EXACT TITLE 1.000
QID OVERLAP: Q1891156 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (23): "acres", "agency", "agriculture", "bureau", "covering", "department", "development", "federal", "fish", "forest", "forests", "land", "lands", "major", "management", "manages", "million", "national", "operations", "private".... | EXACT TITLE in history: "United States Forest Service".
acresagencyagriculturebureaucoveringdepartmentdevelopmentfederalfishforestforestslandlandsmajormanagementmanagesmillionnationaloperationsprivateresearchsystemwildlife
e United States Forest Service (USFS) is an agency within the United States Department of Agriculture. It administers the nation's 154 national forests and 20 national grasslands covering 193 million acres (780,000 km2) of land. The major divisions of the agency are the Chief's Office, National Forest System, State and Private Forestry, Business Operations, as well as Research and Development. The agency manages about 25% of federal lands and is the sole major national land management agency not part of the U.S. Department of the Interior (which manages the National Park Service, the U.S.
In 1876, Congress formed the office of Special Agent in the Department of Agriculture to assess the quality and conditions of forests in the United States. Franklin B. Hough was appointed the head of the office. In 1881, the office was expanded into the newly formed Division of Forestry. The Forest Reserve Act of 1891 authorized withdrawing land from the public domain as forest reserves managed by the Department of the Interior. In 1901, the Division of Forestry was renamed the Bureau of Forestry. The Transfer Act of 1905 transferred the management of forest reserves from the United States General Land Office of the Interior Department to the Bureau of Forestry, henceforth known as the United States Forest Service. Gifford Pinchot was the first United States chief forester in the presidency of Theodore Roosevelt. A historical note to include is that the National Park Service was created in 1916 to manage Yellowstone and several other parks; in 1956, the Fish and Wildlife Service became the manager of lands reserved for wildlife. The Grazing Service and the United States General Land Office were combined to create the Bureau of Land Management in 1946. Also of note was that it was not until 1976 that the Federal Land Policy and Management Act became the national policy for retaining public land for federal ownership. Significant federal legislation affecting the Forest Service includes the Weeks Act of 1911, the Taylor Grazing Act of 1934, P.L. 73-482; the Multiple Use – Sustained Yield Act of 1960, P.L. 86-517; the Wilderness Act, P.L. 88-577; the National Forest Management Act, P.L. 94-588; the National Environmental Policy Act, P.L. 91–190; the Cooperative Forestry Assistance Act, P.L. 95-313; and the Forest and Rangelands Renewable Resources Planning Act, P.L. 95-307. From the early 1900s to the present, there has been a fierce rivalry over control of forests between the Department of Agriculture and the Department of the Interior. Their roles overlap but numerous proposals to combine the two have failed. In 2009, the Government Accountability Office (GAO) evaluated whether the Forest Service should be moved from the Department of Agriculture to the Department of the Interior, which already manages some 438 million acres (1,770,000 km2) of public land through the National Park Service, the Fish and Wildlife Service, and the Bureau of Land Management. GAO ultimately did not offer a recommendation upon the conclusion of its performance audit. The Forest Service remains a part of the USDA. In March 2026, President Donald Trump announced his plans to move the Forest Service's headquarters from Washington D.C.
As of 2019, FY 2020 Forest Service total budget authority is $5.14 billion, a decrease of $815 million from 2019. The budget includes $2.4 billion for Wildland Fire Management, a decrease of $530 million from the 2019 Annualized Continuing Resolution because the "fire fix" cap adjustment becomes available in FY 2020, while the FY 2019 Annualized Continuing Resolution includes $500 million above the base as bridge to the first year of the fire fix. The Forest Service, headquartered in Washington, D.C., has 27,062 permanent, full-time employees as of Sept. 20, 2018, including 541 in the headquarters office and 26,521 in regional and field office. In March 2026, the Forest Service announced the move of its main office to Salt Lake City, Utah, as part of a restructuring plan so their leaders can be closer to the forests and the people they serve in the West. The Chief of the Forest Service is a career federal employee who oversees the agency. The Chief reports to the Under Secretary for Natural Resources and Environment in the U.S. Department of Agriculture, an appointee of the President confirmed by the Senate. The Chief's staff provides broad policy and direction for the agency, works with the Administration to develop a budget to submit to Congress, provides information to Congress on accomplishments, and monitors activities of the agency. There are five deputy chiefs for the following areas: National Forest System, State and Private Forestry, Research and Development, Business Operations, and Finance. The USDA Forest Service's mission is to sustain the health, diversity, and productivity of the Nation's forests and grasslands to meet the needs of present and future generations. Its motto is "Caring for the land and serving people." As the lead federal agency in natural resource conservation, the Forest Service provides leadership in the protection, management, and use of the nation's forest, rangeland, and aquatic ecosystems. The agency's ecosystem approach to management integrates ecological, economic, and social factors to maintain and enhance the quality of the environment to meet current and future needs. Through implementation of land and resource management plans, the agency ensures sustainable ecosystems by restoring and maintaining species diversity and ecological productivity that helps provide recreation, water, timber, minerals, fish, wildlife, wilderness, and aesthetic values for current and future generations of people. The everyday work of the Forest Service balances resource extraction, resource protection, and providing recreation. The work includes managing 193 million acres (780,000 km2) of national forest and grasslands, including 59 million acres (240,000 km2) of roadless areas; 14,077 recreation sites; 143,346 miles (230,693 km) of trails; 374,883 miles (603,316 km) of roads; and the harvesting of 1.5 billion trees per year. Further, the Forest Service fought fires on 2.996 million acres (12,120 km2) of land in 2007. The Forest Service organization includes ranger districts, national forests, regions, research stations and research work units and the Northeastern Area Office for State and Private Forestry.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (21): "agricultural", "boise", "diverse", "eastern", "historically", "land", "local", "lower", "metropolitan", "name", "oregon", "primarily", "region", "resources", "river", "rivers", "snake", "southwestern", "treasure", "valley".... | EXACT TITLE in history: "Treasure Valley". | EXACT TITLE in wildlife_landscape: "Treasure Valley".
agriculturalboisediverseeasternhistoricallylandlocallowermetropolitannameoregonprimarilyregionresourcesriverriverssnakesouthwesterntreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Arrowrock Dam
Q117911 EXACT TITLE 1.000
QID OVERLAP: Q117911 in history (tier:evergreen) and wildlife_landscape (tier:branch). | SHARED TOKENS (25): "ago", "agriculture", "american", "arrowrock", "boise", "bureau", "dam", "designated", "east", "feet", "historic", "irrigation", "lucky", "national", "operated", "peak", "primary", "purpose", "reclamation", "reservoir".... | EXACT TITLE in history: "Arrowrock Dam".
agoagricultureamericanarrowrockboisebureaudamdesignatedeastfeethistoricirrigationluckynationaloperatedpeakprimarypurposereclamationreservoirriversocietysouthwesternwaterwestern
Arrowrock Dam is a concrete arch dam in the western United States, on the Boise River in southwestern Idaho, east of Boise. Opened 111 years ago in 1915, it is located on the border of Boise and Elmore counties, upstream of the Lucky Peak Dam and reservoir. The spillway elevation for Arrowrock is 3,219 feet (981 m) above sea level and its primary purpose is to provide irrigation water for agriculture. The dam was designated as a National Historic Civil Engineering Landmark by the American Society of Civil Engineers in 2016, and is operated by the U.S.
In 1910, the Reclamation Service began to consider another storage facility farther east on the Boise River. After several surveys, engineers decided upon the Arrowrock site which had previously been the site of a private irrigation venture under the direction of Arthur De Wint Foote yet failed for lack of funding. The Arrowrock site is at the confluence of the main channel and the south fork. That was to be the most ambitious project to date for Reclamation. At 348 feet (106 m), Arrowrock would be the largest concrete arch dam in the world. Prior to construction, considerable preparatory work would need to be completed. As the structure was some twenty miles (32 km) upstream from the Boise River Diversion Dam, routing supplies to the worksite would be a massive undertaking unto itself. The Reclamation Service elected to construct a new rail line on the old wagon road leading north to Idaho City. The railroad would begin at the Barberton mill near the Diversion Dam and extend to through a winding canyon up to Arrowrock. Even before the dam had been approved, Reclamation began work on the rail line. Some significant problems existed with construction of the railroad. The Barberton Lumber Company owned the road's right-of-way. That meant that the Reclamation Service needed to come to an agreement over ownership of the rail line. In an unprecedented move, the government agreed to lease the track from Barberton but run the actual locomotive. Part of this agreement stipulated that the line would remain a common carrier. That made the Arrowrock & Boise Railroad the first publicly owned line in the nation. The Service hid this fact from President William Howard Taft when it applied for the Arrowrock Dam's approval. Fortunately for Reclamation, Taft failed to recognize the loophole and in June 1910, the entire project went forward. However, when the Oregon Shortline refused to honor the pact between Barberton and Reclamation, the Arrowrock & Boise terminal was reduced to a field just outside the Barber lumberyard. On August 22, 1910, the entire deal was finalized and work began on the line to the Arrowrock site. Salt Lake City's Manly Brothers won the contract for grading the Arrowrock & Boise road in May 1911. The government called for force account to lay the track from Barber to the work site. Although the construction was delayed several times by the shortage of railroad ties, workers finished the track in early November. By most accounts, the trip through the canyon was a very long and harrowing event. For the first several months, riders were asked to disembark at the unfinished Gooseneck Bridge while the cars were winched across one at a time. However, once they arrived, most passengers were surprised by what they found. Not only was the view breathtaking but the "work" camp offered amenities that were unavailable to some residents of the Treasure Valley. Not only was the site fully powered, but also it provided a central heating plant, running water and an efficient sewage system. Along with the Reclamation offices, the Arrowrock camp carried a hospital, mess hall, post office, and hotel. Workers and visitors were offered lodging in the site's hotel, bunkhouses, or cottages. In addition to the outdoor recreational activities, the camp also operated a YMCA, school, and dancehall. At the peak of construction, some 1,400 people had called Arrowrock home, including some 200 families. To provide power for the site, Reclamation retrofitted The Boise River Diversion Dam with a small powerhouse. Finished in 1912, the plant's three generators produced 1,500 kilowatts of electricity for Arrowrock's camp, sawmills, and giant cement mixers. The German made Allis-Chalmers 725 horsepower (541 kW) turbines, the first in the world to be built with a vertical shaft design. Along with the power lines, government workers hung a two-way phone cable to connect Arrowrock with the outside world. In 1976, the power plant was added to the National Register of Historic Places. After being refurbished by the Bonneville Power Administration in 2002, it is now on ready reserve status and occasionally provides surplus power during times of peak demand. Special care was made to maintain the historic qualities of the powerhouse.
Arrowrock is 3,219 feet (981 m) above sea level and its primary purpose is to provide irrigation water for agriculture. The dam was designated as a National Historic Civil Engineering Landmark by the American Society of Civil Engineers in 2016, and is operated by the U.S. Bureau of Reclamation. Preparations In 1910, the Reclamation Service began to consider another storage facility farther east on the Boise River. After several surveys, engineers decided upon the Arrowrock site which had previously been the site of a private irrigation venture under the direction of Arthur De Wint Foote yet failed for lack of funding. The Arrowrock site is at the confluence of the main channel and the south fork. That was to be the most ambitious project to date for Reclamation. At 348 feet (106 m), Arrowrock would be the largest concrete arch dam in the world. Prior to construction, considerable preparatory work would need to be completed. As the structure was some twenty miles (32 km) upstream from the Boise River Diversion Dam, routing supplies to the worksite would be a massive undertaking unto itself. The Reclamation Service elected to construct a new rail line on the old wagon road leading north to Idaho City. The railroad would begin at the Barberton mill near the Diversion Dam and extend to through a winding canyon up to Arrowrock. Even before the dam had been approved, Reclamation began work on the rail line. Some significant problems existed with construction of the railroad. The Barberton Lumber Company owned the road's right-of-way. That meant that the Reclamation Service needed to come to an agreement over ownership of the rail line. In an unprecedented move, the government agreed to lease the track from Barberton but run the actual locomotive. Part of this agreement stipulated that the line would remain a common carrier. That made the Arrowrock & Boise Railroad the first publicly owned line in the nation. The Service hid this fact from President William Howard Taft when it applied for the Arrowrock Dam's approval. Fortunately for Reclamation, Taft failed to recognize the loophole and in June 1910, the entire project went forward. However, when the Oregon Shortline refused to honor the pact between Barberton and Reclamation, the Arrowrock & Boise terminal was reduced to a field just outside the Barber lumberyard. On August 22, 1910, the entire deal was finalized and work began on the line to the Arrowrock site. Salt Lake City's Manly Brothers won the contract for grading the Arrowrock & Boise road in May 1911. The government called for force account to lay the track from Barber to the work site. Although the construction was delayed several times by the shortage of railroad ties, workers finished the track in early November. By most accounts, the trip through the canyon was a very long and harrowing event. For the first several months, riders were asked to disembark at the unfinished Gooseneck Bridge while the cars were winched across one at a time. However, once they arrived, most passengers were surprised by what they found. Not only was the view breathtaking but the "work" camp offered amenities that were unavailable to some residents of the Treasure Valley. Not only was the site fully powered, but also it provided a central heating plant, running water and an efficient sewage system. Along with the Reclamation offices, the Arrowrock camp carried a hospital, mess hall, post office, and hotel. Workers and visitors were offered lodging in the site's hotel, bunkhouses, or cottages. In addition to the outdoor recreational activities, the camp also operated a YMCA, school, and dancehall. At the peak of construction, some 1,400 people had called Arrowrock home, including some 200 families. To provide power for the site, Reclamation retrofitted The Boise River Diversion Dam with a small powerhouse. Finished in 1912, the plant's three generators produced 1,500 kilowatts of electricity for Arrowrock's camp, sawmills, and giant cement mixers. The German made Allis-Chalmers 725 horsepower (541 kW) turbines, the first in the world to be built with a vertical shaft design. Along with the power lines, government workers hung a two-way phone cable to connect Arrowrock with the outside world. In 1976, the power plant was added to the National Register of Historic Places. After being refurbished by the Bonneville Power Administration in 2002, it is now on ready reserve status and occasionally provides surplus power during times of peak demand. Special care was made to maintain the historic qualities of the powerhouse.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (79): "activities", "agencies", "ago", "altered", "american", "basin", "beaver", "beginning", "canyon", "catastrophic", "central", "century", "clark", "conflict", "constructed", "construction", "control", "created", "dam", "dams".... | EXACT TITLE in history: "Snake River". | EXACT TITLE in wildlife_landscape: "Snake River".
activitiesagenciesagoalteredamericanbasinbeaverbeginningcanyoncatastrophiccentralcenturyclarkconflictconstructedconstructioncontrolcreateddamdamsdecadesdesertdevelopedeasteasternfarmlandfeaturesfishfishingflood+49
and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in history (tier:evergreen) and wildlife_landscape (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "downtown", "east", "estimated", "feet", "home", "major", "metropolitan", "miles", "north", "oregon", "population", "river", "southwestern", "treasure", "valley". | EXACT TITLE in history: "Boise, Idaho".
adaannualboisecapitaldowntowneastestimatedfeethomemajormetropolitanmilesnorthoregonpopulationriversouthwesterntreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Anderson Ranch Dam
Q4754153 EXACT TITLE 1.000
QID OVERLAP: Q4754153 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (49): "act", "ago", "agriculture", "american", "anderson", "approximately", "arrowrock", "beginning", "boise", "bureau", "capacity", "center", "changed", "congress", "construction", "dam", "december", "feet", "forest", "home".... | EXACT TITLE in history: "Anderson Ranch Dam". | EXACT TITLE in wildlife_landscape: "Anderson Ranch Dam".
actagoagricultureamericanandersonapproximatelyarrowrockbeginningboisebureaucapacitycenterchangedcongressconstructiondamdecemberfeetforesthomehydroelectricirrigationlawmaterialsmilesmountainmountainsnationalnorthoperated+19
began in 1941 and experienced numerous challenges with materials, fuel, and labor shortages during World War II. Work was halted for over nine months beginning in late December 1942. The Reclamation Act of 1902 had racial exclusions on labor which were strictly adhered to until Congress changed the law in 1943. This allowed Japanese American internees to work on Reclamation projects; Anderson Ranch utilized internees from the Minidoka War Relocation Center, northeast of Twin Falls. The South Fork of the Boise River originates in the Smoky Mountains north of Fairfield. Its watershed includes portions of the Smoky Mountains, Soldier Mountains, Boise National Forest, and Sawtooth National Forest. Below the dam, the South Fork flows northwestward into the reservoir behind the concrete Arrowrock Dam, completed in 1915. The Bureau of Reclamation and Idaho Water Resource Board are working on raising the dam by six feet (1.8 m), resulting in approximately 29,000 acre-feet (35,800,000 m3) of new storage space.
the Boise River in southwestern Idaho. In Elmore County northeast of Mountain Home, it is several miles north of U.S. Route 20 and operated by the U.S. Bureau of Reclamation. When completed 76 years ago in 1950, Anderson Ranch was the tallest dam of its type in the world. Its primary purpose is to provide irrigation water for agriculture, with a secondary purpose of hydroelectric power. Its generating capacity was increased from 27 to 40 MW in 1986. Its reservoir has a spillway elevation of 4,196 feet (1,280 m) above sea level. The construction of the dam began in 1941 and experienced numerous challenges with materials, fuel, and labor shortages during World War II. Work was halted for over nine months beginning in late December 1942. The Reclamation Act of 1902 had racial exclusions on labor which were strictly adhered to until Congress changed the law in 1943. This allowed Japanese American internees to work on Reclamation projects; Anderson Ranch utilized internees from the Minidoka War Relocation Center, northeast of Twin Falls. The South Fork of the Boise River originates in the Smoky Mountains north of Fairfield. Its watershed includes portions of the Smoky Mountains, Soldier Mountains, Boise National Forest, and Sawtooth National Forest. Below the dam, the South Fork flows northwestward into the reservoir behind the concrete Arrowrock Dam, completed in 1915. The Bureau of Reclamation and Idaho Water Resource Board are working on raising the dam by six feet (1.8 m), resulting in approximately 29,000 acre-feet (35,800,000 m3) of new storage space.
d operated by the U.S. Bureau of Reclamation. When completed 76 years ago in 1950, Anderson Ranch was the tallest dam of its type in the world. Its primary purpose is to provide irrigation water for agriculture, with a secondary purpose of hydroelectric power. Its generating capacity was increased from 27 to 40 MW in 1986. Its reservoir has a spillway elevation of 4,196 feet (1,280 m) above sea level. The construction of the dam began in 1941 and experienced numerous challenges with materials, fuel, and labor shortages during World War II. Work was halted for over nine months beginning in late December 1942. The Reclamation Act of 1902 had racial exclusions on labor which were strictly adhered to until Congress changed the law in 1943. This allowed Japanese American internees to work on Reclamation projects; Anderson Ranch utilized internees from the Minidoka War Relocation Center, northeast of Twin Falls. The South Fork of the Boise River originates in the Smoky Mountains north of Fairfield. Its watershed includes portions of the Smoky Mountains, Soldier Mountains, Boise National Forest, and Sawtooth National Forest. Below the dam, the South Fork flows northwestward into the reservoir behind the concrete Arrowrock Dam, completed in 1915. The Bureau of Reclamation and Idaho Water Resource Board are working on raising the dam by six feet (1.8 m), resulting in approximately 29,000 acre-feet (35,800,000 m3) of new storage space.
Snake River Plain
Q1396049 EXACT TITLE 0.960
QID OVERLAP: Q1396049 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (13): "agricultural", "big", "cities", "east", "land", "largest", "major", "miles", "plain", "primarily", "river", "snake", "southern". | EXACT TITLE in history: "Snake River Plain". | EXACT TITLE in wildlife_landscape: "Snake River Plain".
agriculturalbigcitieseastlandlargestmajormilesplainprimarilyriversnakesouthern
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
e of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
Endangered Species Act of 1973
Q2743374 QID OVERLAP 0.800
QID OVERLAP: Q2743374 in history (tier:evergreen) and wildlife_landscape (tier:evergreen). | SHARED TOKENS (27): "act", "agencies", "authority", "conservation", "december", "described", "development", "different", "economic", "endangered", "federal", "fish", "fisheries", "growth", "international", "law", "national", "needed", "point", "preservation"....
actagenciesauthorityconservationdecemberdescribeddevelopmentdifferenteconomicendangeredfederalfishfisheriesgrowthinternationallawnationalneededpointpreservationprimaryprotectprotectingrequiresspecieswildwildlife
The Endangered Species Act of 1973 (ESA; 16 U.S.C. § 1531 et seq.) is the primary law in the United States for protecting and conserving imperiled species. Designed to protect critically imperiled species from extinction as a "consequence of economic growth and development untempered by adequate concern and conservation", the ESA was signed into law by President Richard Nixon on December 28, 1973. The U.S. Supreme Court described it as "the most comprehensive legislation for the preservation of endangered species enacted by any nation". The purposes of the ESA are two-fold: to prevent extinction and to recover species to the point where the law's protections are not needed. It therefore "protect[s] species and the ecosystems upon which they depend" through different mechanisms. For example, section 4 requires the agencies overseeing the ESA to designate imperiled species as threatened or endangered. Section 9 prohibits unlawful 'take,' of such species, which means to "harass, harm, hunt..." Section 7 directs federal agencies to use their authorities to help conserve listed species. The ESA also serves as the enacting legislation to carry out the provisions outlined in The Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES). The Act is administered by two federal agencies, the United States Fish and Wildlife Service (FWS) and the National Marine Fisheries Service (NMFS).
", the ESA was signed into law by President Richard Nixon on December 28, 1973. The U.S. Supreme Court described it as "the most comprehensive legislation for the preservation of endangered species enacted by any nation". The purposes of the ESA are two-fold: to prevent extinction and to recover species to the point where the law's protections are not needed. It therefore "protect[s] species and the ecosystems upon which they depend" through different mechanisms. For example, section 4 requires the agencies overseeing the ESA to designate imperiled species as threatened or endangered. Section 9 prohibits unlawful 'take,' of such species, which means to "harass, harm, hunt..." Section 7 directs federal agencies to use their authorities to help conserve listed species. The ESA also serves as the enacting legislation to carry out the provisions outlined in The Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES). The Act is administered by two federal agencies, the United States Fish and Wildlife Service (FWS) and the National Marine Fisheries Service (NMFS).
bits unlawful 'take,' of such species, which means to "harass, harm, hunt..." Section 7 directs federal agencies to use their authorities to help conserve listed species. The ESA also serves as the enacting legislation to carry out the provisions outlined in The Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES). The Act is administered by two federal agencies, the United States Fish and Wildlife Service (FWS) and the National Marine Fisheries Service (NMFS).
Diversion Dam and Deer Flat Embankments
Q19573781 QID OVERLAP 0.800
QID OVERLAP: Q19573781 in history (tier:evergreen) and wildlife_landscape (tier:branch). | SHARED TOKENS (27): "acres", "boise", "bureau", "capacity", "dam", "dams", "farmland", "generation", "historic", "hydroelectric", "irrigation", "lower", "name", "nampa", "national", "near", "place", "places", "program", "project"....
acresboisebureaucapacitydamdamsfarmlandgenerationhistorichydroelectricirrigationlowernamenampanationalnearplaceplacesprogramprojectreclamationriversouthwesterntreasurevalleywaterwestern
western United States in southwestern Idaho, near Boise and Nampa. The dams are components of the U.S. Bureau of Reclamation's Boise Project, and were designed to provide irrigation water to 500,000 acres (780 mi2; 2,000 km2) of Treasure Valley farmland in conjunction with the New York Irrigation District (New York Canal). The Boise River Diversion Dam also provides hydroelectric generation capacity.
ise Project, and were designed to provide irrigation water to 500,000 acres (780 mi2; 2,000 km2) of Treasure Valley farmland in conjunction with the New York Irrigation District (New York Canal). The Boise River Diversion Dam also provides hydroelectric generation capacity.
ver Diversion Dam also provides hydroelectric generation capacity. The dams were listed on the National Register in 1976. The three dams that make up the Diversion Dam and Deer Flat Embankments are: Boise River Diversion Dam Deer Flat Upper Embankment Deer Flat Lower Embankment See also National Register of Historic Places listings in Ada County, Idaho National Register of Historic Places listings in Canyon County, Idaho Deer Flat National Wildlife Refuge
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in history (tier:branch) and wildlife_landscape (tier:branch). | SHARED TOKENS (15): "ada", "boise", "capital", "east", "estimated", "far", "home", "largest", "local", "metropolitan", "pacific", "population", "private", "roads", "southwestern".
adaboisecapitaleastestimatedfarhomelargestlocalmetropolitanpacificpopulationprivateroadssouthwestern
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in history (tier:branch) and wildlife_landscape (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "home", "meridian", "metropolitan", "miles", "name", "nampa", "population", "university", "west", "western".
boisecanyonhomemeridianmetropolitanmilesnamenampapopulationuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in history (tier:branch) and wildlife_landscape (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "east", "metropolitan", "miles", "oregon", "population", "west".
approximatelyboisecaldwellcanyoneastmetropolitanmilesoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in history (tier:branch) and wildlife_landscape (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedlargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in history (tier:branch) and wildlife_landscape (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "cities", "making", "meridian", "population".
adaamongboisecapitalcitiesmakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
191 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP191 edges
🌲 EVERGREEN3 edges
0.650
blackboisecapitalconnectscreateddepartmentdowntowneastgreenbelthistorylandnorthoperatedparksrecreationregionriversocietysouthuniversity
SHARED TOKENS (22): "black", "boise", "capital", "connects", "created", "department", "downtown", "east", "greenbelt", "history", "land", "north", "operated", "parks", "recreation", "region", "river", "society", "south", "university".... | URL->A (1): https://www.cityofboise.org/departments/parks-and-recreation/parks/julia-davis-park/. | EXACT TITLE in history: "Julia Davis Park".
0.650
acresbigburnburnedclarkcombinationcongressconservationdestroyeddevelopmenteasternestimatedfirefiresforestforestsgreathistoryhumanhundreds
SHARED TOKENS (40): "acres", "big", "burn", "burned", "clark", "combination", "congress", "conservation", "destroyed", "development", "eastern", "estimated", "fire", "fires", "forest", "forests", "great", "history", "human", "hundreds".... | URL->A (1): https://foresthistory.org/research-explore/us-forest-service-history/policy-and-law/fire-u-s-forest-service/famous-fires/the-1910-fires/. | EXACT TITLE in history: "Great Fire of 1910".
0.630
agencyarchivesculturalestablishedfoundedhistoricmaterialofficialplacespreservationprogrampublicsitessociety
SHARED TOKENS (14): "agency", "archives", "cultural", "established", "founded", "historic", "material", "official", "places", "preservation", "program", "public", "sites", "society". | URL->A (1): http://www.history.idaho.gov/. | EXACT TITLE in history: "Idaho State Historical Society".
🌿 BRANCH155 edges
0.500
Elk ↗ Q180404 EXACT TITLE
americaamericanamonganimalanimalsanotheraroundbeginningcanadacentraleastevidenceforestgamegrazinggroundhigherkeylargelargest
SHARED TOKENS (41): "america", "american", "among", "animal", "animals", "another", "around", "beginning", "canada", "central", "east", "evidence", "forest", "game", "grazing", "ground", "higher", "key", "large", "largest".... | EXACT TITLE in history: "Elk". | EXACT TITLE in wildlife_landscape: "Elk".
0.500
alpineamericaamongbecomingcountrydeepdifferentdistributedfishgamegreatlakelargenativenorthpopulationsregionalremainsriverrivers
SHARED TOKENS (26): "alpine", "america", "among", "becoming", "country", "deep", "different", "distributed", "fish", "game", "great", "lake", "large", "native", "north", "populations", "regional", "remains", "river", "rivers".... | EXACT TITLE in wildlife_landscape: "Brown trout".
0.500
Abraham Lincoln ↗ Q91 EXACT TITLE
actactionamericanamongaprilbecomingcongresscorpusfollowingfoundfrontiergreatesthistorymajornationalnovemberpreserverolesouthernstrategy
SHARED TOKENS (20): "act", "action", "american", "among", "april", "becoming", "congress", "corpus", "following", "found", "frontier", "greatest", "history", "major", "national", "november", "preserve", "role", "southern", "strategy". | EXACT TITLE in history: "Abraham Lincoln".
0.500
acresactagenciesagencyamericanamongapproximatelybureaucaliforniacongressconservationcreateddepartmentdescribedenergyfederalgenerationsgovernmentgrazinghistoric
SHARED TOKENS (45): "acres", "act", "agencies", "agency", "american", "among", "approximately", "bureau", "california", "congress", "conservation", "created", "department", "described", "energy", "federal", "generations", "government", "grazing", "historic".... | EXACT TITLE in wildlife_landscape: "Bureau of Land Management".
0.500
Hoover Dam ↗ Q172822 EXACT TITLE
administrationblackbuiltcaliforniacanyoncongressconstructedconstructioncontroldamdedicatedfederalgovernmentgreathydroelectricirrigationlakelargemajormarch
SHARED TOKENS (37): "administration", "black", "built", "california", "canyon", "congress", "constructed", "construction", "control", "dam", "dedicated", "federal", "government", "great", "hydroelectric", "irrigation", "lake", "large", "major", "march".... | EXACT TITLE in history: "Hoover Dam".
0.500
Shoshone ↗ Q26774 EXACT TITLE
americanbasinbecomecaliforniaculturaleasterngreatlargenativenorthernpeoplesettlementsnakesouthernthroughoutwestern
SHARED TOKENS (16): "american", "basin", "become", "california", "cultural", "eastern", "great", "large", "native", "northern", "people", "settlement", "snake", "southern", "throughout", "western". | EXACT TITLE in history: "Shoshone".
0.500
activitiesagricultureanimalanimalsconnectingconnectscontextcorridordevelopmentexpansionhumanimpactsincreaseinfrastructurelandmovementnetworkpopulationpopulationsrapid
SHARED TOKENS (26): "activities", "agriculture", "animal", "animals", "connecting", "connects", "context", "corridor", "development", "expansion", "human", "impacts", "increase", "infrastructure", "land", "movement", "network", "population", "populations", "rapid".... | EXACT TITLE in wildlife_landscape: "Wildlife corridor".
0.500
Audubon ↗ Q1646000 EXACT TITLE
activitiesamericaamericanbeyondbirdscanadacenturyconservationcreateddecemberdedicatedenvironmentalfieldfoundedglobalgreatimportantinternationallocalnational
SHARED TOKENS (34): "activities", "america", "american", "beyond", "birds", "canada", "century", "conservation", "created", "december", "dedicated", "environmental", "field", "founded", "global", "great", "important", "international", "local", "national".... | EXACT TITLE in wildlife_landscape: "Audubon".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyaroundbasinbecomingboisecanadacapitalcenturycountryeasteasterneconomyeventuallyforestgeographicgreatholdsinstead
SHARED TOKENS (47): "agricultural", "agriculture", "approximately", "around", "basin", "becoming", "boise", "canada", "capital", "century", "country", "east", "eastern", "economy", "eventually", "forest", "geographic", "great", "holds", "instead".... | EXACT TITLE in history: "Idaho". | EXACT TITLE in wildlife_landscape: "Idaho".
0.500
Coyote ↗ Q44299 EXACT TITLE
americaamericananimalbirdsblackcitiescommonconservationdueeasternecologicaleitherespeciallyfishfurthergreatesthomeinternationalleastliving
SHARED TOKENS (38): "america", "american", "animal", "birds", "black", "cities", "common", "conservation", "due", "eastern", "ecological", "either", "especially", "fish", "further", "greatest", "home", "international", "least", "living".... | EXACT TITLE in wildlife_landscape: "Coyote".
0.500
actamongaroundbeginningcenturycitiescommunitiesconstructioncreatedecadedevelopmenteconomiceconomyespeciallyestimatedfarmersglobalgreatgrowinggrowth
SHARED TOKENS (43): "act", "among", "around", "beginning", "century", "cities", "communities", "construction", "create", "decade", "development", "economic", "economy", "especially", "estimated", "farmers", "global", "great", "growing", "growth".... | EXACT TITLE in history: "Great Depression".
0.500
Golden eagle ↗ Q41181 EXACT TITLE
activitiesamericabirdsdespitedistributedeaglefeetformergreatgroundhighhomelargelargestleastlivingnorthnorthernplaceplaces
SHARED TOKENS (30): "activities", "america", "birds", "despite", "distributed", "eagle", "feet", "former", "great", "ground", "high", "home", "large", "largest", "least", "living", "north", "northern", "place", "places".... | EXACT TITLE in wildlife_landscape: "Golden eagle".
0.500
americacanadachangedcongressfoundhelpedinternationalkeylaterlocalnameorganizationorganizationsrockrolewesternworld
SHARED TOKENS (17): "america", "canada", "changed", "congress", "found", "helped", "international", "key", "later", "local", "name", "organization", "organizations", "rock", "role", "western", "world". | EXACT TITLE in history: "Western Federation of Miners".
0.500
Basalt ↗ Q43338 EXACT TITLE
commoncoverdeepduefloodformedgreathundredsimportantnearrapidrockrockysquaresystemthousands
SHARED TOKENS (16): "common", "cover", "deep", "due", "flood", "formed", "great", "hundreds", "important", "near", "rapid", "rock", "rocky", "square", "system", "thousands". | EXACT TITLE in wildlife_landscape: "Basalt".
0.500
Teton Dam ↗ Q1595414 EXACT TITLE
agenciesbuiltbureaucatastrophicdamdamagedamseasternfederalgovernmentlivestockmillionpaidpeoplereclamationriverwestern
SHARED TOKENS (17): "agencies", "built", "bureau", "catastrophic", "dam", "damage", "dams", "eastern", "federal", "government", "livestock", "million", "paid", "people", "reclamation", "river", "western". | EXACT TITLE in history: "Teton Dam".
0.500
Weeks Act ↗ Q7979527 EXACT TITLE
acresactagriculturealoneamericananimalscommunitiescongressconservationcontrolcreatingdepartmentdestroyeddevelopmenteasterneconomiceconomyfederalfeetfire
SHARED TOKENS (58): "acres", "act", "agriculture", "alone", "american", "animals", "communities", "congress", "conservation", "control", "creating", "department", "destroyed", "development", "eastern", "economic", "economy", "federal", "feet", "fire".... | EXACT TITLE in history: "Weeks Act".
0.500
aroundbearcaliforniacommunityconfluenceestimatedeventfarmsfoodhistorylandslargelargestmilitarynativenearnorthernplaceriversources
SHARED TOKENS (21): "around", "bear", "california", "community", "confluence", "estimated", "event", "farms", "food", "history", "lands", "large", "largest", "military", "native", "near", "northern", "place", "river", "sources".... | EXACT TITLE in history: "Bear River Massacre".
0.500
Wildfire ↗ Q169950 EXACT TITLE
burnedburnscaliforniacanadacombinationcommonconcentrationscontrolledcreateeconomicespeciallyeventfireforestforestsfundingglobalgrowthhumanimpacts
SHARED TOKENS (37): "burned", "burns", "california", "canada", "combination", "common", "concentrations", "controlled", "create", "economic", "especially", "event", "fire", "forest", "forests", "funding", "global", "growth", "human", "impacts".... | EXACT TITLE in history: "Wildfire". | EXACT TITLE in wildlife_landscape: "Wildfire".
0.500
actioncleanconservationeducationenvironmentfundinglandslandscapesorganizationprogramsprotectingpublicqualitywaterwildwildlife
SHARED TOKENS (16): "action", "clean", "conservation", "education", "environment", "funding", "lands", "landscapes", "organization", "programs", "protecting", "public", "quality", "water", "wild", "wildlife". | EXACT TITLE in history: "Idaho Conservation League".
0.500
agricultureanotherdevelopmentecosystemenvironmentalforesthumanlandmanagementmanagingnaturalproductivityresourcessoilwater
SHARED TOKENS (15): "agriculture", "another", "development", "ecosystem", "environmental", "forest", "human", "land", "management", "managing", "natural", "productivity", "resources", "soil", "water". | EXACT TITLE in history: "Land management". | EXACT TITLE in wildlife_landscape: "Land management".
0.500
Fort Hall ↗ Q5471267 EXACT TITLE
builtcaliforniacanadacommonconstructedcountrydesignateddevelopedeasteasterneitherendestimatedfarfisheriesfoundedfrontiergreathistoricimportant
SHARED TOKENS (42): "built", "california", "canada", "common", "constructed", "country", "designated", "developed", "east", "eastern", "either", "end", "estimated", "far", "fisheries", "founded", "frontier", "great", "historic", "important".... | EXACT TITLE in history: "Fort Hall".
0.500
actagencybecomedepartmentdistrictsestablishedfederalgovernmentgreathistorichistoryindividuallistingsmilitarymillionnationalofficialparksplacespreservation
SHARED TOKENS (26): "act", "agency", "become", "department", "districts", "established", "federal", "government", "great", "historic", "history", "individual", "listings", "military", "million", "national", "official", "parks", "places", "preservation".... | EXACT TITLE in history: "National Register of Historic Places".
0.500
actalmostamericaanimalsbirdscanadacommunitydueenoughfoodforestslargemovenaturalopensouthsouthernspeciestreesworld
SHARED TOKENS (20): "act", "almost", "america", "animals", "birds", "canada", "community", "due", "enough", "food", "forests", "large", "move", "natural", "open", "south", "southern", "species", "trees", "world". | EXACT TITLE in wildlife_landscape: "Turkey vulture".
0.500
actamericacasecreatedeitherendangeredfishfisheriesfoodgreatleastlinelivinglocalnativenorthofficialpacificpopulationpopulations
SHARED TOKENS (25): "act", "america", "case", "created", "either", "endangered", "fish", "fisheries", "food", "great", "least", "line", "living", "local", "native", "north", "official", "pacific", "population", "populations".... | EXACT TITLE in wildlife_landscape: "Rainbow trout".
0.500
aprilbasinboiseconditionsforestlandmilesmountainnationaloperatedorganizationprivaterecreationroadtrailswestern
SHARED TOKENS (16): "april", "basin", "boise", "conditions", "forest", "land", "miles", "mountain", "national", "operated", "organization", "private", "recreation", "road", "trails", "western". | EXACT TITLE in history: "Bogus Basin".
0.500
americaamericanaprilassetsbasinbeyondcanadacollectioncontrolcontrolledcountrydecemberdepartmenteitherestablishedeventuallyfieldsfollowingformerfounded
SHARED TOKENS (36): "america", "american", "april", "assets", "basin", "beyond", "canada", "collection", "control", "controlled", "country", "december", "department", "either", "established", "eventually", "fields", "following", "former", "founded".... | EXACT TITLE in history: "Hudson's Bay Company".
0.500
basincaliforniadepartmentendangeredestablishedfishfoundgamegreatgrouporegonpacificpopulationpopulationsregionsriverseasonalsmallspecieswestern
SHARED TOKENS (21): "basin", "california", "department", "endangered", "established", "fish", "found", "game", "great", "group", "oregon", "pacific", "population", "populations", "regions", "river", "seasonal", "small", "species", "western".... | EXACT TITLE in wildlife_landscape: "Redband trout".
0.500
americanbigcollectioncontroldecemberfinalformerfoundhistorylandlargelawnationalpresentedquicklyrunningseekingsupportuniversityworld
SHARED TOKENS (20): "american", "big", "collection", "control", "december", "final", "former", "found", "history", "land", "large", "law", "national", "presented", "quickly", "running", "seeking", "support", "university", "world". | EXACT TITLE in history: "William Borah".
0.500
alongsideanimalsbasinbecomebigchangedcommoncommunitydiversedominatedecosystemfirefoundgamegreatimportantkeylandlandscapeleading
SHARED TOKENS (35): "alongside", "animals", "basin", "become", "big", "changed", "common", "community", "diverse", "dominated", "ecosystem", "fire", "found", "game", "great", "important", "key", "land", "landscape", "leading".... | EXACT TITLE in wildlife_landscape: "Sagebrush steppe".
0.500
Barn owl ↗ Q131528250 EXACT TITLE
americananimalsbirdscommondistributedeasteasternlargelargestlongnamepowerfulsouthernspeciesstrongwesternworld
SHARED TOKENS (17): "american", "animals", "birds", "common", "distributed", "east", "eastern", "large", "largest", "long", "name", "powerful", "southern", "species", "strong", "western", "world". | EXACT TITLE in wildlife_landscape: "Barn owl".
0.500
Bobcat ↗ Q131907 EXACT TITLE
americaamericananimalsbirdsblackcanadacentraldueeastedgeforestgreathomelargeleastnamenativenorthpopulationpopulations
SHARED TOKENS (31): "america", "american", "animals", "birds", "black", "canada", "central", "due", "east", "edge", "forest", "great", "home", "large", "least", "name", "native", "north", "population", "populations".... | EXACT TITLE in wildlife_landscape: "Bobcat".
0.500
Beaver ↗ Q47542 EXACT TITLE
americananimalbeaverbuiltcanadaconnectionconstructiondamsdownecosystemespeciallyfeetfoodfoundfronthistoricallyhumaninfrastructurelargeleast
SHARED TOKENS (36): "american", "animal", "beaver", "built", "canada", "connection", "construction", "dams", "down", "ecosystem", "especially", "feet", "food", "found", "front", "historically", "human", "infrastructure", "large", "least".... | EXACT TITLE in history: "Beaver". | EXACT TITLE in wildlife_landscape: "Beaver".
0.500
agriculturalamericaamericananimalsbirdscanadacommonfarfieldsforestforestshighhunterslargestnorthnorthernoccupiespeoplepreysmall
SHARED TOKENS (27): "agricultural", "america", "american", "animals", "birds", "canada", "common", "far", "fields", "forest", "forests", "high", "hunters", "largest", "north", "northern", "occupies", "people", "prey", "small".... | EXACT TITLE in wildlife_landscape: "Red-tailed hawk".
0.500
agenciesanotherapproachaprilcentralcolonialconditionsconflictcountrycreatedcurrentdespiteeconomicespeciallyfollowingforcefoundedfurtherglobalgreat
SHARED TOKENS (45): "agencies", "another", "approach", "april", "central", "colonial", "conditions", "conflict", "country", "created", "current", "despite", "economic", "especially", "following", "force", "founded", "further", "global", "great".... | EXACT TITLE in history: "League of Nations".
0.500
americanamonganimalbasincaliforniacountrycriticaldesertdifferenteasternenvironmentfishfollowingfoodgrassgreatharshimportantlakemigration
SHARED TOKENS (39): "american", "among", "animal", "basin", "california", "country", "critical", "desert", "different", "eastern", "environment", "fish", "following", "food", "grass", "great", "harsh", "important", "lake", "migration".... | EXACT TITLE in history: "Northern Paiute people".
0.500
americaamongapproximatelybeyondbirdscanadadesertdevelopedfoundnativenorthnorthernothersprairiepreysouthspeciesthroughoutwestwestern
SHARED TOKENS (20): "america", "among", "approximately", "beyond", "birds", "canada", "desert", "developed", "found", "native", "north", "northern", "others", "prairie", "prey", "south", "species", "throughout", "west", "western". | EXACT TITLE in wildlife_landscape: "Prairie falcon".
0.500
acrescongresscreatedcurrentdesignatedfederalhonorlargestmanagedmillionmountainnamerivervalleywildlife
SHARED TOKENS (15): "acres", "congress", "created", "current", "designated", "federal", "honor", "largest", "managed", "million", "mountain", "name", "river", "valley", "wildlife". | EXACT TITLE in history: "Frank Church–River of No Return Wilderness".
0.500
almostamericaanimalbirdsblackcitiescommondescribeddueendangeredespeciallyexistedfoodfoundgamegeographichighhistoricallylandlarge
SHARED TOKENS (48): "almost", "america", "animal", "birds", "black", "cities", "common", "described", "due", "endangered", "especially", "existed", "food", "found", "game", "geographic", "high", "historically", "land", "large".... | EXACT TITLE in wildlife_landscape: "Peregrine falcon".
0.500
actioncollectioncombinationconstructiondevelopedfirefiresforestfurtherinstitutionmountainnationaloutdoorplantingpurposeregionregionalrockysoilstandard
SHARED TOKENS (24): "action", "collection", "combination", "construction", "developed", "fire", "fires", "forest", "further", "institution", "mountain", "national", "outdoor", "planting", "purpose", "region", "regional", "rocky", "soil", "standard".... | EXACT TITLE in history: "Pulaski (tool)".
0.500
Mallard ↗ Q25348 EXACT TITLE
animalsaroundblackconservationdevelopmentespeciallyinternationalleastlivelongmakesnaturallynorthplantspopulationsregionssmallsouthspeciessupported
SHARED TOKENS (25): "animals", "around", "black", "conservation", "development", "especially", "international", "least", "live", "long", "makes", "naturally", "north", "plants", "populations", "regions", "small", "south", "species", "supported".... | EXACT TITLE in wildlife_landscape: "Mallard".
0.500
agriculturalamericaamericanamongbecomecommondesertdespitedevelopedforestfoundgroundhighhunterslandscapeslivenamenativenorthopen
SHARED TOKENS (29): "agricultural", "america", "american", "among", "become", "common", "desert", "despite", "developed", "forest", "found", "ground", "high", "hunters", "landscapes", "live", "name", "native", "north", "open".... | EXACT TITLE in wildlife_landscape: "Burrowing owl".
0.500
americananimalsbirdscanadacanyoncenterconservationedgeforestimportantlakelandlargestlowellnampanationalopenoregonpacificprojects
SHARED TOKENS (26): "american", "animals", "birds", "canada", "canyon", "center", "conservation", "edge", "forest", "important", "lake", "land", "largest", "lowell", "nampa", "national", "open", "oregon", "pacific", "projects".... | EXACT TITLE in wildlife_landscape: "Deer Flat National Wildlife Refuge".
0.500
beginningbeyondboiseconnectsdamdedicatedeagleeastgreenbeltluckymilesparkspeakprovidingrecreationalriverriversideroadshortsystem
SHARED TOKENS (25): "beginning", "beyond", "boise", "connects", "dam", "dedicated", "eagle", "east", "greenbelt", "lucky", "miles", "parks", "peak", "providing", "recreational", "river", "riverside", "road", "short", "system".... | EXACT TITLE in wildlife_landscape: "Boise River Greenbelt".
0.500
acresadaapproximatelyboisecanalscanyoncapacitydamfarmlandfeetirrigationlakelowellmilesriversouthwesternsystemtreasurevalleywater
SHARED TOKENS (21): "acres", "ada", "approximately", "boise", "canals", "canyon", "capacity", "dam", "farmland", "feet", "irrigation", "lake", "lowell", "miles", "river", "southwestern", "system", "treasure", "valley", "water".... | EXACT TITLE in history: "New York Canal".
0.500
Muskrat ↗ Q26283 EXACT TITLE
americaanimalscommonfeedfeetfoodfoundimportantlargestlivelongnativenorthprotectshortsmallsouthspecieswater
SHARED TOKENS (19): "america", "animals", "common", "feed", "feet", "food", "found", "important", "largest", "live", "long", "native", "north", "protect", "short", "small", "south", "species", "water". | EXACT TITLE in wildlife_landscape: "Muskrat".
0.500
developmentforestheadquartersmountainnaturalorganizationprogramregionalresearchresourcesrockyroughlysciencestationunitworld
SHARED TOKENS (16): "development", "forest", "headquarters", "mountain", "natural", "organization", "program", "regional", "research", "resources", "rocky", "roughly", "science", "station", "unit", "world". | EXACT TITLE in wildlife_landscape: "Rocky Mountain Research Station".
0.500
Gold rush ↗ Q273182 EXACT TITLE
activitiesalmostamericanbecomebeyondcaliforniacanadacenturydescribeddiscoverydistributedeconomicenvironmentalfarglobalhelpedhistoryimportantincreaseindividual
SHARED TOKENS (41): "activities", "almost", "american", "become", "beyond", "california", "canada", "century", "described", "discovery", "distributed", "economic", "environmental", "far", "global", "helped", "history", "important", "increase", "individual".... | EXACT TITLE in history: "Gold rush".
0.500
actionagriculturebecomebeyondbiologicalcapacitydifferentecosystemenvironmentfisheriesfoodglobalgrowthhumaninternationallivingpeoplepopulationresourcesspecies
SHARED TOKENS (22): "action", "agriculture", "become", "beyond", "biological", "capacity", "different", "ecosystem", "environment", "fisheries", "food", "global", "growth", "human", "international", "living", "people", "population", "resources", "species".... | EXACT TITLE in wildlife_landscape: "Carrying capacity".
0.500
administrationagencyamericanaroundconstructiondedicateddevelopmentdocumentsfederalfinanceformergovernmentgreathistoryinfrastructurekeylandlocalmilesmillion
SHARED TOKENS (42): "administration", "agency", "american", "around", "construction", "dedicated", "development", "documents", "federal", "finance", "former", "government", "great", "history", "infrastructure", "key", "land", "local", "miles", "million".... | EXACT TITLE in history: "Works Progress Administration".
0.500
agenciesanimalcommunitiescreatingenvironmentalfeatureshumanlandmanagementnaturalplanningplayprogramsprojectsqualityrelevantresourcesstudywaterwatershed
SHARED TOKENS (20): "agencies", "animal", "communities", "creating", "environmental", "features", "human", "land", "management", "natural", "planning", "play", "programs", "projects", "quality", "relevant", "resources", "study", "water", "watershed". | EXACT TITLE in wildlife_landscape: "Watershed management".
0.500
Osprey ↗ Q25332 EXACT TITLE
almostamericadistributedfishfoodhistoricallylargenearphysicalpreyprovidingriversouthspecieswater
SHARED TOKENS (15): "almost", "america", "distributed", "fish", "food", "historically", "large", "near", "physical", "prey", "providing", "river", "south", "species", "water". | EXACT TITLE in wildlife_landscape: "Osprey".
0.500
Wetland ↗ Q170321 EXACT TITLE
actamericaamonganimalsbasinconservationcontroldecadesdifferentdiversedominantdominateddueecologicalecosystemeitherenvironmentalespeciallyfloodflooding
SHARED TOKENS (49): "act", "america", "among", "animals", "basin", "conservation", "control", "decades", "different", "diverse", "dominant", "dominated", "due", "ecological", "ecosystem", "either", "environmental", "especially", "flood", "flooding".... | EXACT TITLE in wildlife_landscape: "Wetland".
0.500
activitiesanimalanimalsaroundbearsbecomebecomingcitiesdifferentdominatedecosystemenvironmentforestsfoundhumanlandlargelivelocalnative
SHARED TOKENS (37): "activities", "animal", "animals", "around", "bears", "become", "becoming", "cities", "different", "dominated", "ecosystem", "environment", "forests", "found", "human", "land", "large", "live", "local", "native".... | EXACT TITLE in wildlife_landscape: "Urban wildlife".
0.500
americaamericanamongannualassetsbasebeyondcaliforniacolonialconstructedcreateddecadesdespitediscoverydueexpansionexperiencefoundationfundedgeographic
SHARED TOKENS (47): "america", "american", "among", "annual", "assets", "base", "beyond", "california", "colonial", "constructed", "created", "decades", "despite", "discovery", "due", "expansion", "experience", "foundation", "funded", "geographic".... | EXACT TITLE in history: "Pacific Fur Company".
0.500
acresbasinboisecenturycommoncovercoveringcreateddistrictsfeetforestforestshomelandmanagedmilesmountainnationalpeoplepopulations
SHARED TOKENS (32): "acres", "basin", "boise", "century", "common", "cover", "covering", "created", "districts", "feet", "forest", "forests", "home", "land", "managed", "miles", "mountain", "national", "people", "populations".... | EXACT TITLE in history: "Boise National Forest". | EXACT TITLE in wildlife_landscape: "Boise National Forest".
0.500
Pronghorn ↗ Q187943 EXACT TITLE
americaamericancentraldueecologicalexistedlandlivinglongmakingnorthprairierunningsocietyspeciesthemwesternworld
SHARED TOKENS (18): "america", "american", "central", "due", "ecological", "existed", "land", "living", "long", "making", "north", "prairie", "running", "society", "species", "them", "western", "world". | EXACT TITLE in wildlife_landscape: "Pronghorn".
0.500
Nez Perce ↗ Q1123923 EXACT TITLE
actamericaamongbasincentralcenturycolonialcommunityculturaldominanteasteconomicespeciallyfarmersfishfisheriesforcegovernmentgreatgroup
SHARED TOKENS (46): "act", "america", "among", "basin", "central", "century", "colonial", "community", "cultural", "dominant", "east", "economic", "especially", "farmers", "fish", "fisheries", "force", "government", "great", "group".... | EXACT TITLE in history: "Nez Perce".
0.500
agencyamericanapproximatelycongressconservationdevelopmenteventuallyfederalfollowingfoodgovernmentgreathelpinghomeindividuallandslargestlocalmajormillion
SHARED TOKENS (35): "agency", "american", "approximately", "congress", "conservation", "development", "eventually", "federal", "following", "food", "government", "great", "helping", "home", "individual", "lands", "largest", "local", "major", "million".... | EXACT TITLE in history: "Civilian Conservation Corps".
0.500
acresactbureauconservationdecemberexpansionfederalforestshistorylandlandslargestlawmanagedmanagementmillionmountainsnationalparkspreservation
SHARED TOKENS (30): "acres", "act", "bureau", "conservation", "december", "expansion", "federal", "forests", "history", "land", "lands", "largest", "law", "managed", "management", "million", "mountains", "national", "parks", "preservation".... | EXACT TITLE in history: "Alaska National Interest Lands Conservation Act".
0.500
adaarrowrockboisebuiltbureauconstructioncontroldamdamsdirectlyeastfederalfeetfloodgenerationhydroelectricirrigationlakeluckymiles
SHARED TOKENS (38): "ada", "arrowrock", "boise", "built", "bureau", "construction", "control", "dam", "dams", "directly", "east", "federal", "feet", "flood", "generation", "hydroelectric", "irrigation", "lake", "lucky", "miles".... | EXACT TITLE in history: "Lucky Peak Dam".
0.500
amongboiseeconomicseducationfoundedhighinstitutionmillionmountainprogramprogramspublicreportedresearchuniversitywest
SHARED TOKENS (16): "among", "boise", "economics", "education", "founded", "high", "institution", "million", "mountain", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in history: "Boise State University".
0.500
Brook trout ↗ Q723654 EXACT TITLE
americaamongbeyondblackcanadacenturyconservationdueeasternecologicalendangeredfeetfishforestfoundhistoryinternationallakelongnative
SHARED TOKENS (31): "america", "among", "beyond", "black", "canada", "century", "conservation", "due", "eastern", "ecological", "endangered", "feet", "fish", "forest", "found", "history", "international", "lake", "long", "native".... | EXACT TITLE in wildlife_landscape: "Brook trout".
0.500
adabaseboisecenterdepartmentdowntownfacilityfieldfireforestincreaseinternationalmilesmilitarymillionnationaloperatedroughlysouthsupport
SHARED TOKENS (22): "ada", "base", "boise", "center", "department", "downtown", "facility", "field", "fire", "forest", "increase", "international", "miles", "military", "million", "national", "operated", "roughly", "south", "support".... | EXACT TITLE in history: "Boise Airport".
0.500
Badger ↗ Q638105 EXACT TITLE
agoamericananimalsaroundblackconnectestimatedevidencelargestlongmillionmovementnaturalopenrelationshipsshortsmallsmallerspecieswhite
SHARED TOKENS (20): "ago", "american", "animals", "around", "black", "connect", "estimated", "evidence", "largest", "long", "million", "movement", "natural", "open", "relationships", "short", "small", "smaller", "species", "white". | EXACT TITLE in wildlife_landscape: "Badger".
0.500
administrationamericanbecomingcontroldepartmentdevelopmenteconomicenvironmentenvironmentalestablishedhistoryhonormanagementpreservepublicrenamedstrongwhitewildlife
SHARED TOKENS (19): "administration", "american", "becoming", "control", "department", "development", "economic", "environment", "environmental", "established", "history", "honor", "management", "preserve", "public", "renamed", "strong", "white", "wildlife". | EXACT TITLE in history: "Cecil Andrus".
0.500
archivesaroundbirdsboisecenterendangeredfoundedfundnameorganizationpreyrecoveryresearchspeciesworld
SHARED TOKENS (15): "archives", "around", "birds", "boise", "center", "endangered", "founded", "fund", "name", "organization", "prey", "recovery", "research", "species", "world". | EXACT TITLE in wildlife_landscape: "The Peregrine Fund".
0.500
Albertsons ↗ EXACT TITLE
americaamericanboisecapitaldecemberdifferentfederalformerfoundedhigherlargestmanagementnamenorthnovemberoctoberregional
SHARED TOKENS (17): "america", "american", "boise", "capital", "december", "different", "federal", "former", "founded", "higher", "largest", "management", "name", "north", "november", "october", "regional". | EXACT TITLE in history: "Albertsons".
0.500
centraldirectlyforestlandmilesmountainmountainsnationalnorthernpeakprimaryrecreationriverrockyscenicsouthtrailswestwesternwhite
SHARED TOKENS (20): "central", "directly", "forest", "land", "miles", "mountain", "mountains", "national", "northern", "peak", "primary", "recreation", "river", "rocky", "scenic", "south", "trails", "west", "western", "white". | EXACT TITLE in history: "White Cloud Mountains".
0.500
americaamongbasinclarkcommondeepdistributeddueespeciallyfishfishinggreatgrouphonorlakelargelosslowermountainmountains
SHARED TOKENS (35): "america", "among", "basin", "clark", "common", "deep", "distributed", "due", "especially", "fish", "fishing", "great", "group", "honor", "lake", "large", "loss", "lower", "mountain", "mountains".... | EXACT TITLE in wildlife_landscape: "Cutthroat trout".
0.500
acresadaaroundboisebureaudamdepartmenteastfishforestformedfoundationgamehigherlakelandlowerluckymanagedmanagement
SHARED TOKENS (27): "acres", "ada", "around", "boise", "bureau", "dam", "department", "east", "fish", "forest", "formed", "foundation", "game", "higher", "lake", "land", "lower", "lucky", "managed", "management".... | EXACT TITLE in history: "Boise River Wildlife Management Area". | EXACT TITLE in wildlife_landscape: "Boise River Wildlife Management Area".
0.500
animalbecomebeginningcenturycommondamagediscoveryecologicaleconomicenvironmentenvironmentalestablishedgeographicinternationalnaturalscaleseriousspecieswaterworld
SHARED TOKENS (20): "animal", "become", "beginning", "century", "common", "damage", "discovery", "ecological", "economic", "environment", "environmental", "established", "geographic", "international", "natural", "scale", "serious", "species", "water", "world". | EXACT TITLE in wildlife_landscape: "Invasive species".
0.500
americanaroundbecomebigcaliforniacomcreateddatadevelopeddirectlyformerfoundedgovernmentgrowinghearthistorylargelaterleadingline
SHARED TOKENS (32): "american", "around", "become", "big", "california", "com", "created", "data", "developed", "directly", "former", "founded", "government", "growing", "heart", "history", "large", "later", "leading", "line".... | EXACT TITLE in history: "Hewlett-Packard".
0.500
Bald eagle ↗ Q127216 EXACT TITLE
abundantamericaamericananimalcanadacenturydeepdowneagleendangeredfishfoodfoundlargelargestnamenationalnearnorthnorthern
SHARED TOKENS (30): "abundant", "america", "american", "animal", "canada", "century", "deep", "down", "eagle", "endangered", "fish", "food", "found", "large", "largest", "name", "national", "near", "north", "northern".... | EXACT TITLE in wildlife_landscape: "Bald eagle".
0.500
New Deal ↗ Q186356 EXACT TITLE
actadministrationagenciesagriculturalauthoritybasebasinbigcitizensconditionscongressconservationconstructioncontrolledcreatecreateddevelopmentdominatedeconomiceconomy
SHARED TOKENS (45): "act", "administration", "agencies", "agricultural", "authority", "base", "basin", "big", "citizens", "conditions", "congress", "conservation", "construction", "controlled", "create", "created", "development", "dominated", "economic", "economy".... | EXACT TITLE in history: "New Deal".
0.500
americanblackcenturycongressestablishedfarformedfrontierhonormilitarynamenationalnovemberotherssouththemwestwestern
SHARED TOKENS (18): "american", "black", "century", "congress", "established", "far", "formed", "frontier", "honor", "military", "name", "national", "november", "others", "south", "them", "west", "western". | EXACT TITLE in history: "Buffalo Soldier".
0.500
almostamericaamericanapproximatelybecomebirdscanadacentralcommoncontroldifferentdistributedespeciallygroundhunterslocalnamenorthnorthernprey
SHARED TOKENS (31): "almost", "america", "american", "approximately", "become", "birds", "canada", "central", "common", "control", "different", "distributed", "especially", "ground", "hunters", "local", "name", "north", "northern", "prey".... | EXACT TITLE in wildlife_landscape: "American kestrel".
0.500
americabirdsdespitedistributedecologicalgreatlargenativenorthoccupiesoriginallypreyprimarilyremainsspeciesstudy
SHARED TOKENS (16): "america", "birds", "despite", "distributed", "ecological", "great", "large", "native", "north", "occupies", "originally", "prey", "primarily", "remains", "species", "study". | EXACT TITLE in wildlife_landscape: "Great horned owl".
0.500
Fort Boise ↗ Q3077782 EXACT TITLE
becomeboisecanyoncapitaldevelopeddifferenteasteitherestablishedfollowinggovernmenthistoricmilesmilitarynearnorthernoregonplaceriversettlement
SHARED TOKENS (23): "become", "boise", "canyon", "capital", "developed", "different", "east", "either", "established", "following", "government", "historic", "miles", "military", "near", "northern", "oregon", "place", "river", "settlement".... | EXACT TITLE in history: "Fort Boise".
0.500
acresagoarchivesaroundbirdsboisebuiltcentercollectionsconservationdueeastendangeredfoundedfundheadquartershousesinternationallargeorganization
SHARED TOKENS (26): "acres", "ago", "archives", "around", "birds", "boise", "built", "center", "collections", "conservation", "due", "east", "endangered", "founded", "fund", "headquarters", "houses", "international", "large", "organization".... | EXACT TITLE in wildlife_landscape: "World Center for Birds of Prey".
0.500
Boise River ↗ Q891080 EXACT TITLE
agriculturalalpineapproximatelyboisediverseforestlandsmilesplainriversnakesouthwesternsquareurbanwatershedwestern
SHARED TOKENS (16): "agricultural", "alpine", "approximately", "boise", "diverse", "forest", "lands", "miles", "plain", "river", "snake", "southwestern", "square", "urban", "watershed", "western". | EXACT TITLE in history: "Boise River". | EXACT TITLE in wildlife_landscape: "Boise River".
0.500
americanboisecanadacountryeitherforestformerlakeleastnationalnearnorthoctoberoregonpacificparmariverriverssnakesouthwestern
SHARED TOKENS (24): "american", "boise", "canada", "country", "either", "forest", "former", "lake", "least", "national", "near", "north", "october", "oregon", "pacific", "parma", "river", "rivers", "snake", "southwestern".... | EXACT TITLE in history: "Francois Payette".
0.500
animalsburncombinationcommunitiesecologicalenvironmentalexpansionfirefloodingforestshistoricallylandlargeleastmanagersnaturalpeopleprairiepublicresearch
SHARED TOKENS (26): "animals", "burn", "combination", "communities", "ecological", "environmental", "expansion", "fire", "flooding", "forests", "historically", "land", "large", "least", "managers", "natural", "people", "prairie", "public", "research".... | EXACT TITLE in wildlife_landscape: "Fire ecology".
0.500
activitiesagencyamericanassetsbureaucentralcitizenscommunitycontrolfederalhumanmajornationalnewsoperationsorganizationsprogramprojectpublicreports
SHARED TOKENS (21): "activities", "agency", "american", "assets", "bureau", "central", "citizens", "community", "control", "federal", "human", "major", "national", "news", "operations", "organizations", "program", "project", "public", "reports".... | EXACT TITLE in history: "Church Committee".
0.500
abundantacresactadaadjacentagoalteredamericabasebirdsboisebureaucanyoncombinationconservationcovercreatingdamdeepdifferent
SHARED TOKENS (73): "abundant", "acres", "act", "ada", "adjacent", "ago", "altered", "america", "base", "birds", "boise", "bureau", "canyon", "combination", "conservation", "cover", "creating", "dam", "deep", "different".... | EXACT TITLE in history: "Morley Nelson Snake River Birds of Prey National Conservation Area". | EXACT TITLE in wildlife_landscape: "Morley Nelson Snake River Birds of Prey National Conservation Area".
0.500
americaamericanbirdscanadacentralgreatmountainnorthnorthernopenpresentpreysouthspeciesthroughoutwestwinter
SHARED TOKENS (17): "america", "american", "birds", "canada", "central", "great", "mountain", "north", "northern", "open", "present", "prey", "south", "species", "throughout", "west", "winter". | EXACT TITLE in wildlife_landscape: "Northern harrier".
0.500
adaamericanboisecapitalconstructiondecemberdepartmentfederalfinalfollowinggovernmenthistorichomelaterlegislaturematerialsmillionnationalnativeplaces
SHARED TOKENS (25): "ada", "american", "boise", "capital", "construction", "december", "department", "federal", "final", "following", "government", "historic", "home", "later", "legislature", "materials", "million", "national", "native", "places".... | EXACT TITLE in history: "Idaho State Capitol".
0.500
americacaliforniacenturyconnectedcurrenteasteasternespeciallyestablishedeventuallyfarmersfurtherhistoriclowermakingmigrationmodernmountainsnearnorth
SHARED TOKENS (32): "america", "california", "century", "connected", "current", "east", "eastern", "especially", "established", "eventually", "farmers", "further", "historic", "lower", "making", "migration", "modern", "mountains", "near", "north".... | EXACT TITLE in history: "Oregon Trail".
0.480
agoamongapproximatelybigboiseestablishedhighlaterprimarilyproductionpublicresearchstatewideuniversity
SHARED TOKENS (14): "ago", "among", "approximately", "big", "boise", "established", "high", "later", "primarily", "production", "public", "research", "statewide", "university". | EXACT TITLE in history: "University of Idaho".
0.480
almostbirdsfollowingfoodmajornorthpacificroughlyshowsitessourcessouthspeciesspring
SHARED TOKENS (14): "almost", "birds", "following", "food", "major", "north", "pacific", "roughly", "show", "sites", "sources", "south", "species", "spring". | EXACT TITLE in wildlife_landscape: "Pacific Flyway".
0.460
describesecosystemenvironmentgeologicalhumanlandlargemajorphysicalpopulationsmallerspeciesspecifically
SHARED TOKENS (13): "describes", "ecosystem", "environment", "geological", "human", "land", "large", "major", "physical", "population", "smaller", "species", "specifically". | EXACT TITLE in wildlife_landscape: "Habitat fragmentation".
0.460
americanbuiltcaliforniacapacitydevelopmenthighhistoriclaternorthnorthernroadwestworks
SHARED TOKENS (13): "american", "built", "california", "capacity", "development", "high", "historic", "later", "north", "northern", "road", "west", "works". | EXACT TITLE in history: "Arthur De Wint Foote".
0.460
americabirdsdescribedfoundlaternorthsouthwestspeciesstudiesthemtodaywaterwestern
SHARED TOKENS (13): "america", "birds", "described", "found", "later", "north", "southwest", "species", "studies", "them", "today", "water", "western". | EXACT TITLE in wildlife_landscape: "Western grebe".
0.460
Bull trout ↗ Q2429513 EXACT TITLE
actamericacanadaendangeredfishhistoricallylowernativenorthpopulationpopulationsriversspecies
SHARED TOKENS (13): "act", "america", "canada", "endangered", "fish", "historically", "lower", "native", "north", "population", "populations", "rivers", "species". | EXACT TITLE in wildlife_landscape: "Bull trout".
0.460
Mule deer ↗ Q338831 EXACT TITLE
americaeastfoundgreatlargemountainsnorthrockysmallersouthwestthroughoutwestwestern
SHARED TOKENS (13): "america", "east", "found", "great", "large", "mountains", "north", "rocky", "smaller", "southwest", "throughout", "west", "western". | EXACT TITLE in wildlife_landscape: "Mule deer".
0.460
actagenciescollectiondueestablishedfederalgovernmentlawphysicalproductionpublicrequiressoil
SHARED TOKENS (13): "act", "agencies", "collection", "due", "established", "federal", "government", "law", "physical", "production", "public", "requires", "soil". | EXACT TITLE in history: "Foreign Intelligence Surveillance Act".
0.450
acresactioncaliforniacentercenturycommunitydepartmenteasteducationestablishedformerfoundedgovernmentimportantlandlandslargestlawmilesmillion
SHARED TOKENS (39): "acres", "action", "california", "center", "century", "community", "department", "east", "education", "established", "former", "founded", "government", "important", "land", "lands", "largest", "law", "miles", "million".... | URL->A (1): https://www.sbtribes.com/.
0.440
americacommoncountryduelargenamenativenorthopenprairiepreyspecies
SHARED TOKENS (12): "america", "common", "country", "due", "large", "name", "native", "north", "open", "prairie", "prey", "species". | EXACT TITLE in wildlife_landscape: "Ferruginous hawk".
0.440
Bannock people ↗ EXACT TITLE
americabasingreatlandsnorthnorthernoregonoriginallypeoplesoutherntodaywestern
SHARED TOKENS (12): "america", "basin", "great", "lands", "north", "northern", "oregon", "originally", "people", "southern", "today", "western". | EXACT TITLE in history: "Bannock people".
0.440
Basques ↗ Q126756 EXACT TITLE
amongaroundcommoncountryendgroupnativepopulationsprimarilyregionsouthwesternwestern
SHARED TOKENS (12): "among", "around", "common", "country", "end", "group", "native", "populations", "primarily", "region", "southwestern", "western". | EXACT TITLE in history: "Basques".
0.420
americanbigboisecreateddatadynamicfoundedhighmajorsouthtogether
SHARED TOKENS (11): "american", "big", "boise", "created", "data", "dynamic", "founded", "high", "major", "south", "together". | EXACT TITLE in history: "Micron Technology".
0.420
americacanadadistributedfishfoundmountainnorthpacificriverspecieswestern
SHARED TOKENS (11): "america", "canada", "distributed", "fish", "found", "mountain", "north", "pacific", "river", "species", "western". | EXACT TITLE in wildlife_landscape: "Mountain whitefish".
0.420
boisecaldwellcanyoneasternlargestmetropolitanmiddletonnampaparmapopulationwestern
SHARED TOKENS (11): "boise", "caldwell", "canyon", "eastern", "largest", "metropolitan", "middleton", "nampa", "parma", "population", "western". | EXACT TITLE in history: "Parma, Idaho".
0.420
agencyamericadepartmentfishlandsmanagednationalplantspublicsystemwildlife
SHARED TOKENS (11): "agency", "america", "department", "fish", "lands", "managed", "national", "plants", "public", "system", "wildlife". | EXACT TITLE in wildlife_landscape: "National Wildlife Refuge".
0.420
abundantalmostamericanannuallybirdsduemillionnorthpopulationspeciesstrong
SHARED TOKENS (11): "abundant", "almost", "american", "annually", "birds", "due", "million", "north", "population", "species", "strong". | EXACT TITLE in wildlife_landscape: "Mourning dove".
0.420
americanfargroundgrouplargelivelivingprairiesmallertogethertrees
SHARED TOKENS (11): "american", "far", "ground", "group", "large", "live", "living", "prairie", "smaller", "together", "trees". | EXACT TITLE in wildlife_landscape: "Ground squirrel".
0.420
acresassetsenvironmentalfoundedglobalhistorylandlargestmillionorganizationworks
SHARED TOKENS (11): "acres", "assets", "environmental", "founded", "global", "history", "land", "largest", "million", "organization", "works". | EXACT TITLE in wildlife_landscape: "The Nature Conservancy".
0.410
existedfinalmarch
SHARED TOKENS (3): "existed", "final", "march". | URL->A (1): https://www.boisecounty.us/visit-boise-county/. | EXACT TITLE in history: "Idaho Territory".
0.410
Ed Pulaski ↗ Q5335296 EXACT TITLE
forestranchwest
SHARED TOKENS (3): "forest", "ranch", "west". | URL->A (1): https://foresthistory.org/research-explore/us-forest-service-history/policy-and-law/fire-u-s-forest-service/famous-fires/the-1910-fires/. | EXACT TITLE in history: "Ed Pulaski".
0.400
americabasinformedformergreatincreaselakelargestnorthwestern
SHARED TOKENS (10): "america", "basin", "formed", "former", "great", "increase", "lake", "largest", "north", "western". | EXACT TITLE in wildlife_landscape: "Lake Bonneville".
0.400
americanaprilcenturycountryeconomicgreatestleadingmarchmatterspublic
SHARED TOKENS (10): "american", "april", "century", "country", "economic", "greatest", "leading", "march", "matters", "public". | EXACT TITLE in history: "Clarence Darrow".
0.400
catastrophiceasterneventfloodfloodingpacificriversnakesouthernwater
SHARED TOKENS (10): "catastrophic", "eastern", "event", "flood", "flooding", "pacific", "river", "snake", "southern", "water". | EXACT TITLE in wildlife_landscape: "Bonneville flood".
0.380
boisecenterconstructedculturalhistoricnationalplaceplacesstory
SHARED TOKENS (9): "boise", "center", "constructed", "cultural", "historic", "national", "place", "places", "story". | EXACT TITLE in history: "Cyrus Jacobs House".
0.380
americacanadadistributedforestsgamemountainsnorthopenspecies
SHARED TOKENS (9): "america", "canada", "distributed", "forests", "game", "mountains", "north", "open", "species". | EXACT TITLE in wildlife_landscape: "Ruffed grouse".
0.380
animalsbirdsconservationdamageespeciallyfishlargesmallwildlife
SHARED TOKENS (9): "animals", "birds", "conservation", "damage", "especially", "fish", "large", "small", "wildlife". | EXACT TITLE in wildlife_landscape: "Wildlife crossing".
0.380
Willow ↗ Q36050 EXACT TITLE
alpinearoundfoundgroundplusprimarilyregionsspeciestrees
SHARED TOKENS (9): "alpine", "around", "found", "ground", "plus", "primarily", "regions", "species", "trees". | EXACT TITLE in wildlife_landscape: "Willow".
0.360
agencybirdsdepartmentfishgamemanagingplantswildlife
SHARED TOKENS (8): "agency", "birds", "department", "fish", "game", "managing", "plants", "wildlife". | EXACT TITLE in history: "Idaho Department of Fish and Game". | EXACT TITLE in wildlife_landscape: "Idaho Department of Fish and Game".
0.360
americacalifornianorthsmallspeciesvalleywesternworld
SHARED TOKENS (8): "america", "california", "north", "small", "species", "valley", "western", "world". | EXACT TITLE in wildlife_landscape: "California quail".
0.360
amongfoundedhighmeridianprogramspublicresearchuniversity
SHARED TOKENS (8): "among", "founded", "high", "meridian", "programs", "public", "research", "university". | EXACT TITLE in history: "Idaho State University".
0.350
agencyboisebureaucitizensdepartmentgovernmentheadquartersmilitarynationalprotect
SHARED TOKENS (10): "agency", "boise", "bureau", "citizens", "department", "government", "headquarters", "military", "national", "protect". | URL->A (1): https://www.imd.idaho.gov/idaho-national-guard/our-history/.
0.330
boisebuiltfeetformerhistoricnationalpacificplacesstation
SHARED TOKENS (9): "boise", "built", "feet", "former", "historic", "national", "pacific", "places", "station". | URL->A (1): https://www.ktvb.com/article/news/local/208/1925-boise-depot-train-city-of-trees/277-c69c10d4-8186-43c0-9659-73118e304569.
0.320
changedcommonnameplantsspecieswestern
SHARED TOKENS (6): "changed", "common", "name", "plants", "species", "western". | EXACT TITLE in wildlife_landscape: "Rabbitbrush".
0.320
americanconservationmorleynelsonoctoberwestern
SHARED TOKENS (6): "american", "conservation", "morley", "nelson", "october", "western". | EXACT TITLE in history: "Morley Nelson". | EXACT TITLE in wildlife_landscape: "Morley Nelson".
0.300
Homestead Acts ↗ Q974556 KW CROSS HIGH
acresactaroundfarmersfarmsfederalgovernmentindividuallandlargelawmillionnearlypeoplepolicyprovidingpublicriversoilsouthern
SHARED TOKENS (23): "acres", "act", "around", "farmers", "farms", "federal", "government", "individual", "land", "large", "law", "million", "nearly", "people", "policy", "providing", "public", "river", "soil", "southern"....
0.300
basinbeyondboisedesignatededgehistoricmountainsnationalnorthernprimarilyrecreationriverroadscenicsouthtreasurevalleywestern
SHARED TOKENS (18): "basin", "beyond", "boise", "designated", "edge", "historic", "mountains", "national", "northern", "primarily", "recreation", "river", "road", "scenic", "south", "treasure", "valley", "western".
0.300
Canada goose ↗ Q26733 KW CROSS HIGH
americaanimalsbehaviorblackcanadacommonestablishedfollowingfoodfoundlargelivingmigrationnativenaturalnorthnorthernprimarilyregionsspecies
SHARED TOKENS (25): "america", "animals", "behavior", "black", "canada", "common", "established", "following", "food", "found", "large", "living", "migration", "native", "natural", "north", "northern", "primarily", "regions", "species"....
0.300
actamericanamongauthoritybureauconstructioncreateddepartmentestablishedfarmersfederalfundfundedgeologicalirrigatedirrigationlandlandslaterlaw
SHARED TOKENS (37): "act", "american", "among", "authority", "bureau", "construction", "created", "department", "established", "farmers", "federal", "fund", "funded", "geological", "irrigated", "irrigation", "land", "lands", "later", "law"....
0.300
Oregon Country ↗ Q388164 KW CROSS HIGH
americaamericanarticlebeyondcatastrophiccenturycolonialcontrolcountrycriticaldecadesdepartmentdowndueeasteconomicendestablishedfollowingformed
SHARED TOKENS (50): "america", "american", "article", "beyond", "catastrophic", "century", "colonial", "control", "country", "critical", "decades", "department", "down", "due", "east", "economic", "end", "established", "following", "formed"....
0.300
Sacagawea ↗ Q238960 KW CROSS HIGH
americancenturyclarkculturaldecemberdifferenthelpedhelpinghistorymilesnationalnativenaturalnorthpacificpeopleregionsthousands
SHARED TOKENS (18): "american", "century", "clark", "cultural", "december", "different", "helped", "helping", "history", "miles", "national", "native", "natural", "north", "pacific", "people", "regions", "thousands".
0.300
americancenturycontinuouslydecemberlegislature
SHARED TOKENS (5): "american", "century", "continuously", "december", "legislature". | EXACT TITLE in history: "Pete Cenarrusa".
0.300
Cougar ↗ Q35255 KW CROSS HIGH
alwaysamericaamericanbuiltcanadacentralcenturydevelopmentdistributeddominanteasternfarmsfollowingfurtherhomehumanindividuallargeleastlion
SHARED TOKENS (40): "always", "america", "american", "built", "canada", "central", "century", "development", "distributed", "dominant", "eastern", "farms", "following", "further", "home", "human", "individual", "large", "least", "lion"....
0.300
approximatelyboisebuiltconstructeddecadesdowntowneastfeetformerfoundhistorichonorlatermilesnearoperatedplaceprovidingrocksociety
SHARED TOKENS (23): "approximately", "boise", "built", "constructed", "decades", "downtown", "east", "feet", "former", "found", "historic", "honor", "later", "miles", "near", "operated", "place", "providing", "rock", "society"....
0.300
agriculturalamericabasinbigconditionsdesertdominantfoodgreathumanlandlargemajormountainnamenativenorthportionssagebrushsimply
SHARED TOKENS (23): "agricultural", "america", "basin", "big", "conditions", "desert", "dominant", "food", "great", "human", "land", "large", "major", "mountain", "name", "native", "north", "portions", "sagebrush", "simply"....
0.300
attemptsbackgroundbecomeconditionsconservationcurrentdecadedestroyedecologicalecosystemfoodglobalhigherhundredsimportantleadinglocallossmaintainingneeded
SHARED TOKENS (37): "attempts", "background", "become", "conditions", "conservation", "current", "decade", "destroyed", "ecological", "ecosystem", "food", "global", "higher", "hundreds", "important", "leading", "local", "loss", "maintaining", "needed"....
0.300
americabirdscentralcommonexistsfoundgreatlargenearnorthopenpopulationsouthspecieswaterwhite
SHARED TOKENS (16): "america", "birds", "central", "common", "exists", "found", "great", "large", "near", "north", "open", "population", "south", "species", "water", "white".
0.300
activitiesconservationmanagementrecreationalwildlife
SHARED TOKENS (5): "activities", "conservation", "management", "recreational", "wildlife". | EXACT TITLE in history: "Wildlife management area". | EXACT TITLE in wildlife_landscape: "Wildlife management area".
0.300
agoamongapproximatelybirdsboisebureaucanyoncapacitycenterconservationcreateddamdamsdirectlyeastedgefederalfeetforesthigh
SHARED TOKENS (48): "ago", "among", "approximately", "birds", "boise", "bureau", "canyon", "capacity", "center", "conservation", "created", "dam", "dams", "directly", "east", "edge", "federal", "feet", "forest", "high"....
0.300
Medusahead ↗ Q6807366 EXACT TITLE
commongrassnameplantsspecies
SHARED TOKENS (5): "common", "grass", "name", "plants", "species". | EXACT TITLE in wildlife_landscape: "Medusahead".
0.300
builtcatastrophicdevelopedenvironmentenvironmentalhumanimpactsinterfacelandnaturalpublictransitionurbanwildfirewildland-urban
SHARED TOKENS (15): "built", "catastrophic", "developed", "environment", "environmental", "human", "impacts", "interface", "land", "natural", "public", "transition", "urban", "wildfire", "wildland-urban".
0.300
americandecemberfoundpaidwestern
SHARED TOKENS (5): "american", "december", "found", "paid", "western". | EXACT TITLE in history: "Frank Steunenberg".
0.300
actionamericananotherattentiondestroyeddevelopedfoundfurtherhistorymilitarymillionnationaloctoberoperationsotherspacificprimarilyroughlystoriesstrategic
SHARED TOKENS (22): "action", "american", "another", "attention", "destroyed", "developed", "found", "further", "history", "military", "million", "national", "october", "operations", "others", "pacific", "primarily", "roughly", "stories", "strategic"....
0.300
adjacentagriculturebecomecommonconservationdueenvironmentalkeylandnearprotectprovidingqualityriversrolewater
SHARED TOKENS (16): "adjacent", "agriculture", "become", "common", "conservation", "due", "environmental", "key", "land", "near", "protect", "providing", "quality", "rivers", "role", "water".
0.300
actionconflictmilitaryoregonregion
SHARED TOKENS (5): "action", "conflict", "military", "oregon", "region". | EXACT TITLE in history: "Bannock War".
0.300
americaamericanchangedconflictexpansionformergovernmentissuelandslargemajornationalnorthoregonoriginallyrepresentwestwhiteworld
SHARED TOKENS (19): "america", "american", "changed", "conflict", "expansion", "former", "government", "issue", "lands", "large", "major", "national", "north", "oregon", "originally", "represent", "west", "white", "world".
0.300
actionadjacentagriculturalagriculturealteredanimalsbiologicalcommunitiesconnectconservationconstructioncontrolcorridorcriticaldamageecosystemengineeredenvironmentalfieldsflood
SHARED TOKENS (50): "action", "adjacent", "agricultural", "agriculture", "altered", "animals", "biological", "communities", "connect", "conservation", "construction", "control", "corridor", "critical", "damage", "ecosystem", "engineered", "environmental", "fields", "flood"....
0.300
James Stewart ↗ Q102462 KW CROSS HIGH
actoramericanamongaroundbecomecentercriticalforcegreatesthomehonorlatermakingmilitaryplayprivatereserveroleseekingstory
SHARED TOKENS (22): "actor", "american", "among", "around", "become", "center", "critical", "force", "greatest", "home", "honor", "later", "making", "military", "play", "private", "reserve", "role", "seeking", "story"....
0.300
americaannualbecomebehaviorbiologicalburnscanadacentralcommoncommunitycontroldominantdueeasternecosystemendangeredespeciallyfirefiresfish
SHARED TOKENS (48): "america", "annual", "become", "behavior", "biological", "burns", "canada", "central", "common", "community", "control", "dominant", "due", "eastern", "ecosystem", "endangered", "especially", "fire", "fires", "fish"....
0.300
americanclarkcountrydesertdirectlydiscoveryeventuallygrouplandslatermarchnativenearoregonotherspacificpasspresencereportriver
SHARED TOKENS (24): "american", "clark", "country", "desert", "directly", "discovery", "eventually", "group", "lands", "later", "march", "native", "near", "oregon", "others", "pacific", "pass", "presence", "report", "river"....
0.300
catastrophicconditionsdevelopmentdifferentduefireshumaninterfacelargeleadingnaturalprotectsignificantsmallerurbanwildfirework
SHARED TOKENS (17): "catastrophic", "conditions", "development", "different", "due", "fires", "human", "interface", "large", "leading", "natural", "protect", "significant", "smaller", "urban", "wildfire", "work".
0.300
agricultureboisecanyoncapitalcentercentralclarkcommunityconfluencecreateddamdamsdecembereventsfoundedgovernmentgrowingheadquartershomeimportant
SHARED TOKENS (46): "agriculture", "boise", "canyon", "capital", "center", "central", "clark", "community", "confluence", "created", "dam", "dams", "december", "events", "founded", "government", "growing", "headquarters", "home", "important"....
0.300
activitiescentralestablishedfishingforestheadquartersmanagedmilesmountainnationalnearnorthnorthernrecreationrockstationwaterwhite
SHARED TOKENS (18): "activities", "central", "established", "fishing", "forest", "headquarters", "managed", "miles", "mountain", "national", "near", "north", "northern", "recreation", "rock", "station", "water", "white".
0.300
Fluvial terrace ↗ KW CROSS HIGH
adjacentbasebasincreatedueeitherexistedhigherlandlowerpointriversystemtowardworld
SHARED TOKENS (15): "adjacent", "base", "basin", "create", "due", "either", "existed", "higher", "land", "lower", "point", "river", "system", "toward", "world".
0.300
Clark's grebe ↗ Q432327 KW CROSS HIGH
americaamericanbehaviorcaliforniacentralclarklargelocallowernorthpacificpopulationsriverspeciesvalleywesternwinter
SHARED TOKENS (17): "america", "american", "behavior", "california", "central", "clark", "large", "local", "lower", "north", "pacific", "populations", "river", "species", "valley", "western", "winter".
0.300
americanaroundcommoncontinuedesertfoundhighhuntersimportantlargestnorthopenpreyprotectregionssmallspeciesspringsummerthem
SHARED TOKENS (24): "american", "around", "common", "continue", "desert", "found", "high", "hunters", "important", "largest", "north", "open", "prey", "protect", "regions", "small", "species", "spring", "summer", "them"....
0.300
Bird migration ↗ Q216507 KW CROSS HIGH
birdscarriescommoncontrolledfieldholdsmigrationmountainsmovementnorthernothersprimarilyregionsseasonalsouthernspecies
SHARED TOKENS (16): "birds", "carries", "common", "controlled", "field", "holds", "migration", "mountains", "movement", "northern", "others", "primarily", "regions", "seasonal", "southern", "species".
0.300
agencycaliforniacenterchangingcurrentdatadepartmentfederalfoundedgeologicalgovernmentlandscapemajormakesmarchnaturalnearorganizationpeoplepublic
SHARED TOKENS (30): "agency", "california", "center", "changing", "current", "data", "department", "federal", "founded", "geological", "government", "landscape", "major", "makes", "march", "natural", "near", "organization", "people", "public"....
🫐 BERRY33 edges
0.280
agencyamericandepartmentfederalfishgovernmentmanagementnaturalotherspeopleplantsprotectwildlifeworking
SHARED TOKENS (14): "agency", "american", "department", "federal", "fish", "government", "management", "natural", "others", "people", "plants", "protect", "wildlife", "working".
0.260
Simplot ↗ Q3484788 EXACT TITLE
agricultureamericanboise
SHARED TOKENS (3): "agriculture", "american", "boise". | EXACT TITLE in history: "Simplot".
0.260
americanboisebuiltconstructedconstructiondamheadquartersinfrastructurelargemajorprojectsthroughoutworld
SHARED TOKENS (13): "american", "boise", "built", "constructed", "construction", "dam", "headquarters", "infrastructure", "large", "major", "projects", "throughout", "world".
0.240
Ann Morrison Park ↗ KW CROSS HIGH
boisedepartmenteventsfieldsmanagedoutdoorparkspeoplerecreationriversummerurban
SHARED TOKENS (12): "boise", "department", "events", "fields", "managed", "outdoor", "parks", "people", "recreation", "river", "summer", "urban".
0.240
agoamericabirdsedgelargelaternorthprairieresearchshortspecieswestern
SHARED TOKENS (12): "ago", "america", "birds", "edge", "large", "later", "north", "prairie", "research", "short", "species", "western".
0.240
biologicalcenterfoundgeographichighmovementpopulationregionscalesmallspeciesunit
SHARED TOKENS (12): "biological", "center", "found", "geographic", "high", "movement", "population", "region", "scale", "small", "species", "unit".
0.220
Black bear ↗ Q452750 EXACT TITLE
bearblack
SHARED TOKENS (2): "bear", "black". | EXACT TITLE in wildlife_landscape: "Black bear".
0.220
americanimportant
SHARED TOKENS (2): "american", "important". | EXACT TITLE in history: "William H. Wallace".
0.220
governmentlocal
SHARED TOKENS (2): "government", "local". | EXACT TITLE in history: "Secretary of the Interior".
0.220
James Hawley ↗ EXACT TITLE
americanpublic
SHARED TOKENS (2): "american", "public". | EXACT TITLE in history: "James Hawley".
0.210
american
SHARED TOKENS (1): "american". | EXACT TITLE in history: "George Grimes".
0.210
river
SHARED TOKENS (1): "river". | EXACT TITLE in wildlife_landscape: "River otter".
0.210
november
SHARED TOKENS (1): "november". | EXACT TITLE in history: "Harry Morrison".
0.210
Cottonwood ↗ Q1738790 EXACT TITLE
cottonwood
SHARED TOKENS (1): "cottonwood". | EXACT TITLE in history: "Cottonwood". | EXACT TITLE in wildlife_landscape: "Cottonwood".
0.210
group
SHARED TOKENS (1): "group". | EXACT TITLE in history: "Irreconcilables".
0.200
adaboisecenturydecadegardensgovernmentmetropolitannamenearlypopulation
SHARED TOKENS (10): "ada", "boise", "century", "decade", "gardens", "government", "metropolitan", "name", "nearly", "population".
0.200
countrymetropolitannearnorthoregonplacepopulationriversnakesouth
SHARED TOKENS (10): "country", "metropolitan", "near", "north", "oregon", "place", "population", "river", "snake", "south".
0.200
WinCo Foods ↗ Q8023592 KW CROSS HIGH
americanboisecaliforniacomfoodfoundedlargestnovemberoperatedoregon
SHARED TOKENS (10): "american", "boise", "california", "com", "food", "founded", "largest", "november", "operated", "oregon".
0.200
Chukar ↗ Q16769157 EXACT TITLE
termtopics
EXACT TITLE in wildlife_landscape: "Chukar".
0.200
industrynathanieltermtopicswyeth
EXACT TITLE in history: "Nathaniel Wyeth".
0.200
Raptor ↗ Q137956 EXACT TITLE
termtopics
EXACT TITLE in wildlife_landscape: "Raptor".
0.200
Camas ↗ Q419373 EXACT TITLE
camastermtopics
EXACT TITLE in history: "Camas".
0.180
aroundbeginningcaliforniacenturyduehistorymigrationrushthroughout
SHARED TOKENS (9): "around", "beginning", "california", "century", "due", "history", "migration", "rush", "throughout".
0.180
americanaprilcasecenturydecadeformermarchreportedwestern
SHARED TOKENS (9): "american", "april", "case", "century", "decade", "former", "march", "reported", "western".
0.180
canadagovernmentgreatlaternorthpointregionswestwestern
SHARED TOKENS (9): "canada", "government", "great", "later", "north", "point", "regions", "west", "western".
0.180
americanheadquartersmilitarynationalnorthoctoberoperationssouthwest
SHARED TOKENS (9): "american", "headquarters", "military", "national", "north", "october", "operations", "south", "west".
0.180
americaamericanfarlargenorthsouthspecieswhitewinter
SHARED TOKENS (9): "america", "american", "far", "large", "north", "south", "species", "white", "winter".
0.160
americacommongrassnamenativenorthspecieswestern
SHARED TOKENS (8): "america", "common", "grass", "name", "native", "north", "species", "western".
0.140
Purshia tridentata ↗ KW CROSS HIGH
americacommonnamenativenorthspecieswestern
SHARED TOKENS (7): "america", "common", "name", "native", "north", "species", "western".
0.120
boisecenterculturalfoundedhistoryinstitution
SHARED TOKENS (6): "boise", "center", "cultural", "founded", "history", "institution".
0.120
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboisedowntowneaglemilespopulation
SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "miles", "population".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboisemetropolitannearlypopulation
SHARED TOKENS (5): "ada", "boise", "metropolitan", "nearly", "population".
0.100
Placerville, Idaho ↗ KW CROSS HIGH
boisemetropolitannampaplacepopulation
SHARED TOKENS (5): "boise", "metropolitan", "nampa", "place", "population".
◈ Frequently Asked Questions
History × Wildlife Landscape — Treasure Valley
HAIKU · HIGH GATE
How did the Bureau of Reclamation's dams change wildlife habitat in the Treasure Valley?
The Arrowrock Dam and Anderson Ranch Dam, built by the Bureau of Reclamation on the Snake River, converted flowing riverine habitat into reservoirs that altered water temperature, flow patterns, and spawning grounds for native fish species. The diversion dams and Deer Flat Embankments further fragmented migration corridors throughout Ada County and Canyon County, requiring later application of the Endangered Species Act of 1973 to protect remaining populations.
What role did irrigation development play in reshaping the Treasure Valley's landscape between Boise and Nampa?
The Bureau of Reclamation's irrigation infrastructure transformed the Snake River Plain from sagebrush and native grassland into agricultural fields across Ada County, Canyon County, and Meridian, eliminating habitat for wildlife species adapted to arid conditions. This conversion accelerated between the 1900s and mid-20th century as the metropolitan population of Boise and surrounding cities grew, reducing the largest remaining stretches of native habitat east of the Snake River.
How did hydroelectric development on the Snake River affect endangered species protection in the Treasure Valley?
The construction of hydroelectric dams by the Bureau of Reclamation, including Arrowrock Dam, degraded critical habitat for Snake River salmon and steelhead, leading to federal protections under the Endangered Species Act of 1973 decades after initial water development. Conservation efforts in Ada County and Canyon County now require balancing the water demands of Boise, Nampa, and Caldwell's growing population against the recovery of native fish species dependent on Snake River conditions.
What historical water management decisions in the Treasure Valley created the current wildlife conservation challenges?
Early 20th-century irrigation projects by the Bureau of Reclamation and the United States Forest Service allocated Snake River water for agricultural expansion across the Snake River Plain, prioritizing development over wildlife corridor protection in Ada County and Canyon County. The diversion dams and embankments constructed to support Boise, Nampa, and Caldwell's growth established a pattern of habitat fragmentation that the Endangered Species Act of 1973 later attempted to reverse through mandatory fish passage and flow management requirements.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
History × Wildlife Landscape 15 QID bridges 206 edges 5,114 ext links 2026-07-17 21:17:42 UTC e86575d484fb60b3
History corridor ↗ Wildlife Landscape corridor ↗ Wildlife Landscape × History ↗ boisestandard.org/standard ↗
Parent Corridors
History × All Other Verticals