—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

History ↔ relates to ↔ Legal

15 Wikipedia bridge articles confirmed in both vertical ledgers. 286 deterministic cross-vertical edges. 7,865 external source links harvested. Every edge provenance-stamped. Every claim auditable.

15 QID Bridge Articles
286 Cross Edges
7,865 External Sources
335 Wikipedia Articles
17 🌲 Evergreen
168 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
History
× Legal
QID Bridge Articles
15
confirmed Wikipedia overlap
Total Cross Edges
286
External Sources Harvested
7,865
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  30 shared tokens
QID Bridge Titles (15)
IdahoTreasure ValleyClarence DarrowSnake RiverBoise State UniversityFrank SteunenbergBoise, IdahoJames HawleyNampa, IdahoAda County, IdahoGarden City, IdahoMeridian, IdahoCanyon County, IdahoCaldwell, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationnorthwestwestwesternadalargestriveramericanpubliccanyonsecondeasternpacificsnakeunionwashingtonnamevalley
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:14:53 UTC
Content Hash
f2efeccc5eed6a10
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
15 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in history (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (30): "agricultural", "agriculture", "basin", "boise", "death", "eastern", "idaho", "industries", "land", "largest", "mining", "mountain", "national", "nationwide", "northwest", "organized", "pacific", "plain", "population", "products".... | EXACT TITLE in history: "Idaho". | EXACT TITLE in legal: "Idaho".
agriculturalagriculturebasinboisedeatheasternidahoindustrieslandlargestminingmountainnationalnationwidenorthwestorganizedpacificplainpopulationproductsriversnaketechnologyterritoryunionutahwashingtonwestwesternwyoming
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in history (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (17): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "lower", "name", "payette", "resources", "river", "snake", "treasure", "valley", "weiser", "western". | EXACT TITLE in history: "Treasure Valley". | EXACT TITLE in legal: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocallowernamepayetteresourcesriversnaketreasurevalleyweiserwestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Clarence Darrow
Q449791 EXACT TITLE 1.000
QID OVERLAP: Q449791 in history (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (15): "advocate", "american", "civil", "criminal", "defense", "lawyer", "leading", "legal", "matters", "member", "prominent", "public", "trade", "trial", "union". | EXACT TITLE in history: "Clarence Darrow".
advocateamericancivilcriminaldefenselawyerleadinglegalmattersmemberprominentpublictradetrialunion
l criminal matters, including the Leopold and Loeb murder trial, the Scopes "monkey" trial, and the Ossian Sweet defense. He was a leading member of the American Civil Liberties Union and a prominent advocate for Georgist economic reform, as well as a noted public speaker, debater, and writer. Darrow is considered by some legal analysts and lawyers to be the greatest lawyer of the 20th century. He was posthumously inducted into the Trial Lawyer Hall of Fame.
Early life Clarence Darrow was born in the small town of Farmdale, Ohio, on April 18, 1857, the fifth son of Amirus and Emily Darrow (née Eddy), but grew up in nearby Kinsman, Ohio. Both the Darrow and Eddy families had deep roots in colonial New England, and several of Darrow's ancestors served in the American Revolution. Darrow's father was an ardent abolitionist and a proud iconoclast and religious freethinker. He was known throughout the town as the "village infidel". Emily Darrow was an early supporter of female suffrage and a women's rights advocate. The young Clarence attended Allegheny College in Pennsylvania and the University of Michigan Law School, but did not graduate from either institution. He attended Allegheny College for only one year before the Panic of 1873 struck, and Darrow was determined not to be a financial burden to his father any longer. Over the next three years he taught in the winter at the district school in a country community. While teaching, Darrow also started to study the law on his own, and by the end of his third year of teaching, he was urged by his family to enter the law department at Ann Arbor. Darrow studied there for only a year when he decided that it would be much more cost-effective to read law in an actual law office. When he felt that he was ready, he took the Ohio bar exam and passed. He was admitted to the Ohio bar in 1878, where he continued to practice.
Position on eugenics In the edition of November 18, 1915, of The Washington Post, Darrow stated: "Chloroform unfit children. Show them the same mercy that is shown beasts that are no longer fit to live." However, Darrow was also critical of some eugenics advocates. By the 1920s, the eugenics movement was very powerful and Darrow was a pointed critic of that movement. In the years immediately before the Supreme Court of the United States would endorse eugenics through Buck v. Bell, Darrow wrote multiple essays criticizing the illogic of the eugenicists, especially the confirmation bias in eugenicist arguments. In a 1925 essay, "The Edwardses and the Jukeses", he imitated the eugenicists' tracking of pedigrees as a way to demonstrate that their retrospective centuries-long family tree studies were omitting literally thousands of relatives whose lives did not support the researchers' preconceptions. Eugenicist arguments about the eminent Edwards family (of the theologian Jonathan Edwards) ignored that family's mediocre relatives, and even ignored some immediately related murderers. Eugenicist arguments about the Jukes family did just the opposite, leaving ignored or untraced many functional and law-abiding relatives. In Darrow's subsequent essay, "The Eugenics Cult" (1926), he attacked the reasoning of eugenicists. "On the basis of what biological principles, and by what psychological hocus-pocus [Dr. William McDougall] reaches the conclusion that the ability to read intelligently denotes a good germ-plasm and desirable citizens I cannot say," he wrote.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in history (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (41): "agencies", "american", "basin", "canyon", "catastrophic", "clark", "commercial", "construction", "created", "decades", "eastern", "falls", "flows", "history", "idaho", "irrigation", "large", "largest", "leading", "lower".... | EXACT TITLE in history: "Snake River". | EXACT TITLE in legal: "Snake River".
agenciesamericanbasincanyoncatastrophicclarkcommercialconstructioncreateddecadeseasternfallsflowshistoryidahoirrigationlargelargestleadinglowernationalnorthwestoncepacificplainpopulationsprojectspublicremovalriver+11
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Populations of anadromous fish began to decline in the late 1800s due to the impact of commercial fishing, logging, mining and agriculture, but even in the 1930s, returning fall chinook alone numbered 500,000. Populations further collapsed once dams were built on the lower Snake and Columbia Rivers, and Hells Canyon Dam blocked access to the upper Snake. Wild Snake River spring and summer chinook returns declined from 130,000 in the 1950s to less than 5,000 in the 1990s. Wild steelhead returns followed a similar pattern, falling from 110,000 in the 1960s to less than 10,000 in the 1990s. Spring, summer and fall-run chinook were all listed as threatened in 1992. Snake River steelhead were also listed as threatened in 1997. Wild chinook salmon and steelhead continued to decline into the 1990s, but have begun an unsteady recovery since 2000, with both chinook and steelhead returns up to 20,000–30,000 in some years. Coho salmon had disappeared from the Snake River by the 1980s, they were reintroduced to the watershed in 1995. Snake River sockeye once numbered to up 150,000 adults. Between 24,000 and 30,000 sockeye returned to Wallowa Lake in the Grande Ronde River watershed, but the run was eliminated by 1905 due to overharvest and unscreened irrigation diversions. The Payette Lake population once numbering up to 100,000 was blocked by the Black Canyon Dam in 1924. Sockeye in the Yellowbelly, Stanley, and Pettit Lakes of the Sawtooth basin were eradicated by management actions of the Idaho Department of Fish and Game in the 1950s, and irrigation diversions lead to the extirpation of the Pettit Lake population. Snake River sockeye returns declined to 4,500 in the 1950s and only a few dozen by the late 1960s. Snake River sockeye were listed as endangered in 1991. Numerous hatcheries are operated by agencies such as the Army Corps, Idaho Power, the Bonneville Power Administration, the U.S. Bureau of Indian Affairs and the U.S. Fish and Wildlife Service, to supplement wild fish populations. Hatcheries release about 33 million salmon and steelhead smolt into the Snake River watershed each year. However, the survival rate for hatchery fish is poor. Just 0.4 percent of hatchery chinook and 1.5 percent of hatchery steelhead returned as adults, as measured at Lower Granite Dam between 2007 and 2016. Upstream of the four lower dams, the Snake River watershed contains some of the best remaining spawning habitat in the Columbia River system, particularly along the Clearwater and Salmon Rivers; the latter is one of the longest undammed rivers in the continental US. A much depleted sockeye salmon run continues to spawn in Redfish Lake near Stanley, Idaho, more than 900 miles (1,400 km) inland from the Pacific Ocean.
Boise State University
EXACT TITLE 1.000
QID OVERLAP: Q891082 in history (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (16): "among", "boise", "business", "college", "education", "founded", "idaho", "independent", "member", "mountain", "program", "public", "school", "total", "university", "west". | EXACT TITLE in history: "Boise State University".
amongboisebusinesscollegeeducationfoundedidahoindependentmembermountainprogrampublicschooltotaluniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Frank Steunenberg
Q880563 EXACT TITLE 0.960
QID OVERLAP: Q880563 in history (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (13): "american", "association", "august", "fourth", "governor", "idaho", "labor", "life", "member", "paid", "serving", "union", "western". | EXACT TITLE in history: "Frank Steunenberg".
americanassociationaugustfourthgovernoridaholaborlifememberpaidservingunionwestern
With labor union support, in 1896 Steunenberg was nominated as both the Democratic and Populist candidate for governor. He won the November election at age 35 (the youngest in the state's history) and became the first non-Republican elected to that office and was re-elected to a second two-year term in 1898. Steunenberg served during a period of considerable labor unrest, particularly in the mining industry in northern Idaho. As a result, many corporations, fearing that Steunenberg's government would not support them if there was a strike, increased their wages for workers. The Bunker Hill Mining Company, however, hired only non-union labor and kept wages lower than unionized mines in the area. In April 1899, members of the Western Federation of Miners destroyed the company's mill at Wardner in the Silver Valley. In response, Steunenberg declared martial law and because the national guard was deployed to the Philippines due to the Spanish–American War of the preceding year, Steunenberg asked President William McKinley to send federal troops to quell the unrest. This action was seen as a betrayal by Steunenberg's union supporters.
Assassination Nearly five years after he left office, Steunenberg was killed outside his house in Caldwell at 1602 Dearborn Street (43.6576°N 116.6823°W / 43.6576; -116.6823) by a bomb rigged to the side gate on 16th Avenue. Harry Orchard, a former miner from the Western Federation of Miners (WFM), was arrested in Caldwell shortly after for the assassination, and the investigation was conducted by Pinkerton agent James McParland. Orchard at first claimed innocence, but after solitary confinement and intense interrogation by McParland, Orchard signed a 64-page typewritten confession detailing years of being a paid assassin and dynamiter for the WFM. Orchard claimed he was hired to kill Steunenberg by leadership of the WFM, and he had been in previous jobs that resulted in at least 17 other deaths. Orchard said his orders for the killing of Steunenberg came from "Big Bill" Haywood, general secretary of the WFM, Charles Moyer, president of the WFM, and George Pettibone, a labor activist who had a prior conviction related to an 1892 labor dispute in Coeur d'Alene. At McParland's urging, the three were arrested in Denver in February 1908, and hurriedly extradited to Idaho for trial. The nationally publicized trial took place in Boise over several months in mid-1907 and included new U.S. Senator William Borah for the prosecution and Clarence Darrow for the defense. On the witness stand, Orchard repeated his written confession, admitting to years of setting bombs for the WFM. He was then cross-examined by defense lawyers for 26 hours, spread out over a week's time. In addition to Orchard, the prosecution presented 80 more witnesses to corroborate Orchard's description of numerous attacks. Darrow and the defense team called over 100 witnesses of their own. Closing arguments lasted two weeks, the most talked about of which was by Darrow. Modern commentators have praised Darrow's closing argument, which used powerful emotional rhetoric focused on the moral superiority of the unions' position. However, contemporary reaction was universally negative. The Chicago Tribune called it "the most unseemly, abusive, inflammatory speech ever delivered in an American courtroom." Despite most observers' opinions that the verdict would be guilty, the jury returned an acquittal for Haywood in late July. Pettibone was defended in a separate trial by Judge Orrin N. Hilton of Denver and was also acquitted, and charges were dropped against Moyer. Orchard pleaded guilty and received a death sentence in a separate trial, but the sentence was commuted to life in prison. In 1952, at 86 years of age and 45 years after the Haywood trial, Orchard wrote in his autobiography that all of his confession and his trial testimony were true.
When in 1899 organized lawlessness challenged the power of Idaho, he upheld the dignity of the state, enforced its authority and restored LAW AND ORDER within its boundaries, for which he was assassinated in 1905."Rugged in body, resolute in mind, massive in the strength of his convictions, he was of the granite hewn." In grateful memory of his courageous devotion to public duty, the people of Idaho have erected this monument. The quote is from Borah's oration at the funeral in 1906. Notes See also Steve Adams, accused accomplice Frank R. Gooding, Idaho Governor during assassination and trials List of assassinated American politicians References Further reading The Trial of Bill Haywood - a detailed account of the murder trial Lukas, J. Anthony (October 14, 1997). Big Trouble: A Murder in a Small Western Town Sets Off a Struggle for the Soul of America. Simon & Schuster. ISBN 0-684-80858-7.
Boise, Idaho
Q35775 EXACT TITLE 0.920
QID OVERLAP: Q35775 in history (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (11): "ada", "annual", "boise", "home", "idaho", "level", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in history: "Boise, Idaho".
adaannualboisehomeidaholevelpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
J
EXACT TITLE 0.820
QID OVERLAP: Q92768312 in history (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (6): "american", "attorney", "hawley", "idaho", "james", "public". | EXACT TITLE in history: "James Hawley".
americanattorneyhawleyidahojamespublic
James Hawley may refer to: James H. Hawley (1847–1929), American attorney and politician from Idaho James Edwin Hawley (1897–1965), Canadian geologist and professor James Hawley (Lord Lieutenant) (born 1937), British businessman and public servant
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in history (tier:branch) and legal (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "home", "idaho", "meridian", "name", "nampa", "northwest", "population", "prominent", "second", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannamenampanorthwestpopulationprominentseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in history (tier:branch) and legal (tier:branch). | SHARED TOKENS (13): "ada", "boise", "cascade", "district", "home", "idaho", "largest", "local", "northwest", "pacific", "population", "second", "washington".
adaboisecascadedistricthomeidaholargestlocalnorthwestpacificpopulationsecondwashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
Q1516892 QID OVERLAP 0.700
QID OVERLAP: Q1516892 in history (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (10): "ada", "boise", "government", "idaho", "main", "name", "nearly", "population", "second", "street".
adaboisegovernmentidahomainnamenearlypopulationsecondstreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in history (tier:branch) and legal (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "cities", "idaho", "meridian", "population", "second".
adaamongboisecitiesidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in history (tier:branch) and legal (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in history (tier:branch) and legal (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in history (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
271 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP271 edges
🌲 EVERGREEN2 edges
0.650
boisecourtcreateddavisdepartmenthistoryidahojeffersonlandrecreationriverroserunsstreetuniversitywestwestern
SHARED TOKENS (17): "boise", "court", "created", "davis", "department", "history", "idaho", "jefferson", "land", "recreation", "river", "rose", "runs", "street", "university", "west", "western". | URL->A (1): https://www.cityofboise.org/departments/parks-and-recreation/parks/julia-davis-park/. | EXACT TITLE in history: "Julia Davis Park".
0.650
aleneaugustclarkcoeurdevelopmentdollarseasternhistoryidaholargelargestnationalnorthernnorthwestprimarypublicreceivedrecognitionsourcesstrong
SHARED TOKENS (22): "alene", "august", "clark", "coeur", "development", "dollars", "eastern", "history", "idaho", "large", "largest", "national", "northern", "northwest", "primary", "public", "received", "recognition", "sources", "strong".... | URL->A (1): https://foresthistory.org/research-explore/us-forest-service-history/policy-and-law/fire-u-s-forest-service/famous-fires/the-1910-fires/. | EXACT TITLE in history: "Great Fire of 1910".
🌿 BRANCH168 edges
0.530
establishedfoundedidahomaterialofficepreservationprogrampublicrecords
SHARED TOKENS (9): "established", "founded", "idaho", "material", "office", "preservation", "program", "public", "records". | URL->A (1): http://www.history.idaho.gov/. | EXACT TITLE in history: "Idaho State Historical Society".
0.500
Abraham Lincoln ↗ Q91 EXACT TITLE
amendmentamericanamongchiefcivilhistoryjanuaryjohnjusticelawyernationalopenedservingsouthernunionwashingtonwon
SHARED TOKENS (17): "amendment", "american", "among", "chief", "civil", "history", "january", "john", "justice", "lawyer", "national", "opened", "serving", "southern", "union", "washington", "won". | EXACT TITLE in history: "Abraham Lincoln".
0.500
Hoover Dam ↗ Q172822 EXACT TITLE
canyoncoloradoconstructionfederalgovernmentirrigationlargenameopenedpowerprojectpublicriverschedulesupportwaterworkers
SHARED TOKENS (17): "canyon", "colorado", "construction", "federal", "government", "irrigation", "large", "name", "opened", "power", "project", "public", "river", "schedule", "support", "water", "workers". | EXACT TITLE in history: "Hoover Dam".
0.500
Shoshone ↗ Q26774 EXACT TITLE
americanbasinbrancheasternfamilyidaholargemembersnorthernrecognizedsnakesoutherntribeutahwesternwyoming
SHARED TOKENS (16): "american", "basin", "branch", "eastern", "family", "idaho", "large", "members", "northern", "recognized", "snake", "southern", "tribe", "utah", "western", "wyoming". | EXACT TITLE in history: "Shoshone".
0.500
amongbusinesscitiesconstructioncountriesdevelopmentdomesticfarmersfinancialgeneralglobalgrowinggrowthhawleyincomeindustriesindustryitselflandlarge
SHARED TOKENS (38): "among", "business", "cities", "construction", "countries", "development", "domestic", "farmers", "financial", "general", "global", "growing", "growth", "hawley", "income", "industries", "industry", "itself", "land", "large".... | EXACT TITLE in history: "Great Depression".
0.500
departmentdistrictdistrictsestablishedfederalfinancialgeneralgovernmenthistorylistednationalpreservationpublicrecognitionresourcestaxtotal
SHARED TOKENS (17): "department", "district", "districts", "established", "federal", "financial", "general", "government", "history", "listed", "national", "preservation", "public", "recognition", "resources", "tax", "total". | EXACT TITLE in history: "National Register of Historic Places".
0.500
Corporation ↗ Q167037 EXACT TITLE
businesscontextcorporatecorporationcountriesestablishedinvestorslegallegislativelegislatureliabilitylocalmembernaturalofficeofficerownedpracticepublicrecognized
SHARED TOKENS (25): "business", "context", "corporate", "corporation", "countries", "established", "investors", "legal", "legislative", "legislature", "liability", "local", "member", "natural", "office", "officer", "owned", "practice", "public", "recognized".... | EXACT TITLE in history: "Corporation". | EXACT TITLE in legal: "Corporation".
0.500
americanassetsaugustbasinbaybeyondbusinesscharlescollectioncommercialcorporationdeathdepartmentemployeesenglishestablishedfamilyfiledformerfounded
SHARED TOKENS (34): "american", "assets", "august", "basin", "bay", "beyond", "business", "charles", "collection", "commercial", "corporation", "death", "department", "employees", "english", "established", "family", "filed", "former", "founded".... | EXACT TITLE in history: "Hudson's Bay Company".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetsbusinesscourtcreatedcriminalenglishestablishedfederalgovernedincomeindividualslegallifenaturalpublicrequiresrightsingle
SHARED TOKENS (18): "assets", "business", "court", "created", "criminal", "english", "established", "federal", "governed", "income", "individuals", "legal", "life", "natural", "public", "requires", "right", "single". | EXACT TITLE in legal: "Trust (law)".
0.500
departmentdevelopmentestablishedfarmersfederalgovernmentirrigationjunelargestoversightpowerprogramprojectssecondsecretarywaterwestern
SHARED TOKENS (17): "department", "development", "established", "farmers", "federal", "government", "irrigation", "june", "largest", "oversight", "power", "program", "projects", "second", "secretary", "water", "western". | EXACT TITLE in history: "Bureau of Reclamation".
0.500
boisebranchdatadistrictdistrictsgovernmenthouseidaholegislativelegislaturelowermemberspopulationrepresentingresidentssinglewashington
SHARED TOKENS (17): "boise", "branch", "data", "district", "districts", "government", "house", "idaho", "legislative", "legislature", "lower", "members", "population", "representing", "residents", "single", "washington". | EXACT TITLE in history: "Idaho Legislature". | EXACT TITLE in legal: "Idaho Legislature".
0.500
agenciescreateddisputeseffectivefallfinancialfoundedfrenchgeneralglobalgooditselfjanuaryjoinjuneleadingmainmembermembersoperations
SHARED TOKENS (30): "agencies", "created", "disputes", "effective", "fall", "financial", "founded", "french", "general", "global", "good", "itself", "january", "join", "june", "leading", "main", "member", "members", "operations".... | EXACT TITLE in history: "League of Nations".
0.500
americanamongbasincriticaleasternenvironmentfallfamilyfoodindependentindividualsmigrationnamenorthernterritorytribewesternwork
SHARED TOKENS (18): "american", "among", "basin", "critical", "eastern", "environment", "fall", "family", "food", "independent", "individuals", "migration", "name", "northern", "territory", "tribe", "western", "work". | EXACT TITLE in history: "Northern Paiute people".
0.500
amongcasescontextcountriesdeathdomesticestablishedexperiencefamilyfinancialformerhomelevellifemembersofficeorganizationphysicalpowerrelationships
SHARED TOKENS (24): "among", "cases", "context", "countries", "death", "domestic", "established", "experience", "family", "financial", "former", "home", "level", "life", "members", "office", "organization", "physical", "power", "relationships".... | EXACT TITLE in legal: "Domestic violence".
0.500
Patent ↗ Q253623 EXACT TITLE
amongclaimscountriesfalllegalmemberminimumnationalorganizationpublicrightrightstechnologytradeworld
SHARED TOKENS (15): "among", "claims", "countries", "fall", "legal", "member", "minimum", "national", "organization", "public", "right", "rights", "technology", "trade", "world". | EXACT TITLE in legal: "Patent".
0.500
americanamongannualassetsbeyondcommercialcreateddecadesexpansionexperiencehousejanuaryjohnlandleadingmaterialnorthwestopenedoperationsowned
SHARED TOKENS (27): "american", "among", "annual", "assets", "beyond", "commercial", "created", "decades", "expansion", "experience", "house", "january", "john", "land", "leading", "material", "northwest", "opened", "operations", "owned".... | EXACT TITLE in history: "Pacific Fur Company".
0.500
Nez Perce ↗ Q1123923 EXACT TITLE
amongbasincommunitycontactcourtfarmersfrenchfullgovernmentgroupidahoinstitutionslandmembersnamenationalnetworknorthernnorthwestoperates
SHARED TOKENS (31): "among", "basin", "community", "contact", "court", "farmers", "french", "full", "government", "group", "idaho", "institutions", "land", "members", "name", "national", "network", "northern", "northwest", "operates".... | EXACT TITLE in history: "Nez Perce".
0.500
americandeathdevelopmentexpandedfederalfoodgovernmenthomejameslaborlargestlocalnationalnaturalownedphysicalprogrampublicresourcessources
SHARED TOKENS (24): "american", "death", "development", "expanded", "federal", "food", "government", "home", "james", "labor", "largest", "local", "national", "natural", "owned", "physical", "program", "public", "resources", "sources".... | EXACT TITLE in history: "Civilian Conservation Corps".
0.500
Albertsons ↗ EXACT TITLE
americanattorneyboisecoloradocorporateemployeesfederalfiledformerfoundedgeneralidahojanuarylargestnameregionalthirdtotaltradewashington
SHARED TOKENS (21): "american", "attorney", "boise", "colorado", "corporate", "employees", "federal", "filed", "former", "founded", "general", "idaho", "january", "largest", "name", "regional", "third", "total", "trade", "washington".... | EXACT TITLE in history: "Albertsons".
0.500
businesscommercialcommunitycorporatecorporationdeathemployeesenvironmentfinancialformationgovernanceinvestorslegalmarketmattersorganizationspracticerelationsrightssystem
SHARED TOKENS (20): "business", "commercial", "community", "corporate", "corporation", "death", "employees", "environment", "financial", "formation", "governance", "investors", "legal", "market", "matters", "organizations", "practice", "relations", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.500
authoritycasescivilcourtdisputesestablishedfactsfinalfrenchissuesitselflegallevellowernationwideoncepowerrightsecondstandard
SHARED TOKENS (24): "authority", "cases", "civil", "court", "disputes", "established", "facts", "final", "french", "issues", "itself", "legal", "level", "lower", "nationwide", "once", "power", "right", "second", "standard".... | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalagriculturebeyonddefensedepartmentforeigngrowthimmigrationindividualsleadinglowerminimumphysicalpresenceprogramprojectsrequiredrequiressecuritytotal
SHARED TOKENS (21): "additional", "agriculture", "beyond", "defense", "department", "foreign", "growth", "immigration", "individuals", "leading", "lower", "minimum", "physical", "presence", "program", "projects", "required", "requires", "security", "total".... | EXACT TITLE in legal: "H-1B visa".
0.500
agricultureamericanandersonboiseconstructionfallsflowshomeidahoirrigationlaborlevelmonthsmountainnationalpowerprimaryprojectsrivertwin
SHARED TOKENS (24): "agriculture", "american", "anderson", "boise", "construction", "falls", "flows", "home", "idaho", "irrigation", "labor", "level", "months", "mountain", "national", "power", "primary", "projects", "river", "twin".... | EXACT TITLE in history: "Anderson Ranch Dam".
0.500
americanassetscommunityfamilyfederalhouseidahonationalnewsoperationsorganizationsprogramprojectpublicreportssecurity
SHARED TOKENS (16): "american", "assets", "community", "family", "federal", "house", "idaho", "national", "news", "operations", "organizations", "program", "project", "public", "reports", "security". | EXACT TITLE in history: "Church Committee".
0.500
businesseasternestablishedfarmersidaholowermigrationorganizedriverserveterritoryvalleywestwesternwyoming
SHARED TOKENS (15): "business", "eastern", "established", "farmers", "idaho", "lower", "migration", "organized", "river", "serve", "territory", "valley", "west", "western", "wyoming". | EXACT TITLE in history: "Oregon Trail".
0.500
aleneamongboisebranchcoeurestablishedfallsidahomainofficesopenedoperatespostprofessionalpublicstatewideuniversity
SHARED TOKENS (17): "alene", "among", "boise", "branch", "coeur", "established", "falls", "idaho", "main", "offices", "opened", "operates", "post", "professional", "public", "statewide", "university". | EXACT TITLE in history: "University of Idaho". | EXACT TITLE in legal: "University of Idaho".
0.500
Weeks Act ↗ Q7979527 EXACT TITLE
agricultureamericanbillchiefdepartmentdevelopmenteasternexpandedfederalflowformergeneralgovernmenthouseidahojohnlandlargelocalmember
SHARED TOKENS (37): "agriculture", "american", "bill", "chief", "department", "development", "eastern", "expanded", "federal", "flow", "former", "general", "government", "house", "idaho", "john", "land", "large", "local", "member".... | EXACT TITLE in history: "Weeks Act".
0.500
bearchiefcommunityfoodhistoryidahojanuarylargelargestnorthernriversinglesourcesterritorywashington
SHARED TOKENS (15): "bear", "chief", "community", "food", "history", "idaho", "january", "large", "largest", "northern", "river", "single", "sources", "territory", "washington". | EXACT TITLE in history: "Bear River Massacre".
0.500
Fort Hall ↗ Q5471267 EXACT TITLE
bayeasternfoundedidahokeylistedminingnationalnorthernnorthwestpacificpocatellopostriversnaketerritoryvalleywestwestern
SHARED TOKENS (19): "bay", "eastern", "founded", "idaho", "key", "listed", "mining", "national", "northern", "northwest", "pacific", "pocatello", "post", "river", "snake", "territory", "valley", "west", "western". | EXACT TITLE in history: "Fort Hall".
0.500
americanannualassociationbarboisebusinesscollegecountrieseducationenvironmentalestablishedexpansionfallfallsforeignfullidaholegislaturemainmember
SHARED TOKENS (33): "american", "annual", "association", "bar", "boise", "business", "college", "countries", "education", "environmental", "established", "expansion", "fall", "falls", "foreign", "full", "idaho", "legislature", "main", "member".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
americanbillcaseschairmancollectiondeathelectedfamilyfinalforeignformerhistoryhouseidahojanuaryjunelandlargelawyerlegal
SHARED TOKENS (32): "american", "bill", "cases", "chairman", "collection", "death", "elected", "family", "final", "foreign", "former", "history", "house", "idaho", "january", "june", "land", "large", "lawyer", "legal".... | EXACT TITLE in history: "William Borah".
0.500
administrativeagenciesamericanbroughtdeathenglishgovernmentjusticelandlegallibertynaturalpowerrightstrade
SHARED TOKENS (15): "administrative", "agencies", "american", "brought", "death", "english", "government", "justice", "land", "legal", "liberty", "natural", "power", "rights", "trade". | EXACT TITLE in history: "Due process".
0.500
Gold rush ↗ Q273182 EXACT TITLE
americanbeyondenvironmentalgeneralglobalhistoryimmigrationincomeitselflargelocalmigrationminingsingletradeworld
SHARED TOKENS (16): "american", "beyond", "environmental", "general", "global", "history", "immigration", "income", "itself", "large", "local", "migration", "mining", "single", "trade", "world". | EXACT TITLE in history: "Gold rush".
0.500
americanconstructioncorporationdevelopmentfederalfinanceformerfullgovernmenthistoryindustryjunekeylandlocalnationalpaidpopulationprofessionalprogram
SHARED TOKENS (29): "american", "construction", "corporation", "development", "federal", "finance", "former", "full", "government", "history", "industry", "june", "key", "land", "local", "national", "paid", "population", "professional", "program".... | EXACT TITLE in history: "Works Progress Administration".
0.500
Mediation ↗ Q223871 EXACT TITLE
amongauthoritycivilcommercialcountriesdisputesindependentindividualsissueslegalpracticeprofessionalreachthirdtraining
SHARED TOKENS (15): "among", "authority", "civil", "commercial", "countries", "disputes", "independent", "individuals", "issues", "legal", "practice", "professional", "reach", "third", "training". | EXACT TITLE in legal: "Mediation".
0.500
Contract ↗ Q93288 EXACT TITLE
businesscivilcommercialframeworkgeneralgovernedgroundsindependentindividualslegallitigationnationalpracticerightstrade
SHARED TOKENS (15): "business", "civil", "commercial", "framework", "general", "governed", "grounds", "independent", "individuals", "legal", "litigation", "national", "practice", "rights", "trade". | EXACT TITLE in history: "Contract". | EXACT TITLE in legal: "Contract".
0.500
adaboiseconstructionfederalfullidahoirrigationlevelmountainoperatingpowerprimaryriversnakesouthernwestern
SHARED TOKENS (16): "ada", "boise", "construction", "federal", "full", "idaho", "irrigation", "level", "mountain", "operating", "power", "primary", "river", "snake", "southern", "western". | EXACT TITLE in history: "Lucky Peak Dam".
0.500
agenciesbranchdevelopmentenergyenvironmentenvironmentalglobalgrowthissueskeylegalnationalnationallynaturalorganizationspreservationresourcesrightssafetytrade
SHARED TOKENS (20): "agencies", "branch", "development", "energy", "environment", "environmental", "global", "growth", "issues", "key", "legal", "national", "nationally", "natural", "organizations", "preservation", "resources", "rights", "safety", "trade". | EXACT TITLE in legal: "Environmental law".
0.500
assetsbranchbusinesscivilcommercialdistrictfallfinancefinancialfinancingfoodformationframeworkgeneralinsuranceissueslegalmarketsmattersorganizations
SHARED TOKENS (32): "assets", "branch", "business", "civil", "commercial", "district", "fall", "finance", "financial", "financing", "food", "formation", "framework", "general", "insurance", "issues", "legal", "markets", "matters", "organizations".... | EXACT TITLE in legal: "Commercial law".
0.500
americanaugustbusinessdepartmentdevelopmentenvironmentenvironmentalestablishedgovernorhistoryidaholifepublicsecondsecretaryserveservedstrongtotalwashington
SHARED TOKENS (22): "american", "august", "business", "department", "development", "environment", "environmental", "established", "governor", "history", "idaho", "life", "public", "second", "secretary", "serve", "served", "strong", "total", "washington".... | EXACT TITLE in history: "Cecil Andrus".
0.500
americanbillbusinesscomcombinedcorporationcreateddatadavidformerfoundedgovernmentgrowinghistoryindustrylargeleadingnamepersonalproducts
SHARED TOKENS (26): "american", "bill", "business", "com", "combined", "corporation", "created", "data", "david", "former", "founded", "government", "growing", "history", "industry", "large", "leading", "name", "personal", "products".... | EXACT TITLE in history: "Hewlett-Packard".
0.500
New Deal ↗ Q186356 EXACT TITLE
additionalagenciesagriculturalauthoritybasinconstructioncorporationcourtcreateddevelopmentdomesticemployeesfederalfinancialfullgovernmentindustriesinsuranceinvestorslabor
SHARED TOKENS (44): "additional", "agencies", "agricultural", "authority", "basin", "construction", "corporation", "court", "created", "development", "domestic", "employees", "federal", "financial", "full", "government", "industries", "insurance", "investors", "labor".... | EXACT TITLE in history: "New Deal".
0.500
developmentexpandedfinalfullgovernmentlandlegaloncepowerpublicrighttaxthirdtitletotal
SHARED TOKENS (15): "development", "expanded", "final", "full", "government", "land", "legal", "once", "power", "public", "right", "tax", "third", "title", "total". | EXACT TITLE in legal: "Eminent domain".
0.500
Lawsuit ↗ Q697327 EXACT TITLE
broughtbusinesscivilclaimscourtcriminaldisputesindividualsissueslegallitigationorganizationspublicrepresentingrequiredright
SHARED TOKENS (16): "brought", "business", "civil", "claims", "court", "criminal", "disputes", "individuals", "issues", "legal", "litigation", "organizations", "public", "representing", "required", "right". | EXACT TITLE in history: "Lawsuit".
0.500
amendmentcasescountriescourtcriminalestablishedfederalfullgovernmentlawyerlegalofficepublicrequiressupremetrial
SHARED TOKENS (16): "amendment", "cases", "countries", "court", "criminal", "established", "federal", "full", "government", "lawyer", "legal", "office", "public", "requires", "supreme", "trial". | EXACT TITLE in legal: "Public defender".
0.500
casescivilcollectioncountriescreateddevelopmentfamilyfinancialincomememberminimumpaidprimaryrecognizedrequiredrequiresrightrightssignedsingle
SHARED TOKENS (24): "cases", "civil", "collection", "countries", "created", "development", "family", "financial", "income", "member", "minimum", "paid", "primary", "recognized", "required", "requires", "right", "rights", "signed", "single".... | EXACT TITLE in legal: "Child support".
0.500
americanbayboiseclaimsclerkformergeneralgovernoridahojohnjunenationalnorthwestpacificpayettepostriversecondsnakewest
SHARED TOKENS (20): "american", "bay", "boise", "claims", "clerk", "former", "general", "governor", "idaho", "john", "june", "national", "northwest", "pacific", "payette", "post", "river", "second", "snake", "west". | EXACT TITLE in history: "Francois Payette".
0.500
adaamericanboisecharlesconstructiondepartmentdistrictfederalfinalfirmformationgovernmenthomeidahojohnlegislaturenationalservedterritoryunion
SHARED TOKENS (22): "ada", "american", "boise", "charles", "construction", "department", "district", "federal", "final", "firm", "formation", "government", "home", "idaho", "john", "legislature", "national", "served", "territory", "union".... | EXACT TITLE in history: "Idaho State Capitol".
0.490
boisecourtcreatedidaholegislatureoperationssupreme
SHARED TOKENS (7): "boise", "court", "created", "idaho", "legislature", "operations", "supreme". | URL->B (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.480
broughtcoloradodistrictkeylaborlocalnameorganizationorganizationsrefusingunionwesternworkersworld
SHARED TOKENS (14): "brought", "colorado", "district", "key", "labor", "local", "name", "organization", "organizations", "refusing", "union", "western", "workers", "world". | EXACT TITLE in history: "Western Federation of Miners".
0.480
Fort Boise ↗ Q3077782 EXACT TITLE
bayboisecanyondistrictestablishedgovernmentidahonorthernpostriversecondsnaketerritorywestern
SHARED TOKENS (14): "bay", "boise", "canyon", "district", "established", "government", "idaho", "northern", "post", "river", "second", "snake", "territory", "western". | EXACT TITLE in history: "Fort Boise".
0.480
Court ↗ Q41487 EXACT TITLE
administrativeauthoritycivilcourtcriminaldisputesestablishedgovernmentjusticelegallegislaturematterspowertrial
SHARED TOKENS (14): "administrative", "authority", "civil", "court", "criminal", "disputes", "established", "government", "justice", "legal", "legislature", "matters", "power", "trial". | EXACT TITLE in history: "Court". | EXACT TITLE in legal: "Court".
0.480
Real estate ↗ Q684740 EXACT TITLE
businesscommercialgeneralgovernmentgrowingindividualslandlegalnaturalownedpersonalpublicresourceswater
SHARED TOKENS (14): "business", "commercial", "general", "government", "growing", "individuals", "land", "legal", "natural", "owned", "personal", "public", "resources", "water". | EXACT TITLE in legal: "Real estate".
0.480
adaboisecombinedcommercialdepartmentfallsgeneralidahonationalofficeroperatesrightssupportwestern
SHARED TOKENS (14): "ada", "boise", "combined", "commercial", "department", "falls", "general", "idaho", "national", "officer", "operates", "rights", "support", "western". | EXACT TITLE in history: "Boise Airport".
0.460
Teton Dam ↗ Q1595414 EXACT TITLE
agenciescatastrophicclaimseasternfederalgovernmentidahojunepaidrivertetontotalwestern
SHARED TOKENS (13): "agencies", "catastrophic", "claims", "eastern", "federal", "government", "idaho", "june", "paid", "river", "teton", "total", "western". | EXACT TITLE in history: "Teton Dam".
0.460
Green card ↗ Q6676995 EXACT TITLE
amongattorneycasescriminalfederalgeneralgoodimmigrationmemberremovalresidentsserveworkers
SHARED TOKENS (13): "among", "attorney", "cases", "criminal", "federal", "general", "good", "immigration", "member", "removal", "residents", "serve", "workers". | EXACT TITLE in legal: "Green card".
0.460
casesclaimsfactsfamilygoodlandlegalpublicrepresentingrequiredrightrightstitle
SHARED TOKENS (13): "cases", "claims", "facts", "family", "good", "land", "legal", "public", "representing", "required", "right", "rights", "title". | EXACT TITLE in history: "Title (property)". | EXACT TITLE in legal: "Title (property)".
0.460
agenciesbusinesscollectioncourtdomesticestablishedfederalforeigngovernmentphysicalpublicrecordsrequires
SHARED TOKENS (13): "agencies", "business", "collection", "court", "domestic", "established", "federal", "foreign", "government", "physical", "public", "records", "requires". | EXACT TITLE in history: "Foreign Intelligence Surveillance Act".
0.460
Lawyer ↗ Q40348 EXACT TITLE
bareducationindividualslawyerlegalmatterspracticeprofessionalrequiredrightssystemtrainingwork
SHARED TOKENS (13): "bar", "education", "individuals", "lawyer", "legal", "matters", "practice", "professional", "required", "rights", "system", "training", "work". | EXACT TITLE in history: "Lawyer". | EXACT TITLE in legal: "Lawyer".
0.460
agricultureamericanboisecivilidahoirrigationlevelnationalopenedprimaryriverwaterwestern
SHARED TOKENS (13): "agriculture", "american", "boise", "civil", "idaho", "irrigation", "level", "national", "opened", "primary", "river", "water", "western". | EXACT TITLE in history: "Arrowrock Dam".
0.460
americanboisecreateddatafoundedidahomarketownedproductsreachsemiconductorservedtechnology
SHARED TOKENS (13): "american", "boise", "created", "data", "founded", "idaho", "market", "owned", "products", "reach", "semiconductor", "served", "technology". | EXACT TITLE in history: "Micron Technology".
0.460
adaboisecanalcanyonidahoirrigationriversecondsystemtreasurevalleywaterwestern
SHARED TOKENS (13): "ada", "boise", "canal", "canyon", "idaho", "irrigation", "river", "second", "system", "treasure", "valley", "water", "western". | EXACT TITLE in history: "New York Canal".
0.460
expansionfederalhistorylandlargestnationalpreservationrecreationsignedsinglespecialsystemwhite
SHARED TOKENS (13): "expansion", "federal", "history", "land", "largest", "national", "preservation", "recreation", "signed", "single", "special", "system", "white". | EXACT TITLE in history: "Alaska National Interest Lands Conservation Act".
0.450
finalidahoorganizedterritoryunion
SHARED TOKENS (5): "final", "idaho", "organized", "territory", "union". | URL->A (1): https://www.boisecounty.us/visit-boise-county/. | EXACT TITLE in history: "Idaho Territory".
0.450
alenecoeurcommunitydepartmenteducationelectedestablishedformerfoundedgovernedgovernmentidaholandlargestmembersmountainplainpocatellopopulationpost
SHARED TOKENS (30): "alene", "coeur", "community", "department", "education", "elected", "established", "former", "founded", "governed", "government", "idaho", "land", "largest", "members", "mountain", "plain", "pocatello", "population", "post".... | URL->A (1): https://www.sbtribes.com/.
0.450
chiefcourtidahojusticesupreme
SHARED TOKENS (5): "chief", "court", "idaho", "justice", "supreme". | URL->B (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.440
Divorce ↗ Q93190 EXACT TITLE
authoritycivilcountriescourtformerissueslegalrequiredrequiressupportunionworld
SHARED TOKENS (12): "authority", "civil", "countries", "court", "former", "issues", "legal", "required", "requires", "support", "union", "world". | EXACT TITLE in legal: "Divorce".
0.440
civilcourtenglishenvironmentalindividualsissueslandlegalpersonalpublicrelationshipsrights
SHARED TOKENS (12): "civil", "court", "english", "environmental", "individuals", "issues", "land", "legal", "personal", "public", "relationships", "rights". | EXACT TITLE in legal: "Property law".
0.440
advocatescountriesgoodlandlegallowermainprimaryrightsstrongtradeworld
SHARED TOKENS (12): "advocates", "countries", "good", "land", "legal", "lower", "main", "primary", "rights", "strong", "trade", "world". | EXACT TITLE in legal: "Intellectual property".
0.440
idaholandmainmountainnationalnorthernprimaryrecreationriverwestwesternwhite
SHARED TOKENS (12): "idaho", "land", "main", "mountain", "national", "northern", "primary", "recreation", "river", "west", "western", "white". | EXACT TITLE in history: "White Cloud Mountains".
0.440
Assault ↗ Q365680 EXACT TITLE
civilcombinedcontactcriminaldeathlegalliabilityofficerphysicalsinglesystemviolence
SHARED TOKENS (12): "civil", "combined", "contact", "criminal", "death", "legal", "liability", "officer", "physical", "single", "system", "violence". | EXACT TITLE in legal: "Assault".
0.440
agriculturebusinesschiefcoveringdepartmentdevelopmentfederallandnationalofficeoperationssystem
SHARED TOKENS (12): "agriculture", "business", "chief", "covering", "department", "development", "federal", "land", "national", "office", "operations", "system". | EXACT TITLE in history: "United States Forest Service".
0.440
augustcollectionconstructiondistrictgeneralidahominingmountainnationalregionalstandardwork
SHARED TOKENS (12): "august", "collection", "construction", "district", "general", "idaho", "mining", "mountain", "national", "regional", "standard", "work". | EXACT TITLE in history: "Pulaski (tool)".
0.440
authoritycasescountriesfederalgovernmentlandlegislativelegislaturepopulationpowerrightstax
SHARED TOKENS (12): "authority", "cases", "countries", "federal", "government", "land", "legislative", "legislature", "population", "power", "rights", "tax". | EXACT TITLE in legal: "Constitutional law".
0.420
contactcountriesdeathfamilyhouselegalmemberphysicalrightrightsstandard
SHARED TOKENS (11): "contact", "countries", "death", "family", "house", "legal", "member", "physical", "right", "rights", "standard". | EXACT TITLE in legal: "Child custody".
0.420
amongcountriesdevelopmentenglishfinancialgovernmentlegalnationalrightssystemworld
SHARED TOKENS (11): "among", "countries", "development", "english", "financial", "government", "legal", "national", "rights", "system", "world". | EXACT TITLE in legal: "Real estate transaction".
0.420
Law firm ↗ Q613142 EXACT TITLE
businesscasescivilcriminalfirmindividualslegalmatterspracticeprimaryrights
SHARED TOKENS (11): "business", "cases", "civil", "criminal", "firm", "individuals", "legal", "matters", "practice", "primary", "rights". | EXACT TITLE in legal: "Law firm".
0.420
associationbasinboiseidaholandmountainnationalorganizationrecreationrunswestern
SHARED TOKENS (11): "association", "basin", "boise", "idaho", "land", "mountain", "national", "organization", "recreation", "runs", "western". | EXACT TITLE in history: "Bogus Basin".
0.420
americancasescivilcountriescourtcriminalgenerallegalsinglesystemtrial
SHARED TOKENS (11): "american", "cases", "civil", "countries", "court", "criminal", "general", "legal", "single", "system", "trial". | EXACT TITLE in legal: "Jury trial".
0.420
agriculturalcitiesidaholandlargestnorthwestplainriversnakesouthernwyoming
SHARED TOKENS (11): "agricultural", "cities", "idaho", "land", "largest", "northwest", "plain", "river", "snake", "southern", "wyoming". | EXACT TITLE in history: "Snake River Plain". | EXACT TITLE in legal: "Snake River Plain".
0.420
createddeathfederalidaholargestmountainnameoutsideriversinglevalley
SHARED TOKENS (11): "created", "death", "federal", "idaho", "largest", "mountain", "name", "outside", "river", "single", "valley". | EXACT TITLE in history: "Frank Church–River of No Return Wilderness".
0.420
amongcreatedemployeesgeneralinsuranceliabilityoutsiderightsecuritysystemworkers
SHARED TOKENS (11): "among", "created", "employees", "general", "insurance", "liability", "outside", "right", "security", "system", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.420
americancivilestablishednamenationaloldestserveservedunionwestwestern
SHARED TOKENS (11): "american", "civil", "established", "name", "national", "oldest", "serve", "served", "union", "west", "western". | EXACT TITLE in history: "Buffalo Soldier".
0.400
Arbitration ↗ Q207946 EXACT TITLE
commercialcontextcountriescourtdisputeslocalmattersrightrightsthird
SHARED TOKENS (10): "commercial", "context", "countries", "court", "disputes", "local", "matters", "right", "rights", "third". | EXACT TITLE in legal: "Arbitration".
0.400
bardevelopmentdistricteducationlegalminimumoutsidepracticeprofessionalrequired
SHARED TOKENS (10): "bar", "development", "district", "education", "legal", "minimum", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.400
educationenvironmentidaholifemembersorganizationprofessionalpublicqualitywater
SHARED TOKENS (10): "education", "environment", "idaho", "life", "members", "organization", "professional", "public", "quality", "water". | EXACT TITLE in history: "Idaho Conservation League".
0.400
amongfallsfoundedidahomainmeridianpocatellopublictwinuniversity
SHARED TOKENS (10): "among", "falls", "founded", "idaho", "main", "meridian", "pocatello", "public", "twin", "university". | EXACT TITLE in history: "Idaho State University".
0.400
Aquifer ↗ Q208791 EXACT TITLE
aquiferbeyondenvironmentflowformationhomelandlayermaterialwater
SHARED TOKENS (10): "aquifer", "beyond", "environment", "flow", "formation", "home", "land", "layer", "material", "water". | EXACT TITLE in history: "Aquifer". | EXACT TITLE in legal: "Aquifer".
0.400
bankruptcycasescivilcountriesdeathlegalrightrightssupportunion
SHARED TOKENS (10): "bankruptcy", "cases", "civil", "countries", "death", "legal", "right", "rights", "support", "union". | EXACT TITLE in legal: "Prenuptial agreement".
0.400
Overtime ↗ Q667022 EXACT TITLE
beyondcountriesemployeeslevelnationalreceivedtradeworkworkersworks
SHARED TOKENS (10): "beyond", "countries", "employees", "level", "national", "received", "trade", "work", "workers", "works". | EXACT TITLE in history: "Overtime".
0.400
Jury ↗ Q837675 EXACT TITLE
civilcountriescourtenglishgrouplegalprofessionalsinglesystemtrial
SHARED TOKENS (10): "civil", "countries", "court", "english", "group", "legal", "professional", "single", "system", "trial". | EXACT TITLE in legal: "Jury".
0.400
civilcourtfinalformerlegallowernorthernsinglesupremetrial
SHARED TOKENS (10): "civil", "court", "final", "former", "legal", "lower", "northern", "single", "supreme", "trial". | EXACT TITLE in history: "Supreme court". | EXACT TITLE in legal: "Supreme court".
0.400
boisecaldwellcanyoneasternfourthidaholargestnampapopulationwestern
SHARED TOKENS (10): "boise", "caldwell", "canyon", "eastern", "fourth", "idaho", "largest", "nampa", "population", "western". | EXACT TITLE in history: "Parma, Idaho".
0.400
Creditor ↗ Q157165 EXACT TITLE
assetscourtfinancialgeneralgovernmentorganizationrepresentssecondsecurityworld
SHARED TOKENS (10): "assets", "court", "financial", "general", "government", "organization", "represents", "second", "security", "world". | EXACT TITLE in legal: "Creditor".
0.380
americancasesenglishfiledlegalliabilitylifepersonalquality
SHARED TOKENS (9): "american", "cases", "english", "filed", "legal", "liability", "life", "personal", "quality". | EXACT TITLE in legal: "Personal injury".
0.380
Immigration law ↗ EXACT TITLE
countriesfreedomgovernmentimmigrationlegalmattersnationalrightrights
SHARED TOKENS (9): "countries", "freedom", "government", "immigration", "legal", "matters", "national", "right", "rights". | EXACT TITLE in legal: "Immigration law".
0.380
Deed ↗ Q705914 EXACT TITLE
attorneylegalliabilitypracticerightrightssignedthirdtitle
SHARED TOKENS (9): "attorney", "legal", "liability", "practice", "right", "rights", "signed", "third", "title". | EXACT TITLE in history: "Deed".
0.380
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationlawyerlegalprofessionalschoolsystemuniversity
SHARED TOKENS (9): "college", "department", "education", "lawyer", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.380
Zoning ↗ Q702232 EXACT TITLE
countriesdevelopmentgovernmentgrowthlandlocalplanningscalesingle
SHARED TOKENS (9): "countries", "development", "government", "growth", "land", "local", "planning", "scale", "single". | EXACT TITLE in legal: "Zoning".
0.370
Ed Pulaski ↗ Q5335296 EXACT TITLE
idahowest
SHARED TOKENS (2): "idaho", "west". | URL->A (1): https://foresthistory.org/research-explore/us-forest-service-history/policy-and-law/fire-u-s-forest-service/famous-fires/the-1910-fires/. | EXACT TITLE in history: "Ed Pulaski".
0.360
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivildeathindividualslegalpracticerights
SHARED TOKENS (8): "among", "assets", "civil", "death", "individuals", "legal", "practice", "rights". | EXACT TITLE in legal: "Inheritance".
0.360
Bannock people ↗ EXACT TITLE
basinidahonorthernrecognizedsoutherntribewesternwyoming
SHARED TOKENS (8): "basin", "idaho", "northern", "recognized", "southern", "tribe", "western", "wyoming". | EXACT TITLE in history: "Bannock people".
0.360
Probate ↗ Q6500369 EXACT TITLE
assetsclaimscourtdeathlegalpersonalpowerpublic
SHARED TOKENS (8): "assets", "claims", "court", "death", "legal", "personal", "power", "public". | EXACT TITLE in legal: "Probate".
0.360
augustchiefdeathgeneralidahojuneterritorywashington
SHARED TOKENS (8): "august", "chief", "death", "general", "idaho", "june", "territory", "washington". | EXACT TITLE in history: "Bannock War".
0.340
casescivilcommunitycountriesownedsystemworld
SHARED TOKENS (7): "cases", "civil", "community", "countries", "owned", "system", "world". | EXACT TITLE in legal: "Community property".
0.340
assetsdeathlegallifenetplanningtax
SHARED TOKENS (7): "assets", "death", "legal", "life", "net", "planning", "tax". | EXACT TITLE in legal: "Estate planning".
0.340
Felony ↗ Q178844 EXACT TITLE
additionalcivilcourtenglishfrenchlandtrial
SHARED TOKENS (7): "additional", "civil", "court", "english", "french", "land", "trial". | EXACT TITLE in legal: "Felony".
0.340
americanidaholegislaturememberofficesecretaryserved
SHARED TOKENS (7): "american", "idaho", "legislature", "member", "office", "secretary", "served". | EXACT TITLE in history: "Pete Cenarrusa".
0.340
Pro bono ↗ Q127537 EXACT TITLE
communityenglishgoodlegalprofessionalpublicwork
SHARED TOKENS (7): "community", "english", "good", "legal", "professional", "public", "work". | EXACT TITLE in legal: "Pro bono".
0.340
americancivildevelopmentminingnorthernwestworks
SHARED TOKENS (7): "american", "civil", "development", "mining", "northern", "west", "works". | EXACT TITLE in history: "Arthur De Wint Foote".
0.340
constructionfrenchitselflaborpersonalsecuritytitle
SHARED TOKENS (7): "construction", "french", "itself", "labor", "personal", "security", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.340
americangovernoridaholawyerservingterritorywashington
SHARED TOKENS (7): "american", "governor", "idaho", "lawyer", "serving", "territory", "washington". | EXACT TITLE in history: "William H. Wallace".
0.340
groundirrigationlegalphysicalrightriverwater
SHARED TOKENS (7): "ground", "irrigation", "legal", "physical", "right", "river", "water". | EXACT TITLE in history: "Water right". | EXACT TITLE in legal: "Water right".
0.330
boiseformeridaholevellistednationalopenedpacificunion
SHARED TOKENS (9): "boise", "former", "idaho", "level", "listed", "national", "opened", "pacific", "union". | URL->A (1): https://www.ktvb.com/article/news/local/208/1925-boise-depot-train-city-of-trees/277-c69c10d4-8186-43c0-9659-73118e304569.
0.330
boisedepartmentgovernmentheadquartersidahomainnationalsecurityserve
SHARED TOKENS (9): "boise", "department", "government", "headquarters", "idaho", "main", "national", "security", "serve". | URL->A (1): https://www.imd.idaho.gov/idaho-national-guard/our-history/.
0.320
Adoption ↗ Q180472 EXACT TITLE
governedlegalrecognitionrequiresrightsyoung
SHARED TOKENS (6): "governed", "legal", "recognition", "requires", "rights", "young". | EXACT TITLE in legal: "Adoption".
0.320
deathincomelegalprofessionalrecognizedstandard
SHARED TOKENS (6): "death", "income", "legal", "professional", "recognized", "standard". | EXACT TITLE in legal: "Medical malpractice".
0.320
countrieslegalmigrationminimumnationalorganization
SHARED TOKENS (6): "countries", "legal", "migration", "minimum", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.300
amendmentattorneybillcasescommunitycourtcriminaldistrictgovernmentlevelmonthspublicrequiresrightrightssupremetrial
SHARED TOKENS (17): "amendment", "attorney", "bill", "cases", "community", "court", "criminal", "district", "government", "level", "months", "public", "requires", "right", "rights", "supreme", "trial".
0.300
advocatesamericanamongcasescourtdisputesgeneralindividualslegallitigationpublicrequiredrightshortsystemthird
SHARED TOKENS (16): "advocates", "american", "among", "cases", "court", "disputes", "general", "individuals", "legal", "litigation", "public", "required", "right", "short", "system", "third".
0.300
americanamongassociationauthorityconstructioncreateddepartmentestablishedfarmersfederalfundirrigationlandmeridiannationalnearlyorganizationprogramprojectprojects
SHARED TOKENS (29): "american", "among", "association", "authority", "construction", "created", "department", "established", "farmers", "federal", "fund", "irrigation", "land", "meridian", "national", "nearly", "organization", "program", "project", "projects"....
0.300
boisecharleshouseidahonational
SHARED TOKENS (5): "boise", "charles", "house", "idaho", "national". | EXACT TITLE in history: "Cyrus Jacobs House".
0.300
amongcriminallegallevelpresence
SHARED TOKENS (5): "among", "criminal", "legal", "level", "presence". | EXACT TITLE in legal: "Manslaughter".
0.300
administrativeagenciesbranchcivilcountriescreatededucationenvironmentenvironmentalexpandedgovernmentimmigrationitselflegallegislativeopenedpublicstrongsystemtrade
SHARED TOKENS (20): "administrative", "agencies", "branch", "civil", "countries", "created", "education", "environment", "environmental", "expanded", "government", "immigration", "itself", "legal", "legislative", "opened", "public", "strong", "system", "trade".
0.300
authoritycorporationcreateddistrictdistrictsgovernmentirrigationlargelegislaturelocalorganizedpowerprojectspublictaxwater
SHARED TOKENS (16): "authority", "corporation", "created", "district", "districts", "government", "irrigation", "large", "legislature", "local", "organized", "power", "projects", "public", "tax", "water".
0.300
annualbusinessdevelopmentemployeesfinancefinancialfinancingfundgrowthhistoryindustriesinstitutionalinvestorsmarketmarketsoperatingoperationsownedpublicscale
SHARED TOKENS (25): "annual", "business", "development", "employees", "finance", "financial", "financing", "fund", "growth", "history", "industries", "institutional", "investors", "market", "markets", "operating", "operations", "owned", "public", "scale"....
0.300
countriesemployeesgrouporganizationreachrepresentingrightssafetysecuritysingletradetrainingunionworkworkers
SHARED TOKENS (15): "countries", "employees", "group", "organization", "reach", "representing", "rights", "safety", "security", "single", "trade", "training", "union", "work", "workers".
0.300
agriculturalcourtdomesticemployeesestablishedfederalformationgovernmentindependentlabormembersnationalorganizationpowerrelationsrightsignedsupremetradeworkers
SHARED TOKENS (20): "agricultural", "court", "domestic", "employees", "established", "federal", "formation", "government", "independent", "labor", "members", "national", "organization", "power", "relations", "right", "signed", "supreme", "trade", "workers".
0.300
administrativeassociationcivilfreedomgroupindividualsjusticekeylegallifemainnaturalorganizationspersonalphysicalpressrelationsrightrightssafety
SHARED TOKENS (23): "administrative", "association", "civil", "freedom", "group", "individuals", "justice", "key", "legal", "life", "main", "natural", "organizations", "personal", "physical", "press", "relations", "right", "rights", "safety"....
0.300
americanassociationauthoritycitiescommunitydevelopmentdistrictsenvironmentalfoundedlandnaturalnorthernphysicalplanningprojectregionalresourcessecondwater
SHARED TOKENS (19): "american", "association", "authority", "cities", "community", "development", "districts", "environmental", "founded", "land", "natural", "northern", "physical", "planning", "project", "regional", "resources", "second", "water".
0.300
casescourtcriminaldisputesgoodinsurancejusticelegalliabilitymainpaidpublicrecognitionspecialsystem
SHARED TOKENS (15): "cases", "court", "criminal", "disputes", "good", "insurance", "justice", "legal", "liability", "main", "paid", "public", "recognition", "special", "system".
0.300
assetsbusinesscombinedcorporatecountriesdepartmentfederalgovernedgovernmentjusticelegalmarketoperatingoperationsorganizationrequiressinglestrategictrade
SHARED TOKENS (19): "assets", "business", "combined", "corporate", "countries", "department", "federal", "governed", "government", "justice", "legal", "market", "operating", "operations", "organization", "requires", "single", "strategic", "trade".
0.300
Complaint ↗ Q836925 KW CROSS HIGH
authoritybroughtcasescivilcourtcriminaldefensefactsfederaljusticelegallitigationnamepowersupport
SHARED TOKENS (15): "authority", "brought", "cases", "civil", "court", "criminal", "defense", "facts", "federal", "justice", "legal", "litigation", "name", "power", "support".
0.300
Civil liberties ↗ Q29556 KW CROSS HIGH
advocateadvocatesauthoritycivilcountriesfreedomgovernmentjohnlibertylifepersonalpowerpressrightrightssecuritytrialwork
SHARED TOKENS (18): "advocate", "advocates", "authority", "civil", "countries", "freedom", "government", "john", "liberty", "life", "personal", "power", "press", "right", "rights", "security", "trial", "work".
0.300
Basques ↗ Q126756 EXACT TITLE
amongbaygrouppopulationswestern
SHARED TOKENS (5): "among", "bay", "group", "populations", "western". | EXACT TITLE in history: "Basques".
0.300
contextcourtemployeesfallsfederalgeneralgovernmentlaborlocalmembermemberspublicrequiredrightsecuritysupremeunionwork
SHARED TOKENS (18): "context", "court", "employees", "falls", "federal", "general", "government", "labor", "local", "member", "members", "public", "required", "right", "security", "supreme", "union", "work".
0.300
americancasescivilcommunitycourtcreatedfallfreedomgovernmentgroupkeylibertyminimumoldestpracticepublicrequiresrightrightssupreme
SHARED TOKENS (22): "american", "cases", "civil", "community", "court", "created", "fall", "freedom", "government", "group", "key", "liberty", "minimum", "oldest", "practice", "public", "requires", "right", "rights", "supreme"....
0.300
amongannualclaimscountriesfallfirmgovernmentgroundsgrouphistorylegaloutsideprogramsecondthirdtotalworld
SHARED TOKENS (17): "among", "annual", "claims", "countries", "fall", "firm", "government", "grounds", "group", "history", "legal", "outside", "program", "second", "third", "total", "world".
0.300
agenciesamendmentassociationbillcasescivilcourtexpandedfinancefreedomgovernmentjeffersonpressrightrightsschoolsupremethird
SHARED TOKENS (18): "agencies", "amendment", "association", "bill", "cases", "civil", "court", "expanded", "finance", "freedom", "government", "jefferson", "press", "right", "rights", "school", "supreme", "third".
0.300
adabillbusinesscivileffectiveemployeesfinalhouseindividualsjanuarynationalpublicrequiresrightssigned
SHARED TOKENS (15): "ada", "bill", "business", "civil", "effective", "employees", "final", "house", "individuals", "january", "national", "public", "requires", "rights", "signed".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalalongsideamericanassociationbarcasescivilcorporatecriminaldepartmenteducationfederalindividualslegallicensedlitigationmattersnationalofficepractice
SHARED TOKENS (26): "additional", "alongside", "american", "association", "bar", "cases", "civil", "corporate", "criminal", "department", "education", "federal", "individuals", "legal", "licensed", "litigation", "matters", "national", "office", "practice"....
0.300
amendmentbillcourtcriminalestablishedfederalfourthgovernmenthistoryindividualsissuesjamesjeffersonlegallocalmainphysicalplainrightssecretary
SHARED TOKENS (22): "amendment", "bill", "court", "criminal", "established", "federal", "fourth", "government", "history", "individuals", "issues", "james", "jefferson", "legal", "local", "main", "physical", "plain", "rights", "secretary"....
0.300
attorneybusinesscasescommunitydisputesemployeeseventsformerindividualslegalmaterialpaidprogramrequiredsignedsingletrade
SHARED TOKENS (17): "attorney", "business", "cases", "community", "disputes", "employees", "events", "former", "individuals", "legal", "material", "paid", "program", "required", "signed", "single", "trade".
0.300
Homestead Acts ↗ Q974556 KW CROSS HIGH
farmersfederalgovernmentlaborlandlargenearlyopenedpublicreceivedriversoutherntotalwestwhite
SHARED TOKENS (15): "farmers", "federal", "government", "labor", "land", "large", "nearly", "opened", "public", "received", "river", "southern", "total", "west", "white".
0.300
administrativeamericancasescourtcoveringcreateddistrictdistrictseasternfederalidahojameslargestnorthernpacificsansecretaryservesoutherntotal
SHARED TOKENS (22): "administrative", "american", "cases", "court", "covering", "created", "district", "districts", "eastern", "federal", "idaho", "james", "largest", "northern", "pacific", "san", "secretary", "serve", "southern", "total"....
0.300
advocateamongassociationsbusinesscasesemployeesfirmformerindividualsindustrylaborleavelegalmarketmarketssupportsystemtradeworkers
SHARED TOKENS (19): "advocate", "among", "associations", "business", "cases", "employees", "firm", "former", "individuals", "industry", "labor", "leave", "legal", "market", "markets", "support", "system", "trade", "workers".
0.300
Oregon Country ↗ Q388164 KW CROSS HIGH
americanbaybeyondcatastrophiccoastalcountriescriticaldecadesdepartmentdistrictestablishedfrenchgovernmentidahoindependentlandlargelowernamenational
SHARED TOKENS (34): "american", "bay", "beyond", "catastrophic", "coastal", "countries", "critical", "decades", "department", "district", "established", "french", "government", "idaho", "independent", "land", "large", "lower", "name", "national"....
0.300
amendmentamericancivilcourteducationequallyfederalgovernmentindividualsitselfjusticelargelocalprimaryrequiresrightrightssupreme
SHARED TOKENS (18): "amendment", "american", "civil", "court", "education", "equally", "federal", "government", "individuals", "itself", "justice", "large", "local", "primary", "requires", "right", "rights", "supreme".
0.300
associationbusinesscorporatecorporationgovernedincomelegalliabilitymemberoperatingoperationsorganizationorganizedphysicalprimaryprofessionalrequiredrightssingletax
SHARED TOKENS (20): "association", "business", "corporate", "corporation", "governed", "income", "legal", "liability", "member", "operating", "operations", "organization", "organized", "physical", "primary", "professional", "required", "rights", "single", "tax".
0.300
bankruptcycaseschaptercourtcreateddistrictdistrictseffectivefederalfiledgovernmentitselfmatterssystemwest
SHARED TOKENS (15): "bankruptcy", "cases", "chapter", "court", "created", "district", "districts", "effective", "federal", "filed", "government", "itself", "matters", "system", "west".
0.300
americanassociationassociationscasescommercialcommunitycontextcountriescreateddavisdecadesdevelopmentgovernedgrowthlandlargelegallevellifelocal
SHARED TOKENS (31): "american", "association", "associations", "cases", "commercial", "community", "context", "countries", "created", "davis", "decades", "development", "governed", "growth", "land", "large", "legal", "level", "life", "local"....
0.300
additionalbilldepartmentdomesticelectedemployeesfamilylaborleavemembermonthspublicsignedweeksworkworkers
SHARED TOKENS (16): "additional", "bill", "department", "domestic", "elected", "employees", "family", "labor", "leave", "member", "months", "public", "signed", "weeks", "work", "workers".
0.300
administrativeagenciesannualcasescitiescourtdistrictestablishedfederalfiledfinalformerlargelegalnationalnationwideorganizedpopulationsecurityserve
SHARED TOKENS (26): "administrative", "agencies", "annual", "cases", "cities", "court", "district", "established", "federal", "filed", "final", "former", "large", "legal", "national", "nationwide", "organized", "population", "security", "serve"....
0.300
advocatesassociationassociationsbarbusinesscasescountriescourtenglishgenerallegalmembersorganizationsorganizedphysicalpracticeprofessionalpublicserving
SHARED TOKENS (19): "advocates", "association", "associations", "bar", "business", "cases", "countries", "court", "english", "general", "legal", "members", "organizations", "organized", "physical", "practice", "professional", "public", "serving".
0.300
businesscasescommercialcountriesdefensefinancialgeneralindependentinstitutionalinsurancelandlargelegallifenearlyoutsidesecuritysystemtitle
SHARED TOKENS (19): "business", "cases", "commercial", "countries", "defense", "financial", "general", "independent", "institutional", "insurance", "land", "large", "legal", "life", "nearly", "outside", "security", "system", "title".
0.300
Grand jury ↗ Q1323789 KW CROSS HIGH
broughtcasescivilcourtcriminalfrenchindependentlargelegalmattersmembersphysicalpublicrequiredservespecialtrial
SHARED TOKENS (17): "brought", "cases", "civil", "court", "criminal", "french", "independent", "large", "legal", "matters", "members", "physical", "public", "required", "serve", "special", "trial".
0.300
americancivilexpansionformergovernmentissuesjohnlargelifenationalprominentservedspanishweekswestwhitewonworld
SHARED TOKENS (18): "american", "civil", "expansion", "former", "government", "issues", "john", "large", "life", "national", "prominent", "served", "spanish", "weeks", "west", "white", "won", "world".
0.300
James Stewart ↗ Q102462 KW CROSS HIGH
americanamongcommercialcriticalfreedomgeneralhomejameslibertylifeofficerreceivedrosethirduniversitywashingtonworld
SHARED TOKENS (17): "american", "among", "commercial", "critical", "freedom", "general", "home", "james", "liberty", "life", "officer", "received", "rose", "third", "university", "washington", "world".
0.300
americancharlesclaimsclarkgroupjeffersonmembersmonthspacificpresencerelationsreportriversecondsouthwestterritorytradewestwestern
SHARED TOKENS (19): "american", "charles", "claims", "clark", "group", "jefferson", "members", "months", "pacific", "presence", "relations", "report", "river", "second", "southwest", "territory", "trade", "west", "western".
0.300
agriculturealeneaugustboisecanyonclarkcoeurcollegecommunitycreatedeventsfallsfoundedgovernmentgrowingheadquartershomeidahoindustriesjanuary
SHARED TOKENS (38): "agriculture", "alene", "august", "boise", "canyon", "clark", "coeur", "college", "community", "created", "events", "falls", "founded", "government", "growing", "headquarters", "home", "idaho", "industries", "january"....
0.300
Annexation ↗ Q194465 EXACT TITLE
legalphysicalrecognizedterritorytitle
SHARED TOKENS (5): "legal", "physical", "recognized", "territory", "title". | EXACT TITLE in legal: "Annexation".
0.300
agenciesauthoritycreatedenvironmentenvironmentalestablishedfederalfinalgovernmentjanuarynationalqualityreportsrequiressignedworld
SHARED TOKENS (16): "agencies", "authority", "created", "environment", "environmental", "established", "federal", "final", "government", "january", "national", "quality", "reports", "requires", "signed", "world".
0.300
casescontextcourtlegallitigation
SHARED TOKENS (5): "cases", "context", "court", "legal", "litigation". | EXACT TITLE in history: "Settlement (litigation)".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
chiefdatafinancialfullgovernmentlargestlevelnamenationwideofficeofficerpersonalprogramrecordsreportresourcessecuritytechnologyuniversity
SHARED TOKENS (19): "chief", "data", "financial", "full", "government", "largest", "level", "name", "nationwide", "office", "officer", "personal", "program", "records", "report", "resources", "security", "technology", "university".
0.300
boisecanaldistrictidahoirrigationlistedlowernamenampanationalprogramprojectrivertreasurevalleywaterwestern
SHARED TOKENS (17): "boise", "canal", "district", "idaho", "irrigation", "listed", "lower", "name", "nampa", "national", "program", "project", "river", "treasure", "valley", "water", "western".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
administrativeamericanassociationattorneybankruptcybarbusinesscasescorporationcourtcreateddepartmentseducationenvironmentestablishedexperiencefamilyfullgovernmentlabor
SHARED TOKENS (41): "administrative", "american", "association", "attorney", "bankruptcy", "bar", "business", "cases", "corporation", "court", "created", "departments", "education", "environment", "established", "experience", "family", "full", "government", "labor"....
0.300
communitycountriesfoodfreedomjohnlegallibertymaterialmembernationalorganizationspowerpublicrecognizedrightrightssecurityspecialtrade
SHARED TOKENS (19): "community", "countries", "food", "freedom", "john", "legal", "liberty", "material", "member", "national", "organizations", "power", "public", "recognized", "right", "rights", "security", "special", "trade".
0.300
amendmentbillcourtcriminalfederalgovernmentlevellibertylifelocalmainoncepublicrequiresrightrightsservesupreme
SHARED TOKENS (18): "amendment", "bill", "court", "criminal", "federal", "government", "level", "liberty", "life", "local", "main", "once", "public", "requires", "right", "rights", "serve", "supreme".
🫐 BERRY101 edges
0.280
Homicide ↗ Q149086 EXACT TITLE
deathlegalrequiressystem
SHARED TOKENS (4): "death", "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.280
agenciesauthoritycourtdevelopmentfederalgrowthlistednationalpreservationprimaryrequiressignedsupremetrade
SHARED TOKENS (14): "agencies", "authority", "court", "development", "federal", "growth", "listed", "national", "preservation", "primary", "requires", "signed", "supreme", "trade".
0.280
Family law ↗ Q384014 EXACT TITLE
domesticfamilymattersrelations
SHARED TOKENS (4): "domestic", "family", "matters", "relations". | EXACT TITLE in legal: "Family law".
0.280
americanenglishlegislativemember
SHARED TOKENS (4): "american", "english", "legislative", "member". | EXACT TITLE in history: "George Grimes".
0.280
Simplot ↗ Q3484788 EXACT TITLE
agricultureamericanboiseidaho
SHARED TOKENS (4): "agriculture", "american", "boise", "idaho". | EXACT TITLE in history: "Simplot".
0.270
branchelectedgovernmentidahoofficesecretary
SHARED TOKENS (6): "branch", "elected", "government", "idaho", "office", "secretary". | URL->B (1): https://sos.idaho.gov/.
0.260
Attorney ↗ Q1289214 EXACT TITLE
attorneylawyerpower
SHARED TOKENS (3): "attorney", "lawyer", "power". | EXACT TITLE in history: "Attorney". | EXACT TITLE in legal: "Attorney".
0.260
Labour law ↗ Q628967 KW CROSS HIGH
agenciescasesemployeesformergovernmentlaborlegislatureminimumrightstradeunionworkworkers
SHARED TOKENS (13): "agencies", "cases", "employees", "former", "government", "labor", "legislature", "minimum", "rights", "trade", "union", "work", "workers".
0.260
Theft ↗ Q2727213 EXACT TITLE
englishnamenorthern
SHARED TOKENS (3): "english", "name", "northern". | EXACT TITLE in history: "Theft".
0.260
civilcountriescourt
SHARED TOKENS (3): "civil", "countries", "court". | EXACT TITLE in history: "Discovery (law)".
0.260
countriesdeathdepartmentsenvironmentfinancialgovernmentindividualsnationalorganizationspressstreetsustainedunion
SHARED TOKENS (13): "countries", "death", "departments", "environment", "financial", "government", "individuals", "national", "organizations", "press", "street", "sustained", "union".
0.260
Plea bargain ↗ Q664736 KW CROSS HIGH
authoritycasescivilcriminaldefensefinaljusticelegallocalpracticepublicresourcestrial
SHARED TOKENS (13): "authority", "cases", "civil", "criminal", "defense", "final", "justice", "legal", "local", "practice", "public", "resources", "trial".
0.260
governmentlocalsecretary
SHARED TOKENS (3): "government", "local", "secretary". | EXACT TITLE in history: "Secretary of the Interior".
0.260
claimscountriesfinancialgovernmentinstitutionsissuesorganizationorganizationspublicreportresourcesthirdwork
SHARED TOKENS (13): "claims", "countries", "financial", "government", "institutions", "issues", "organization", "organizations", "public", "report", "resources", "third", "work".
0.260
Private equity ↗ Q476115 KW CROSS HIGH
businessdevelopmentexpansionfinancefinancialfinancingfirmfundgeneralmanagingpressproductspublic
SHARED TOKENS (13): "business", "development", "expansion", "finance", "financial", "financing", "firm", "fund", "general", "managing", "press", "products", "public".
0.260
Beneficiary ↗ Q2596417 KW CROSS HIGH
assetscontextcreateddeathdevelopmentfinancegetsinsurancelegallifeprimaryprojectsyoung
SHARED TOKENS (13): "assets", "context", "created", "death", "development", "finance", "gets", "insurance", "legal", "life", "primary", "projects", "young".
0.240
amendmentcourtcriminalfactsfourthimmigrationlegalpowerrequiredrightstandardsupreme
SHARED TOKENS (12): "amendment", "court", "criminal", "facts", "fourth", "immigration", "legal", "power", "required", "right", "standard", "supreme".
0.240
agenciesauthoritycriminalfederalfinancialindustrylevelliabilitylitigationorganizationsprimarysecurity
SHARED TOKENS (12): "agencies", "authority", "criminal", "federal", "financial", "industry", "level", "liability", "litigation", "organizations", "primary", "security".
0.240
U visa ↗ Q17086349 KW CROSS HIGH
agenciescasescreatedcriminaldomesticfamilygovernmentimmediatemembersphysicalserveviolence
SHARED TOKENS (12): "agencies", "cases", "created", "criminal", "domestic", "family", "government", "immediate", "members", "physical", "serve", "violence".
0.240
countriesemployeesenvironmentgeneralkeylegalorganizationspersonalphysicalprofessionalrelationshipswork
SHARED TOKENS (12): "countries", "employees", "environment", "general", "key", "legal", "organizations", "personal", "physical", "professional", "relationships", "work".
0.240
Trademark ↗ Q167270 KW CROSS HIGH
agenciescountrieslegalmemberminimumofficeprimaryproductsrightssourcestradeunion
SHARED TOKENS (12): "agencies", "countries", "legal", "member", "minimum", "office", "primary", "products", "rights", "sources", "trade", "union".
0.240
civilcriminalenglishirrigationlandlegalliabilitypowerprominentstandardsystemwater
SHARED TOKENS (12): "civil", "criminal", "english", "irrigation", "land", "legal", "liability", "power", "prominent", "standard", "system", "water".
0.240
americanbayboisecivilconstructionheadquartersidaholargepipelineprojectssanworld
SHARED TOKENS (12): "american", "bay", "boise", "civil", "construction", "headquarters", "idaho", "large", "pipeline", "projects", "san", "world".
0.220
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycourtcriticalfamilylegallifememberpersonalprofessionalpublicserve
SHARED TOKENS (11): "authority", "court", "critical", "family", "legal", "life", "member", "personal", "professional", "public", "serve".
0.220
casescivilcourtcriminaldisputesdistrictdistrictsfederalresidentssupremetrial
SHARED TOKENS (11): "cases", "civil", "court", "criminal", "disputes", "district", "districts", "federal", "residents", "supreme", "trial".
0.220
WinCo Foods ↗ Q8023592 KW CROSS HIGH
americanboisecomemployeesfoodfoundedidaholargestownedutahwashington
SHARED TOKENS (11): "american", "boise", "com", "employees", "food", "founded", "idaho", "largest", "owned", "utah", "washington".
0.220
civilcountriescriminaldefensefiledfulllegallegislativerequiresrunstrial
SHARED TOKENS (11): "civil", "countries", "criminal", "defense", "filed", "full", "legal", "legislative", "requires", "runs", "trial".
0.220
Probation ↗ Q13961 KW CROSS HIGH
communitycontactcourtcriminaldomesticformerleaveofficerprogramrequiredviolence
SHARED TOKENS (11): "community", "contact", "court", "criminal", "domestic", "former", "leave", "officer", "program", "required", "violence".
0.220
Road transport ↗ KW CROSS HIGH
countriesdevelopmentfoodfullindustrieslargelocalsafetyshortspecialstandard
SHARED TOKENS (11): "countries", "development", "food", "full", "industries", "large", "local", "safety", "short", "special", "standard".
0.220
authoritybankruptcycasescourtdistrictfederalfiledgovernedrightstaxtitle
SHARED TOKENS (11): "authority", "bankruptcy", "cases", "court", "district", "federal", "filed", "governed", "rights", "tax", "title".
0.210
industry
SHARED TOKENS (1): "industry". | EXACT TITLE in history: "Nathaniel Wyeth".
0.210
professional
SHARED TOKENS (1): "professional". | EXACT TITLE in history: "Harry Morrison".
0.210
group
SHARED TOKENS (1): "group". | EXACT TITLE in history: "Irreconcilables".
0.210
Paternity ↗ Q16881001 EXACT TITLE
house
SHARED TOKENS (1): "house". | EXACT TITLE in legal: "Paternity".
0.200
Family court ↗ Q82749 KW CROSS HIGH
casescourtcreateddomesticfamilylegalmattersrelationshipssupportsystem
SHARED TOKENS (10): "cases", "court", "created", "domestic", "family", "legal", "matters", "relationships", "support", "system".
0.200
boisedecadesformerfullhouseidaholevelsingleterritorywestern
SHARED TOKENS (10): "boise", "decades", "former", "full", "house", "idaho", "level", "single", "territory", "western".
0.200
americandavisgeneralheadquartersjeffersonnationaloperationsservedunionwest
SHARED TOKENS (10): "american", "davis", "general", "headquarters", "jefferson", "national", "operations", "served", "union", "west".
0.200
Magistrate ↗ Q4594605 KW CROSS HIGH
casescivilcourtcriminalgovernmentlocallowermattersofficerworld
SHARED TOKENS (10): "cases", "civil", "court", "criminal", "government", "local", "lower", "matters", "officer", "world".
0.200
completelyenvironmentalfederalnameownedphysicalprimaryqualitywaterworks
SHARED TOKENS (10): "completely", "environmental", "federal", "name", "owned", "physical", "primary", "quality", "water", "works".
0.200
termtopics
EXACT TITLE in legal: "Subdivision".
0.200
Debtor ↗ Q157470 KW CROSS HIGH
bankruptcyfamilyfirmfullgovernmentlegaloralpaidpersonalrequires
SHARED TOKENS (10): "bankruptcy", "family", "firm", "full", "government", "legal", "oral", "paid", "personal", "requires".
0.200
attorneycourteffectivefulllawyerlegaloldestprofessionalrightsupreme
SHARED TOKENS (10): "attorney", "court", "effective", "full", "lawyer", "legal", "oldest", "professional", "right", "supreme".
0.200
bankruptcychapterclaimscourtfinancialgeneralincomepersonalpowertitle
SHARED TOKENS (10): "bankruptcy", "chapter", "claims", "court", "financial", "general", "income", "personal", "power", "title".
0.200
Will ↗ Q1498271 EXACT TITLE
termtopics
EXACT TITLE in history: "Will". | EXACT TITLE in legal: "Will".
0.200
augustestablishedheadquartersidahomountainnationalnorthernrecreationwaterwhite
SHARED TOKENS (10): "august", "established", "headquarters", "idaho", "mountain", "national", "northern", "recreation", "water", "white".
0.200
agenciesauthorityeffectivefoodgovernmentindependentmarketsofficeproductssafety
SHARED TOKENS (10): "agencies", "authority", "effective", "food", "government", "independent", "markets", "office", "products", "safety".
0.200
Camas ↗ Q419373 EXACT TITLE
camastermtopics
EXACT TITLE in history: "Camas".
0.200
Probate court ↗ Q7246899 KW CROSS HIGH
assetsauthoritycasescourtcreateddistrictissueslegislativematterspersonal
SHARED TOKENS (10): "assets", "authority", "cases", "court", "created", "district", "issues", "legislative", "matters", "personal".
0.180
amongcorporationeasternenglishlandorganizedrightssystemwater
SHARED TOKENS (9): "among", "corporation", "eastern", "english", "land", "organized", "rights", "system", "water".
0.180
amendmentcourtcriminallawyerrequiredrightrightssupremetrial
SHARED TOKENS (9): "amendment", "court", "criminal", "lawyer", "required", "right", "rights", "supreme", "trial".
0.180
additionalcatastrophiccountriesdevelopmentlargeleadinglifenaturalwork
SHARED TOKENS (9): "additional", "catastrophic", "countries", "development", "large", "leading", "life", "natural", "work".
0.180
countriesdecadesgovernmentlargepersonalpracticeproductssystemtax
SHARED TOKENS (9): "countries", "decades", "government", "large", "personal", "practice", "products", "system", "tax".
0.180
administrativecivilclaimsestablishedfederalgovernmentnationalpracticerights
SHARED TOKENS (9): "administrative", "civil", "claims", "established", "federal", "government", "national", "practice", "rights".
0.180
casescourtfactsfullissuesmaterialstandardsupporttrial
SHARED TOKENS (9): "cases", "court", "facts", "full", "issues", "material", "standard", "support", "trial".
0.160
Sacagawea ↗ Q238960 KW CROSS HIGH
americanassociationclarkhistorynationalnaturalpacificterritory
SHARED TOKENS (8): "american", "association", "clark", "history", "national", "natural", "pacific", "territory".
0.160
Expungement ↗ Q2352928 KW CROSS HIGH
completelycriminalfederalgeneralgovernorlegalpublicrecords
SHARED TOKENS (8): "completely", "criminal", "federal", "general", "governor", "legal", "public", "records".
0.160
additionalcasescountriescourtcriminalhistorynationalrecords
SHARED TOKENS (8): "additional", "cases", "countries", "court", "criminal", "history", "national", "records".
0.160
Tort ↗ Q158970 KW CROSS HIGH
civilcountriescriminalenglishestablishedindividualslegalliability
SHARED TOKENS (8): "civil", "countries", "criminal", "english", "established", "individuals", "legal", "liability".
0.160
americanhistorynationaloldestoperationspacificstrategicworld
SHARED TOKENS (8): "american", "history", "national", "oldest", "operations", "pacific", "strategic", "world".
0.160
Drug court ↗ Q5308883 KW CROSS HIGH
barcombinedcourtcriminaldefenseleadingpublicwork
SHARED TOKENS (8): "bar", "combined", "court", "criminal", "defense", "leading", "public", "work".
0.160
broughtcivilcountriesgeneralhistoryindividualsmigrationsecond
SHARED TOKENS (8): "brought", "civil", "countries", "general", "history", "individuals", "migration", "second".
0.160
agriculturalamericanfulllegalrightrightssystemwater
SHARED TOKENS (8): "agricultural", "american", "full", "legal", "right", "rights", "system", "water".
0.160
Foreclosure ↗ Q231710 KW CROSS HIGH
associationattorneycourthouselegalrightsecuritytitle
SHARED TOKENS (8): "association", "attorney", "court", "house", "legal", "right", "security", "title".
0.160
americanimmigrationindividualsjunerightsecondsupportwork
SHARED TOKENS (8): "american", "immigration", "individuals", "june", "right", "second", "support", "work".
0.160
Easement ↗ Q448405 KW CROSS HIGH
amongitselflandownedpublicrightrightsthird
SHARED TOKENS (8): "among", "itself", "land", "owned", "public", "right", "rights", "third".
0.160
attorneycombinedcountriesitselflegalpersonalpowersingle
SHARED TOKENS (8): "attorney", "combined", "countries", "itself", "legal", "personal", "power", "single".
0.140
Parole ↗ Q5357120 KW CROSS HIGH
additionalfrenchkeyoutsideservedservingsystem
SHARED TOKENS (7): "additional", "french", "key", "outside", "served", "serving", "system".
0.140
Trade secret ↗ Q602938 KW CROSS HIGH
amongassetsbusinesscommerciallegallicensedtrade
SHARED TOKENS (7): "among", "assets", "business", "commercial", "legal", "licensed", "trade".
0.140
Bail ↗ Q162351 KW CROSS HIGH
additionalcasescountriescourtcriminalrequiredtrial
SHARED TOKENS (7): "additional", "cases", "countries", "court", "criminal", "required", "trial".
0.140
Discrimination ↗ Q169207 KW CROSS HIGH
countriesgroupinstitutionslegalmembersrightsworld
SHARED TOKENS (7): "countries", "group", "institutions", "legal", "members", "rights", "world".
0.140
casescivilcountriescourtlegalpublicright
SHARED TOKENS (7): "cases", "civil", "countries", "court", "legal", "public", "right".
0.140
Ann Morrison Park ↗ KW CROSS HIGH
boisecourtdepartmenteventsidahorecreationriver
SHARED TOKENS (7): "boise", "court", "department", "events", "idaho", "recreation", "river".
0.140
Trial court ↗ Q3125101 KW CROSS HIGH
authoritycasescourtestablishedmatterspowertrial
SHARED TOKENS (7): "authority", "cases", "court", "established", "matters", "power", "trial".
0.140
administrativecourtfederalimmigrationlegalofficeremoval
SHARED TOKENS (7): "administrative", "court", "federal", "immigration", "legal", "office", "removal".
0.140
amongdistrictinvestorslegaloversightownedpublic
SHARED TOKENS (7): "among", "district", "investors", "legal", "oversight", "owned", "public".
0.140
Injunction ↗ Q6495575 KW CROSS HIGH
civilcourtcriminalenglishfulllegalspecial
SHARED TOKENS (7): "civil", "court", "criminal", "english", "full", "legal", "special".
0.140
civilcommercialgovernedlegalrequiredrightssales
SHARED TOKENS (7): "civil", "commercial", "governed", "legal", "required", "rights", "sales".
0.120
americanformergovernoridahoprominentwestern
SHARED TOKENS (6): "american", "former", "governor", "idaho", "prominent", "western".
0.120
Escrow ↗ Q338451 KW CROSS HIGH
establishedfrenchinsurancenameprimarythird
SHARED TOKENS (6): "established", "french", "insurance", "name", "primary", "third".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahonearlypopulation
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "nearly", "population".
0.120
Partnership ↗ Q728646 KW CROSS HIGH
businessgovernedindividualsorganizationorganizationsreach
SHARED TOKENS (6): "business", "governed", "individuals", "organization", "organizations", "reach".
0.120
Alimony ↗ Q368305 KW CROSS HIGH
familyfinanciallegalnorthernrequiredsupport
SHARED TOKENS (6): "family", "financial", "legal", "northern", "required", "support".
0.120
Legal ethics ↗ Q3655952 KW CROSS HIGH
developmentitselflegalmemberspracticeprofessional
SHARED TOKENS (6): "development", "itself", "legal", "members", "practice", "professional".
0.120
Damages ↗ Q308922 KW CROSS HIGH
generallegalpaidphysicalrecognizedspecial
SHARED TOKENS (6): "general", "legal", "paid", "physical", "recognized", "special".
0.120
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualemployeesindependentleavework
SHARED TOKENS (6): "among", "annual", "employees", "independent", "leave", "work".
0.120
Oregon Treaty ↗ Q823433 KW CROSS HIGH
americanbroughtclaimsjunesignedwashington
SHARED TOKENS (6): "american", "brought", "claims", "june", "signed", "washington".
0.120
Deposition ↗ Q1174534 KW CROSS HIGH
authoritycourtoutsidepowerremovaluniversity
SHARED TOKENS (6): "authority", "court", "outside", "power", "removal", "university".
0.120
businesslegalnameownedtradework
SHARED TOKENS (6): "business", "legal", "name", "owned", "trade", "work".
0.120
Fraud ↗ Q28813 KW CROSS HIGH
casescivilcriminalitselflegalright
SHARED TOKENS (6): "cases", "civil", "criminal", "itself", "legal", "right".
0.120
attorneybusinessfinanciallegalpowersigned
SHARED TOKENS (6): "attorney", "business", "financial", "legal", "power", "signed".
0.100
associationbarlawyerpracticerequired
SHARED TOKENS (5): "association", "bar", "lawyer", "practice", "required".
0.100
baybusinessgovernmentwestwestern
SHARED TOKENS (5): "bay", "business", "government", "west", "western".
0.100
Criminal law ↗ Q146491 KW CROSS HIGH
civilcriminalestablishedlegislaturesafety
SHARED TOKENS (5): "civil", "criminal", "established", "legislature", "safety".
0.100
broughtcasescivildeathlegal
SHARED TOKENS (5): "brought", "cases", "civil", "death", "legal".
0.100
contactcourtenglishmattersrights
SHARED TOKENS (5): "contact", "court", "english", "matters", "rights".
0.100
corporatefinancialgovernmentindividualslabor
SHARED TOKENS (5): "corporate", "financial", "government", "individuals", "labor".
0.100
Due diligence ↗ Q794134 KW CROSS HIGH
assetsbusinesslegalqualitystandard
SHARED TOKENS (5): "assets", "business", "legal", "quality", "standard".
0.100
completelycriminaldefenseleadingtotal
SHARED TOKENS (5): "completely", "criminal", "defense", "leading", "total".
0.100
idahopocatellopopulationriversnake
SHARED TOKENS (5): "idaho", "pocatello", "population", "river", "snake".
0.100
branchcivilcriminalenglishlegal
SHARED TOKENS (5): "branch", "civil", "criminal", "english", "legal".
0.100
Legal clinic ↗ Q1351667 KW CROSS HIGH
experiencelegalprogramschoolwork
SHARED TOKENS (5): "experience", "legal", "program", "school", "work".
◈ Frequently Asked Questions
History × Legal — Treasure Valley
HAIKU · HIGH GATE
How did the Frank Steunenberg assassination case shape Idaho's legal system?
Frank Steunenberg's 1905 murder in Caldwell led to one of the most significant criminal trials in Treasure Valley history, with James Hawley prosecuting the case and Clarence Darrow defending the accused. The trial established precedents for labor-related violence prosecutions in Ada County and across Idaho, fundamentally changing how the state's courts handled disputes between mining interests and workers.
What role did Boise serve as the territorial capital in establishing Idaho's legal framework?
Boise, Idaho's largest city in Ada County, functioned as the seat of territorial government where early Idaho legal codes were drafted and enforced beginning in the 1860s. The city's location along the Snake River made it the administrative center where judges, territorial legislators, and legal authorities established the court systems and property laws that governed settlement and development throughout the Treasure Valley.
How did water rights disputes along the Snake River create legal precedents in the Treasure Valley?
Agricultural settlement in Canyon County, Ada County, and surrounding areas of the Treasure Valley generated conflicts over Snake River water allocation that courts in Boise and Caldwell resolved through landmark rulings on irrigation rights. These decisions established Idaho's water law doctrine and determined how municipalities like Nampa, Garden City, and Eagle could legally claim and use river water for development.
What legal authority did Boise State University gain in relation to Treasure Valley public lands?
Boise State University, established as a public institution in Ada County, acquired legal rights to manage and conduct research on territories adjacent to the Snake River and throughout the Treasure Valley region. The university's charter granted it authority to hold property in Boise, Meridian, and Eagle, enabling it to operate as a legal entity controlling significant parcels in the region's development history.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
History × Legal 15 QID bridges 286 edges 7,865 ext links 2026-07-17 21:14:53 UTC 27aa3a6b31e6eee2
History corridor ↗ Legal corridor ↗ Legal × History ↗ boisestandard.org/standard ↗
Parent Corridors
History × All Other Verticals