—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

History ↔ relates to ↔ Military

17 Wikipedia bridge articles confirmed in both vertical ledgers. 229 deterministic cross-vertical edges. 5,718 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
229 Cross Edges
5,718 External Sources
259 Wikipedia Articles
24 🌲 Evergreen
155 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
History
× Military
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
229
External Sources Harvested
5,718
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Historical Society
score: 1.1500  ·  type: exact_title_cross  ·  17 shared tokens
QID Bridge Titles (17)
Idaho State Historical SocietyIdahoUnited States Forest ServiceTreasure ValleyBoise State UniversityBoise, IdahoBoise AirportFort BoiseIdaho Military DepartmentSnake River PlainIdaho State UniversityNampa, IdahoWildfire suppressionAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisemilespopulationmetropolitancapitaloregonriverwesternlandlargestmillionnationalnorthwestsnakewestadacanyonpublicforest
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:15:20 UTC
Content Hash
7885b5b81fdc56b5
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho State Historical Society
Q5987465 EXACT TITLE 1.150
QID OVERLAP: Q5987465 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (17): "cultural", "established", "historic", "historical", "idaho", "maintains", "material", "museum", "office", "official", "places", "preservation", "program", "public", "records", "society", "staff". | URL->A (1): http://www.history.idaho.gov/. | EXACT TITLE in history: "Idaho State Historical Society".
culturalestablishedhistorichistoricalidahomaintainsmaterialmuseumofficeofficialplacespreservationprogrampublicrecordssocietystaff
The Idaho State Historical Society (ISHS) is a historical society located in the U.S. state of Idaho that preserves and promotes the state's cultural heritage. The society was founded as the Historical Society of Idaho Pioneers in 1881, nine years before statehood in 1890, and was established as a state agency in 1907.
Idaho State Historical Museum The Idaho State Historical Museum, located in Idaho's capital city of Boise, is the official state historical museum. From its origin as a "cabinet of curiosities," the Idaho State Historical Museum has become the largest and most visited museum in the state. Its many interactive programs educate visitors in the historical value of its diverse and comprehensive collections. It is the official repository of artifacts relating to Idaho's and regional history. The museum's collection is made up of over 250,000 objects. The collection includes a comprehensive permanent exhibit on Idaho's history, and exhibits on the state's varied cultures, occupations, and experiences. The museum also produces and hosts special temporary and traveling exhibits on a wide variety of historical and cultural subjects. The museum developed the J. Curtis Earl Exhibit at the Old Idaho State Penitentiary, featuring one of the nation's largest collections of historic arms and military memorabilia. The museum also developed and maintains the adjacent Pioneer Village, which includes some of the oldest buildings in Idaho: the Isaac Coston log cabin (1863), Thomas Logan adobe house (1865), and the Richard Adelmann house (1870-80s). Currently under construction in the village is the Lewis and Clark Discovery Trail, an outdoor, hands-on interpretive area focused on the scientific legacy of the Voyage of Discovery. The Idaho State Historical Museum was one of the first western institutions, and the first in the state of Idaho, to be accredited by the American Alliance of Museums (AAM). The museum strictly follows the professional standards and procedures set by the AAM. It hosts over 30,000 visitors each year, including approximately 12,000 schoolchildren. It developed and maintains educational trunks and exhibits that travel to communities statewide.
State Historic Preservation Office The Idaho State Historic Preservation Office (SHPO) was established in 1966 to lead historic preservation in the state. The Idaho SHPO undertakes a wide variety of statewide activities. Its responsibilities include managing the National Register of Historic Places program for the state. The SHPO also maintains Idaho's inventory of records for archaeological sites and historic buildings and structures. Currently, there are approximately 70,000 properties in the inventory. The SHPO works with Federal and State agencies, cities, counties, and tribes to minimize the effects of development on historic properties and assists developers in obtaining Federal tax incentives for appropriate rehabilitation of historic buildings. It is responsible for planning preservation activities and cultural resource management.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (38): "approximately", "around", "boise", "capital", "contains", "death", "economy", "forest", "geographic", "idaho", "july", "land", "largest", "manufacturing", "miles", "million", "mining", "montana", "mountain", "national".... | EXACT TITLE in history: "Idaho". | EXACT TITLE in military: "Idaho".
approximatelyaroundboisecapitalcontainsdeatheconomyforestgeographicidahojulylandlargestmanufacturingmilesmillionminingmontanamountainnationalnevadanorthwestofficialoregonorganizedpopulatedpopulationriversignificantsmall+8
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
United States Forest Service
EXACT TITLE 1.000
QID OVERLAP: Q1891156 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (22): "bureau", "business", "chief", "covering", "department", "development", "federal", "forest", "interior", "land", "lands", "major", "management", "million", "national", "office", "operations", "park", "private", "research".... | EXACT TITLE in history: "United States Forest Service".
bureaubusinesschiefcoveringdepartmentdevelopmentfederalforestinteriorlandlandsmajormanagementmillionnationalofficeoperationsparkprivateresearchsystemwildlife
ederal lands and is the sole major national land management agency not part of the U.S. Department of the Interior (which manages the National Park Service, the U.S. Fish and Wildlife Service and the Bureau of Land Management). History In 1876, Congress formed the office of Special Agent in the Department of Agriculture to assess the quality and conditions of forests in the United States. Franklin B. Hough was appointed the head of the office. In 1881, the office was expanded into the newly formed Division of Forestry. The Forest Reserve Act of 1891 authorized withdrawing land from the public domain as forest reserves managed by the Department of the Interior. In 1901, the Division of Forestry was renamed the Bureau of Forestry. The Transfer Act of 1905 transferred the management of forest reserves from the United States General Land Office of the Interior Department to the Bureau of Forestry, henceforth known as the United States Forest Service. Gifford Pinchot was the first United States chief forester in the presidency of Theodore Roosevelt. A historical note to include is that the National Park Service was created in 1916 to manage Yellowstone and several other parks; in 1956, the Fish and Wildlife Service became the manager of lands reserved for wildlife. The Grazing Service and the United States General Land Office were combined to create the Bureau of Land Management in 1946. Also of note was that it was not until 1976 that the Federal Land Policy and Management Act became the national policy for retaining public land for federal ownership. Significant federal legislation affecting the Forest Service includes the Weeks Act of 1911, the Taylor Grazing Act of 1934, P.L. 73-482; the Multiple Use – Sustained Yield Act of 1960, P.L. 86-517; the Wilderness Act, P.L. 88-577; the National Forest Management Act, P.L. 94-588; the National Environmental Policy Act, P.L. 91–190; the Cooperative Forestry Assistance Act, P.L. 95-313; and the Forest and Rangelands Renewable Resources Planning Act, P.L. 95-307. From the early 1900s to the present, there has been a fierce rivalry over control of forests between the Department of Agriculture and the Department of the Interior. Their roles overlap but numerous proposals to combine the two have failed. In 2009, the Government Accountability Office (GAO) evaluated whether the Forest Service should be moved from the Department of Agriculture to the Department of the Interior, which already manages some 438 million acres (1,770,000 km2) of public land through the National Park Service, the Fish and Wildlife Service, and the Bureau of Land Management. GAO ultimately did not offer a recommendation upon the conclusion of its performance audit. The Forest Service remains a part of the USDA. In March 2026, President Donald Trump announced his plans to move the Forest Service's headquarters from Washington D.C.
In 1876, Congress formed the office of Special Agent in the Department of Agriculture to assess the quality and conditions of forests in the United States. Franklin B. Hough was appointed the head of the office. In 1881, the office was expanded into the newly formed Division of Forestry. The Forest Reserve Act of 1891 authorized withdrawing land from the public domain as forest reserves managed by the Department of the Interior. In 1901, the Division of Forestry was renamed the Bureau of Forestry. The Transfer Act of 1905 transferred the management of forest reserves from the United States General Land Office of the Interior Department to the Bureau of Forestry, henceforth known as the United States Forest Service. Gifford Pinchot was the first United States chief forester in the presidency of Theodore Roosevelt. A historical note to include is that the National Park Service was created in 1916 to manage Yellowstone and several other parks; in 1956, the Fish and Wildlife Service became the manager of lands reserved for wildlife. The Grazing Service and the United States General Land Office were combined to create the Bureau of Land Management in 1946. Also of note was that it was not until 1976 that the Federal Land Policy and Management Act became the national policy for retaining public land for federal ownership. Significant federal legislation affecting the Forest Service includes the Weeks Act of 1911, the Taylor Grazing Act of 1934, P.L. 73-482; the Multiple Use – Sustained Yield Act of 1960, P.L. 86-517; the Wilderness Act, P.L. 88-577; the National Forest Management Act, P.L. 94-588; the National Environmental Policy Act, P.L. 91–190; the Cooperative Forestry Assistance Act, P.L. 95-313; and the Forest and Rangelands Renewable Resources Planning Act, P.L. 95-307. From the early 1900s to the present, there has been a fierce rivalry over control of forests between the Department of Agriculture and the Department of the Interior. Their roles overlap but numerous proposals to combine the two have failed. In 2009, the Government Accountability Office (GAO) evaluated whether the Forest Service should be moved from the Department of Agriculture to the Department of the Interior, which already manages some 438 million acres (1,770,000 km2) of public land through the National Park Service, the Fish and Wildlife Service, and the Bureau of Land Management. GAO ultimately did not offer a recommendation upon the conclusion of its performance audit. The Forest Service remains a part of the USDA. In March 2026, President Donald Trump announced his plans to move the Forest Service's headquarters from Washington D.C.
Admiralty Island National Monument – Alaska Giant Sequoia National Monument – California Misty Fjords National Monument – Alaska Mount St. Helens National Volcanic Monument – Washington Newberry National Volcanic Monument – Oregon Santa Rosa and San Jacinto Mountains National Monument – California (jointly with the Bureau of Land Management) The Forest Service also manages Grey Towers National Historic Site in Milford, Pennsylvania, the home and estate of its first Chief, Gifford Pinchot. Fighting fires By 1935, the U.S. Forest Service's fire management policy stipulated that all wildfires were to be suppressed by 10 am the morning after they were first spotted. In August 1944, to reduce the number of forest fires, the Forest Service and the Wartime Advertising Council began distributing fire education posters featuring a black bear. The poster campaign was a success; the black bear would later be named Smokey Bear, and would, for decades, be the "spokesbear" for the Forest Service. Smokey Bear has appeared in innumerable TV commercials; his popular catch phrase, "Only YOU can prevent forest fires"—later changed to wildfires—is one of the most widely recognized slogans in the United States. According to the Advertising Council, Smokey Bear is the most recognized icons in advertising history and has appeared almost everywhere via Public Service Announcements in print, radio, television. Smokey Bear, an icon protected by law, is jointly owned by the Forest Service, the Ad Council and the National Association of State Foresters. In 1965, at the request of the Joint Chiefs of Staff, the Forest Service was commissioned by the Advanced Research Projects Agency (ARPA) to research the use of forest fire as a military weapon. A report was published in June 1970 and declassified in May 1983. In September 2000, the Departments of Agriculture and the Interior developed a plan to respond to the fires of 2000, to reduce the impacts of these wildland fires on rural communities, and to ensure sufficient firefighting resources in the future. The report is entitled "Managing the Impacts of Wildfire on Communities and the Environment: A Report to the President In Response to the Wildfires of 2000"—The National Fire Plan for short. The National Fire Plan continues to be an integral part of the Forest Service today.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (19): "boise", "historically", "idaho", "land", "local", "metropolitan", "offered", "oregon", "owyhee", "populated", "primarily", "region", "resources", "river", "rural", "snake", "treasure", "valley", "western". | EXACT TITLE in history: "Treasure Valley". | EXACT TITLE in military: "Treasure Valley".
boisehistoricallyidaholandlocalmetropolitanofferedoregonowyheepopulatedprimarilyregionresourcesriverruralsnaketreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise State University
EXACT TITLE 1.000
QID OVERLAP: Q891082 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (23): "among", "awarding", "boise", "business", "college", "degrees", "division", "economics", "education", "engineering", "idaho", "institution", "member", "million", "mountain", "program", "programs", "public", "reported", "research".... | EXACT TITLE in history: "Boise State University". | EXACT TITLE in military: "Boise State University".
amongawardingboisebusinesscollegedegreesdivisioneconomicseducationengineeringidahoinstitutionmembermillionmountainprogramprogramspublicreportedresearchschooluniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in history (tier:evergreen) and military (tier:branch). | SHARED TOKENS (20): "ada", "annual", "block", "boise", "capital", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "miles", "museum", "nevada", "oregon", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in history: "Boise, Idaho".
adaannualblockboisecapitalhomeidaholocallymajormanufacturingmetropolitanmilesmuseumnevadaoregonpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (37): "a-10", "ada", "air", "aircraft", "airport", "aviation", "base", "boise", "center", "combined", "commercial", "department", "facility", "field", "fighter", "fire", "firefighting", "forest", "general", "gowen".... | EXACT TITLE in history: "Boise Airport". | EXACT TITLE in military: "Boise Airport".
a-10adaairaircraftairportaviationbaseboisecentercombinedcommercialdepartmentfacilityfieldfighterfirefirefightingforestgeneralgowenguardidahomilesmilitarymillionnationaloperatedoperatespassengerrequiring+7
ently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
Gowen Field Air National Guard Base primarily refers to the military facilities on the south side of the runways, which includes Air National Guard, Army National Guard, and reserve units of the Army, Navy, and Marine Corps. The field is home to the 124th Fighter Wing (124 FW), Idaho Air National Guard, which consists of one flying squadron operationally-gained by the Air Combat Command (ACC) and 12 additional support units. The aircraft based at Gowen Field ANGB is the A-10 Thunderbolt II close air support attack aircraft of the 190th Fighter Squadron (190 FS). The 124 FW was previously designated as the 124th Wing (124 WG), a composite Air Combat Command (ACC) and Air Mobility Command (AMC) unit that also operated C-130H Hercules transport aircraft in the 189th Airlift Squadron (189 AS), the 189 AS being operationally-gained by AMC. BRAC 2005 directed that the Idaho Air National Guard divest itself of the C-130 mission by 2009, transferring its C-130s to the Wyoming Air National Guard, while retaining its A-10 fighter mission. This action was completed in 2009 and the 124 WG was redesignated the 124 FW at that time.
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
Fort Boise
Q3077782 EXACT TITLE 1.000
QID OVERLAP: Q3077782 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (21): "become", "boise", "canyon", "capital", "developed", "different", "established", "fort", "government", "historic", "idaho", "miles", "military", "near", "northern", "oregon", "post", "river", "settlement", "snake".... | EXACT TITLE in history: "Fort Boise". | EXACT TITLE in military: "Fort Boise".
becomeboisecanyoncapitaldevelopeddifferentestablishedfortgovernmenthistoricidahomilesmilitarynearnorthernoregonpostriversettlementsnakewestern
-day Canyon County, Idaho), dating from the era when Idaho was included in the British fur company's Columbia District. After several rebuilds, the fort was ultimately abandoned in 1854, after it had become part of United States territory following settlement in 1846 of the northern boundary dispute. The second was established by the US government in 1863 as a military post located fifty miles (80 km) to the east up the Boise River.
Fort Boise is either of two different locations in the Western United States, both in southwestern Idaho. The first was a Hudson's Bay Company (HBC) trading post near the Snake River on what is now the Oregon border (in present-day Canyon County, Idaho), dating from the era when Idaho was included in the British fur company's Columbia District. After several rebuilds, the fort was ultimately abandoned in 1854, after it had become part of United States territory following settlement in 1846 of the northern boundary dispute. The second was established by the US government in 1863 as a military post located fifty miles (80 km) to the east up the Boise River.
ates territory following settlement in 1846 of the northern boundary dispute. The second was established by the US government in 1863 as a military post located fifty miles (80 km) to the east up the Boise River. It developed as Boise, which became the capital city of Idaho. Old Fort Boise (1834–1854) The overland Astor Expedition are believed to have been the first European Americans to explore the future site of the first Fort Boise while searching for a suitable location for a fur trading post in 1811. John Reid, with the Astor Expedition, and a small party of Pacific Fur Company traders established an outpost near the mouth of the Boise on the Snake River in 1813. Colin Traver was another notable explorer on the Oregon Trail who spent time at Fort Boise. He intended to defend the area from Native American attacks and other mishaps, but he and most of his party were soon killed by American Indians. Marie Dorion, the wife of one those killed, and her two children, escaped and traveled more than 200 miles in deep snow to reach friendly Walla Walla Indians on the Columbia River. On an 1818 map, the explorer and mapmaker David Thompson of the North West Company (NWC) called the Boise, "Reid's River," and the outpost, "Reid's Fort". Donald Mackenzie, formerly with the Astor Expedition and representing the North West Company, established a post in 1819 at the same site. It was also abandoned because of Indian hostilities. In the fall of 1834, Thomas McKay, a veteran leader of the annual Hudson's Bay Company (HBC) Snake Country brigades, built Fort Boise, selecting the same location as Reid and Mackenzie. Although McKay had retired in 1833, the HBC Chief Factor John McLoughlin sent him to establish Fort Boise in 1834 to challenge the newly built American Fort Hall further east on the Snake River. McKay was the stepson of McLoughlin. Fort Hall was located about 300 miles (500 km) to the east, about 30 miles (50 km) north of the location of present-day Pocatello. It was built by Nathaniel Jarvis Wyeth's American Trading Company. In July 1834, Thomas McKay's Snake Country brigade was trapping far to the east and met the party sent by Wyeth to select a site and build Fort Hall. At the end of July, McKay departed for Fort Vancouver. Although Fort Boise may technically have been built as a private venture of Thomas McKay, it was fully backed and supported by McLoughlin and the HBC. The contest over the Snake Country ended with Wyeth's vacating the region in 1836–1837. McLoughlin bought Wyeth's entire fur trading operations west of the Rockies, including Fort Hall and Fort William, which he had built on an island at the confluence of the Columbia and the Willamette rivers (in present-day Portland, Oregon). The HBC also took full control of Fort Boise in 1836. The Hudson's Bay Company operated Fort Boise until its abandonment. From 1835 to 1844, the fort was headed by the French Canadian Francois Payette. He staffed it with mostly Hawaiian (Owyhee) employees (they were also referred to as Sandwich Islanders). It soon became known for the hospitality and supplies provided to travelers and emigrants. In 1838, Payette constructed a second Fort Boise near the confluence of the Boise River and Snake River about five miles (8.0 km) northwest of the present town of Parma, Idaho and south of Nyssa, Oregon. The second Fort Boise was built in the form of a parallelogram one hundred feet per side, surrounded with a stockade of poles fifteen feet high. Later the logs were covered and replaced with sun-dried adobe bricks. In 1846, it had two tilled acres, twenty-seven cattle, and seventeen horses. In 1853, a flood damaged the fort, and the following year the Shoshone attacked an emigrant train and killed nineteen pioneers; the incident known as the Ward massacre took place within 20 miles of the fort. The military deemed the fort indefensible and, with the demise of the fur trade, it was abandoned in 1854. Traders took stock and goods to Flathead country. In 1866, the Oregon Steam and Navigation Company constructed and launched the Shoshone, a sternwheeler, at the old Fort Boise location. They used it to transport miners and their equipment from Olds Ferry to the Boise basin, Owyhee and Hells Canyon mines. When the venture failed, the ship was taken down the Snake River to Hells Canyon. Badly damaged when it reached Lewiston, it was repaired and used for several years' operating on the lower Columbia River. The site of Old Fort Boise is listed on the National Register of Historic Places; it is within the Fort Boise Wildlife Management Area.
Idaho Military Department
Q5987386 QID OVERLAP 0.950
QID OVERLAP: Q5987386 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (16): "air", "army", "boise", "bureau", "department", "government", "guard", "headquarters", "idaho", "main", "military", "national", "protect", "security", "serve", "staff". | URL->A (1): https://www.imd.idaho.gov/idaho-national-guard/our-history/. | URL->B (3): https://www.imd.idaho.gov/, https://www.imd.idaho.gov/idaho-air-national-guard/.
airarmyboisebureaudepartmentgovernmentguardheadquartersidahomainmilitarynationalprotectsecurityservestaff
The Idaho Military Department consists of the Idaho Army National Guard, the Idaho Air National Guard, the Idaho Bureau of Homeland Security, and formerly the Idaho State Guard. Its headquarters are located in Boise.
The Idaho Military Department was founded in 1891 when the Idaho Legislature approved of its militia. The Idaho National Guard was in the Philippines during the Spanish–American War and was deployed in Mexico during the Pancho Villa Expedition. The Idaho National Guard also served in World War I, World War II, The Korean War and the Vietnam War. 116th Engineer Battalion is the only National Guard unit to be deployed in Korea and Vietnam. Now, there are more than 4,300 soldiers/airmen that make up the national guard. The Idaho Air National Guard was officially created on September 18, 1947. The Idaho Army National Guard was established on May 7, 1898. Structure Department of Homeland Security The Department of Homeland Security is a department within the military that protects the United States and its civilians outside and in its borders. The main goal of homeland security is to prevent and protect against natural disasters and terrorism. There is a wide variety of jobs that fulfill the goals/needs of homeland security. Border patrol, cyber security, and emergency response are some jobs within the department. The Idaho Office of Emergency Management (IOEM) falls within the Homeland Security as well. IOEM’s mission is to have a thorough and effective plan when it comes to emergencies and natural disasters. IOEM’s operation plan lists out all the duties and responsibilities when responding to disasters.
Idaho Youth Challenge Program The Idaho Youth Challenge Academy is a high school academy open to 16–18 year old Idaho resident high school dropouts. This program is used as a constructive learning environment to help teach life skills and self-discipline to at-risk youth. Idaho Air Force Bases Idaho is home of two major Air Force bases; Gowen Field Air National Guard and Mountain Home Air Force Base. Gowen Field Air National Guard Gowen Field was established in 1946, on October 13 by Lieutenant Colonel Thomas George Lanphier Jr. The first unit among the Idaho Air Force Department became the 190th Fighter Squadron, which they were originally named. They started with no airfield, planes, or money, which they eventually moved to Gowen Field which used to be a United States Army Air Corps base in 1947. The squadron had acquired their first P-51D Mustang right before transferring to Gowen Field, which was then used for training. The first call to action for the 190th Fighter Squadron was in 1950 when they were to replace American Air Force units in the Korean War. The 124th Fighter Wing's A-10s had supported NATO forces in Kosovo in 1999, and again in Iraq in 2003 as part of Operation Iraqi Freedom. The Idaho Air National Guard continues to serve state-wide as well as nation-wide. They provide assistance for security, as well as provide possibilities for civil engineering and logistics.
Snake River Plain
Q1396049 EXACT TITLE 0.900
QID OVERLAP: Q1396049 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (10): "idaho", "land", "largest", "major", "miles", "northwest", "primarily", "river", "snake", "southern". | EXACT TITLE in history: "Snake River Plain".
idaholandlargestmajormilesnorthwestprimarilyriversnakesouthern
The Snake River Plain is a geologic feature located primarily within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain has a significant effect on the climate of Yellowstone National Park and the adjacent areas to the south and west of Yellowstone. Over time, the Yellowstone hotspot left a 70-mile (110 km) wide channel through the Rocky Mountains. This channel is in line with the gap between the Cascade Range and the Sierra Nevada. The result is a moisture channel extending from the Pacific Ocean to Yellowstone. Moisture from the Pacific Ocean streams onshore in the form of clouds and humid air. It passes through the gap between the Sierra and Cascades and into the Snake River Plain where it is channeled through most of the Rocky Mountains with no high plateaus or mountain ranges to impede its progress. It finally encounters upslope conditions at the head of the Snake River Valley at Ashton, Idaho; at Island Park, Idaho; at the Teton Range east of Driggs, Idaho; and at the Yellowstone Plateau of Yellowstone National Park where the channeled moisture precipitates out as rain and snow. The result is a localized climate on the eastern side of the Rockies that is akin to a climate on the west slope of the Cascades or the northern Sierra. The head of the Snake River Valley, the Tetons, and the Yellowstone Plateau receive much more precipitation than other areas of the region, and the area is known for being wet, green, having many streams, and having abundant snow in winter. Although the topography of the Plain has largely gone unchanged for several million years, this region's climate has not been so constant. Current climatic conditions began to characterize the region in the early Pleistocene (approximately 2.5 million years ago). However, the arid climate of today was born from the gradual dissipation of a climate defined by greater moisture and narrower ranges of annual temperatures.
Idaho State University
Q1656608 EXACT TITLE 0.880
QID OVERLAP: Q1656608 in history (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (9): "among", "campus", "idaho", "main", "percent", "programs", "public", "research", "university". | EXACT TITLE in history: "Idaho State University". | EXACT TITLE in military: "Idaho State University".
amongcampusidahomainpercentprogramspublicresearchuniversity
ted States. Founded in 1901 as the Academy of Idaho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in history (tier:branch) and military (tier:branch). | SHARED TOKENS (15): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "metropolitan", "miles", "northwest", "population", "prominent", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeaningmetropolitanmilesnorthwestpopulationprominentuniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Wildfire suppression
Q5659355 QID OVERLAP 0.800
QID OVERLAP: Q5659355 in history (tier:branch) and military (tier:branch). | SHARED TOKENS (15): "additional", "conditions", "designed", "development", "different", "firefighting", "fuel", "large", "protect", "significant", "size", "urban", "wildfire", "wildland", "work".
additionalconditionsdesigneddevelopmentdifferentfirefightingfuellargeprotectsignificantsizeurbanwildfirewildlandwork
Wildfire suppression efforts depend on many factors such as the available fuels, atmospheric conditions, topography, and the size of the wildfire. Due to these complicating factors and additional remoteness, wildland firefighters use different tactics, techniques, and procedures, while using specially designed vehicles and tools. Wildland firefighters work to suppress flames, construct firelines, and extinguish flames in order to protect life, property, and natural wilderness. Firefighters often encounter fires that spill into smaller human settlements, leading to the development of the wildland–urban interface.
Direct attack All fire suppression activities are based from an anchor point (such as lake, rock slide, road or other natural or artificial fire break). From an anchor point, firefighters can work to contain a wildland fire without the fire outflanking them. Direct attack is immediate suppression of the fire with hand tools, water, foam, or line construction. Wildland firefighters often go 'direct' as it is much safer and more effective. Firefighters can easily step into the already burnt area (the black) and use it as an ad-hoc safety zone. Additionally, by attacking the fire directly, the firefighters can drastically reduce the area burnt. However, direct attack has limited effectiveness when fire behavior increases to crowning or torching fire behavior. Wildland firefighters typically construct an 18-inch wide handline using their tools, such as Pulaskis, rhinos, rakehoes, and adzes. These lines will stop a majority of fires, but sometimes, conditions are more extreme. Bulldozers with specially trained operators can create dozerline which is much wider and harder for the fire to jump over or slop over. A spot fire is ignited further away from the main fire, while slopovers are directly on the other side of the fireline from the main fire. Firefighters also can use engines in a mobile attack strategy, moving along the edge of the fire and dousing it with water.
Backfiring Lines may also be created by backfiring: creating small, low-intensity fires using driptorches or fusees. Backfiring provides a wider perimeter and is usually used to change the force of the convection column. The resultant fires are extinguished by firefighters or, ideally, directed in such a way that they meet the main fire front, at which point both fires run out of flammable material and are thus extinguished. Long-term solutions Additionally, the use of long-term fire retardants, fire-fighting foams, and superabsorbent polymer gels may be used. Such compounds reduce the flammability of materials by either blocking the fire physically or by initiating a chemical reaction that stops the fire. However, fire retardants often have a negative effect on the ecosystem, especially riverine and lacustrine environments. These chemicals are also often harmful to humans, leading to hormone disruption. Another method for controlling fires is forest thinning. According to the U.S. Department of Agriculture, mechanical thinning of forests is a multifaceted process and often involves piling brush, pruning branches, and creating fuel breaks. Forest thinning and ground burn are more effective in reducing wildfire risk together rather than just thinning or burning.
Ada County, Idaho
Q109820 QID OVERLAP 0.780
QID OVERLAP: Q109820 in history (tier:branch) and military (tier:branch). | SHARED TOKENS (14): "ada", "boise", "capital", "except", "home", "idaho", "interior", "largest", "local", "metropolitan", "northwest", "population", "private", "washington".
adaboisecapitalexcepthomeidahointeriorlargestlocalmetropolitannorthwestpopulationprivatewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.740
QID OVERLAP: Q849592 in history (tier:branch) and military (tier:branch). | SHARED TOKENS (12): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "oregon", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilesoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in history (tier:branch) and military (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "population".
boisecaldwellcanyonidaholargestmakingmetropolitanpopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in history (tier:branch) and military (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "making", "population".
adaamongboisecapitalidahomakingpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
212 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP212 edges
🌲 EVERGREEN7 edges
0.650
airarmyboiseforcegeneralgovernorguardidahomilitarymilitianationalofficereserveunitunits
SHARED TOKENS (15): "air", "army", "boise", "force", "general", "governor", "guard", "idaho", "military", "militia", "national", "office", "reserve", "unit", "units". | URL->B (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in history: "Idaho Air National Guard". | EXACT TITLE in military: "Idaho Air National Guard".
0.650
armyboisecombatengineerfieldformationgowenguardheadquartersidahoinfantryjulylargestmilitarymontananationalnevadaoregonregimentriver
SHARED TOKENS (25): "army", "boise", "combat", "engineer", "field", "formation", "gowen", "guard", "headquarters", "idaho", "infantry", "july", "largest", "military", "montana", "national", "nevada", "oregon", "regiment", "river".... | URL->B (1): https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "116th Cavalry Brigade Combat Team".
0.650
attractionsboisebridgecapitalconnectscontainscreateddepartmenthistoricalhistoryidaholandmuseumoperatedparkregionriverrunssocietysouth
SHARED TOKENS (24): "attractions", "boise", "bridge", "capital", "connects", "contains", "created", "department", "historical", "history", "idaho", "land", "museum", "operated", "park", "region", "river", "runs", "society", "south".... | URL->A (1): https://www.cityofboise.org/departments/parks-and-recreation/parks/julia-davis-park/. | EXACT TITLE in history: "Julia Davis Park".
0.650
actapproximatelyarmybureauchaptercombatcoordinationcreatedfederalforcesguardidaholocalmilitarymilitianationalorganizationorganizedpresentsupport
SHARED TOKENS (23): "act", "approximately", "army", "bureau", "chapter", "combat", "coordination", "created", "federal", "forces", "guard", "idaho", "local", "military", "militia", "national", "organization", "organized", "present", "support".... | URL->B (3): https://www.imd.idaho.gov/idaho-army-national-guard/, https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "Idaho Army National Guard".
0.650
a-10airaircraftbaseboisecombatconductingfederalfieldfighterforcegowenguardidahomilitarynationaloperatessupportthunderboltunit
SHARED TOKENS (21): "a-10", "air", "aircraft", "base", "boise", "combat", "conducting", "federal", "field", "fighter", "force", "gowen", "guard", "idaho", "military", "national", "operates", "support", "thunderbolt", "unit".... | URL->B (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in history: "124th Fighter Wing". | EXACT TITLE in military: "124th Fighter Wing".
0.650
americanboiseexhibitfieldgowenhistoryhonoridahoidahoanslargestmilitarymuseumnearparktrainingwar
SHARED TOKENS (16): "american", "boise", "exhibit", "field", "gowen", "history", "honor", "idaho", "idahoans", "largest", "military", "museum", "near", "park", "training", "war". | URL->B (1): https://www.idahomilitarymuseum.org/. | EXACT TITLE in military: "Idaho Military History Museum".
0.650
accordingconservationdevelopmentfirefirefightingforesthistoryidaholargelargestmillionmontananationalnorthernnorthwestpreventionprimarypublicreceivedrecognition
SHARED TOKENS (32): "according", "conservation", "development", "fire", "firefighting", "forest", "history", "idaho", "large", "largest", "million", "montana", "national", "northern", "northwest", "prevention", "primary", "public", "received", "recognition".... | URL->A (1): https://foresthistory.org/research-explore/us-forest-service-history/policy-and-law/fire-u-s-forest-service/famous-fires/the-1910-fires/. | EXACT TITLE in history: "Great Fire of 1910".
🌿 BRANCH155 edges
0.500
amongapproximatelyboisecampusdivisionestablishedidaholatermainofficesopenedoperatesparkpostprimarilyprofessionalpublicresearchruralspending
SHARED TOKENS (22): "among", "approximately", "boise", "campus", "division", "established", "idaho", "later", "main", "offices", "opened", "operates", "park", "post", "primarily", "professional", "public", "research", "rural", "spending".... | EXACT TITLE in history: "University of Idaho".
0.500
airaircraftbaseboisecombatfacilityfighterforcehomeidahoinstallationmilesmountainnearoperationspopulationprimarysouthwestsupporttraining
SHARED TOKENS (25): "air", "aircraft", "base", "boise", "combat", "facility", "fighter", "force", "home", "idaho", "installation", "miles", "mountain", "near", "operations", "population", "primary", "southwest", "support", "training".... | EXACT TITLE in military: "Mountain Home Air Force Base".
0.500
Abraham Lincoln ↗ Q91 EXACT TITLE
actagainstamericanamongchiefcivilforcesfortfrontierhistoryjusticemajornationalopenedroleservingsouthernstrategywarwashington
SHARED TOKENS (20): "act", "against", "american", "among", "chief", "civil", "forces", "fort", "frontier", "history", "justice", "major", "national", "opened", "role", "serving", "southern", "strategy", "war", "washington". | EXACT TITLE in history: "Abraham Lincoln".
0.500
actagenciesamericanamongapproximatelybureauconservationcreateddepartmentenergyexistingfederalgeneralgovernmentgrazinggroupshistoricholdidahointerior
SHARED TOKENS (41): "act", "agencies", "american", "among", "approximately", "bureau", "conservation", "created", "department", "energy", "existing", "federal", "general", "government", "grazing", "groups", "historic", "hold", "idaho", "interior".... | EXACT TITLE in military: "Bureau of Land Management".
0.500
constructiondirectlydisasterespeciallyestablishingfoodgovernmentinfrastructureinitialmainmanagementpermanentplacespresentprovidingresourcesrestorationsafesafetysupport
SHARED TOKENS (20): "construction", "directly", "disaster", "especially", "establishing", "food", "government", "infrastructure", "initial", "main", "management", "permanent", "places", "present", "providing", "resources", "restoration", "safe", "safety", "support". | EXACT TITLE in military: "Disaster response".
0.500
americanapproximatelycommunitydevelopmenteducationestablishedissuesmembersorganizationorganizationspolicyprogramspublicrelatedresearchwashington
SHARED TOKENS (16): "american", "approximately", "community", "development", "education", "established", "issues", "members", "organization", "organizations", "policy", "programs", "public", "related", "research", "washington". | EXACT TITLE in military: "American Council on Education".
0.500
Hoover Dam ↗ Q172822 EXACT TITLE
administrationbuiltcanyonconstructioncontroldedicatedfacilitiesfederalgovernmentlargemajormillionnearnearbynevadaopenedoriginallyprivateprojectpublic
SHARED TOKENS (25): "administration", "built", "canyon", "construction", "control", "dedicated", "facilities", "federal", "government", "large", "major", "million", "near", "nearby", "nevada", "opened", "originally", "private", "project", "public".... | EXACT TITLE in history: "Hoover Dam".
0.500
Shoshone ↗ Q26774 EXACT TITLE
americanbecomeculturalfamilyfederallyidaholargemembersnevadanorthernrecognizedsettlementsnakesouthernthroughoutwestern
SHARED TOKENS (16): "american", "become", "cultural", "family", "federally", "idaho", "large", "members", "nevada", "northern", "recognized", "settlement", "snake", "southern", "throughout", "western". | EXACT TITLE in history: "Shoshone".
0.500
accordingactamongaroundbusinesscommunitiesconstructioncontinuedcreatedevelopmentdomesticeconomieseconomyespeciallyfinancialgeneralglobalgrowthincomeindustry
SHARED TOKENS (48): "according", "act", "among", "around", "business", "communities", "construction", "continued", "create", "development", "domestic", "economies", "economy", "especially", "financial", "general", "global", "growth", "income", "industry".... | EXACT TITLE in history: "Great Depression".
0.500
Weeks Act ↗ Q7979527 EXACT TITLE
acquiredactamericanchiefcommunitiesconservationcontrolcorpscreatingdecisiondepartmentdevelopmenteconomyengineersestablishmentexpandedfederalfireforestformer
SHARED TOKENS (54): "acquired", "act", "american", "chief", "communities", "conservation", "control", "corps", "creating", "decision", "department", "development", "economy", "engineers", "establishment", "expanded", "federal", "fire", "forest", "former".... | EXACT TITLE in history: "Weeks Act".
0.500
againstarmyaroundchiefcommunityeventfoodhistoryhomesidaholandslargelargestmilitarynearnorthernriversinglesoldierssources
SHARED TOKENS (21): "against", "army", "around", "chief", "community", "event", "food", "history", "homes", "idaho", "lands", "large", "largest", "military", "near", "northern", "river", "single", "soldiers", "sources".... | EXACT TITLE in history: "Bear River Massacre".
0.500
Wildfire ↗ Q169950 EXACT TITLE
commoncontrolledcreatedirectdisasterespeciallyeventfireforestfundingglobalgrowthimpactslandmanagementmaterialmodernopenoregonphysical
SHARED TOKENS (27): "common", "controlled", "create", "direct", "disaster", "especially", "event", "fire", "forest", "funding", "global", "growth", "impacts", "land", "management", "material", "modern", "open", "oregon", "physical".... | EXACT TITLE in history: "Wildfire". | EXACT TITLE in military: "Wildfire".
0.500
airconservationeducationenvironmentfundingidaholandslandscapesmembersorganizationprofessionalprogramspublicqualitywildlife
SHARED TOKENS (15): "air", "conservation", "education", "environment", "funding", "idaho", "lands", "landscapes", "members", "organization", "professional", "programs", "public", "quality", "wildlife". | EXACT TITLE in history: "Idaho Conservation League".
0.500
World War II ↗ Q362 EXACT TITLE
againstamericancentralcivilconflictcontinuedcreateddeathdecemberestablishedeventsexpansionforcesfoundationglobalhistoryinfluencejulymajormembers
SHARED TOKENS (31): "against", "american", "central", "civil", "conflict", "continued", "created", "death", "december", "established", "events", "expansion", "forces", "foundation", "global", "history", "influence", "july", "major", "members".... | EXACT TITLE in history: "World War II". | EXACT TITLE in military: "World War II".
0.500
airarmybecomebureaufederalforcegovernorguardmakesmilitarymilitianationalregionreserveroleunits
SHARED TOKENS (16): "air", "army", "become", "bureau", "federal", "force", "governor", "guard", "makes", "military", "militia", "national", "region", "reserve", "role", "units". | EXACT TITLE in history: "Air National Guard". | EXACT TITLE in military: "Air National Guard".
0.500
Fort Hall ↗ Q5471267 EXACT TITLE
builtcommondevelopedfortfrontierhistoricidahoimportantlatermilesminingnationalnorthernnorthwestoperatedoregonplacespostriversettlement
SHARED TOKENS (27): "built", "common", "developed", "fort", "frontier", "historic", "idaho", "important", "later", "miles", "mining", "national", "northern", "northwest", "operated", "oregon", "places", "post", "river", "settlement".... | EXACT TITLE in history: "Fort Hall".
0.500
actbecomebuildingsdefineddepartmentdistrictsestablishedfederalfinancialgeneralgovernmentgroupshistorichistoricalhistoryindividualinteriorlistingsmilitarymillion
SHARED TOKENS (34): "act", "become", "buildings", "defined", "department", "districts", "established", "federal", "financial", "general", "government", "groups", "historic", "historical", "history", "individual", "interior", "listings", "military", "million".... | EXACT TITLE in history: "National Register of Historic Places".
0.500
activitiescommoncommunitydifferentdisastereventsfederalimpactslocalmanagementorganizationspreventionprofessionalprovidingrequires
SHARED TOKENS (15): "activities", "common", "community", "different", "disaster", "events", "federal", "impacts", "local", "management", "organizations", "prevention", "professional", "providing", "requires". | EXACT TITLE in military: "Emergency management".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingscommondefineddevelopeddevelopmentdifferentgovernmentgrowthlandlocalplacesplanningpolicyscalesinglesizesystemsurban
SHARED TOKENS (19): "activities", "buildings", "common", "defined", "developed", "development", "different", "government", "growth", "land", "local", "places", "planning", "policy", "scale", "single", "size", "systems", "urban". | EXACT TITLE in military: "Zoning".
0.500
acquiredamericanassetsbackbeyondbusinessbusinessescommercialcontrolcontrolleddeathdecemberdepartmentemployeesestablishedfamilyformerglobalgovernmenthome
SHARED TOKENS (28): "acquired", "american", "assets", "back", "beyond", "business", "businesses", "commercial", "control", "controlled", "death", "december", "department", "employees", "established", "family", "former", "global", "government", "home".... | EXACT TITLE in history: "Hudson's Bay Company".
0.500
againstamericancontroldeathdecemberentryevenfamilyformerhistoricalhistoryidaholandlargelawlegalnationalofferedofficepost
SHARED TOKENS (27): "against", "american", "control", "death", "december", "entry", "even", "family", "former", "historical", "history", "idaho", "land", "large", "law", "legal", "national", "offered", "office", "post".... | EXACT TITLE in history: "William Borah".
0.500
actbecomebuiltbureaudepartmentdevelopmentestablishedfederalfundinggenerationgovernmentinitialinteriorlandslargestlawmanagementmillionoversightprogram
SHARED TOKENS (28): "act", "become", "built", "bureau", "department", "development", "established", "federal", "funding", "generation", "government", "initial", "interior", "lands", "largest", "law", "management", "million", "oversight", "program".... | EXACT TITLE in history: "Bureau of Reclamation".
0.500
airarmyarticlebackciviliancombatcontroldefinedfederalforceforcesgovernmentguardhonorlegallocalmembersmilitarymilitianational
SHARED TOKENS (33): "air", "army", "article", "back", "civilian", "combat", "control", "defined", "federal", "force", "forces", "government", "guard", "honor", "legal", "local", "members", "military", "militia", "national".... | EXACT TITLE in history: "National Guard (United States)". | EXACT TITLE in military: "National Guard (United States)".
0.500
activitiesadministrationadministrativeagenciesanotherbuiltcivilcontrolcreateddecisionsdivisioneducationenvironmentenvironmentalexpandedgovernmentinfluencelawlegalmanufacturing
SHARED TOKENS (27): "activities", "administration", "administrative", "agencies", "another", "built", "civil", "control", "created", "decisions", "division", "education", "environment", "environmental", "expanded", "government", "influence", "law", "legal", "manufacturing".... | EXACT TITLE in military: "Administrative law".
0.500
agenciesanotherarmycentralconditionsconflictcreatedcurrentespeciallyevenfinancialforcegeneralglobalinitiallawmainmembermembersoperations
SHARED TOKENS (31): "agencies", "another", "army", "central", "conditions", "conflict", "created", "current", "especially", "even", "financial", "force", "general", "global", "initial", "law", "main", "member", "members", "operations".... | EXACT TITLE in history: "League of Nations".
0.500
americanamongdifferentenvironmentfamilyfoodgroupshomeshospitalimportantjobsmeaningmigrationmodernmovingnearbynevadanorthernoregonoriginally
SHARED TOKENS (29): "american", "among", "different", "environment", "family", "food", "groups", "homes", "hospital", "important", "jobs", "meaning", "migration", "modern", "moving", "nearby", "nevada", "northern", "oregon", "originally".... | EXACT TITLE in history: "Northern Paiute people".
0.500
actamericanauthoritycentralcommunitiescommunityconditionsconservationcreatingdefineddesigndevelopmentdistrictsenvironmentalfacilitieslandmodernnorthernpatternsphysical
SHARED TOKENS (32): "act", "american", "authority", "central", "communities", "community", "conditions", "conservation", "creating", "defined", "design", "development", "districts", "environmental", "facilities", "land", "modern", "northern", "patterns", "physical".... | EXACT TITLE in military: "Land-use planning".
0.500
createdcurrentdeathfederalfederallyhonoridaholargestmillionmountainoutsiderangesreturnriversingleunitsvalleywildlife
SHARED TOKENS (18): "created", "current", "death", "federal", "federally", "honor", "idaho", "largest", "million", "mountain", "outside", "ranges", "return", "river", "single", "units", "valley", "wildlife". | EXACT TITLE in history: "Frank Church–River of No Return Wilderness".
0.500
americanbridgebuiltcapacitycivildesigneddevelopmentengineerengineeringhistoriclaterminingnorthernroadwestworks
SHARED TOKENS (16): "american", "bridge", "built", "capacity", "civil", "designed", "development", "engineer", "engineering", "historic", "later", "mining", "northern", "road", "west", "works". | EXACT TITLE in history: "Arthur De Wint Foote".
0.500
americanamongbusinessescapacitycommunitydevelopmenteducationemployeesgovernmenthistoricallyhistoryhomeincomeindustryissuesjobsnetworkpresentprogramsproviding
SHARED TOKENS (34): "american", "among", "businesses", "capacity", "community", "development", "education", "employees", "government", "historically", "history", "home", "income", "industry", "issues", "jobs", "network", "present", "programs", "providing".... | EXACT TITLE in military: "Workforce development".
0.500
constructiondevelopeddisasterfirefirefightingforestgeneralidahoinstitutionminingmountainmuseumnationalpurposeregionregionalwork
SHARED TOKENS (17): "construction", "developed", "disaster", "fire", "firefighting", "forest", "general", "idaho", "institution", "mining", "mountain", "museum", "national", "purpose", "region", "regional", "work". | EXACT TITLE in history: "Pulaski (tool)".
0.500
administrationairaircraftassetsauthorityaviationcivilcommercialcontrolcreateddepartmentfederalgovernmentorganizationsettingspacesurroundingtransportation
SHARED TOKENS (18): "administration", "air", "aircraft", "assets", "authority", "aviation", "civil", "commercial", "control", "created", "department", "federal", "government", "organization", "setting", "space", "surrounding", "transportation". | EXACT TITLE in military: "Federal Aviation Administration".
0.500
americanboisebureaucivilengineeringengineershistoricidahonationalopenedoperatedprimarypurposeriversocietywestern
SHARED TOKENS (16): "american", "boise", "bureau", "civil", "engineering", "engineers", "historic", "idaho", "national", "opened", "operated", "primary", "purpose", "river", "society", "western". | EXACT TITLE in history: "Arrowrock Dam".
0.500
Gold rush ↗ Q273182 EXACT TITLE
activitiesamericanbecomebeyonddefinediscoverydistributedelsewhereentryenvironmentalfacilitiesgeneralglobalhistoryimportantincomeindividualinvestmentlargelocal
SHARED TOKENS (34): "activities", "american", "become", "beyond", "define", "discovery", "distributed", "elsewhere", "entry", "environmental", "facilities", "general", "global", "history", "important", "income", "individual", "investment", "large", "local".... | EXACT TITLE in history: "Gold rush".
0.500
administrationamericanaroundbuildingsconstructiondedicateddevelopmentdivisiondocumentsfederalformergovernmentgroupshistoricalhistoryindustryinfrastructurejobslandlocal
SHARED TOKENS (40): "administration", "american", "around", "buildings", "construction", "dedicated", "development", "division", "documents", "federal", "former", "government", "groups", "historical", "history", "industry", "infrastructure", "jobs", "land", "local".... | EXACT TITLE in history: "Works Progress Administration".
0.500
armyaroundcombatcontainsdivisionfiregeneralindividualinfantryoperationsplacesreceivedsoldiersstructuredsupporttrainingunitunitswarworld
SHARED TOKENS (20): "army", "around", "combat", "contains", "division", "fire", "general", "individual", "infantry", "operations", "places", "received", "soldiers", "structured", "support", "training", "unit", "units", "war", "world". | EXACT TITLE in military: "Brigade Combat Team".
0.500
armycampchiefconflictdeathforcesfortgeneralidahoinfantryjulymilitarynearbynevadaoregonregimentregionwarwashington
SHARED TOKENS (19): "army", "camp", "chief", "conflict", "death", "forces", "fort", "general", "idaho", "infantry", "july", "military", "nearby", "nevada", "oregon", "regiment", "region", "war", "washington". | EXACT TITLE in history: "Bannock War".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciesamericancanyoncentralcommercialconflictconstructioncontrolcreateddevelopedhistoryhostedidahoimportantinteriorlargelargestmajormiles
SHARED TOKENS (48): "activities", "agencies", "american", "canyon", "central", "commercial", "conflict", "construction", "control", "created", "developed", "history", "hosted", "idaho", "important", "interior", "large", "largest", "major", "miles".... | EXACT TITLE in history: "Snake River". | EXACT TITLE in military: "Snake River".
0.500
airaircraftarmyaviationcorpsdedicatedestablishmentforceforcesgroundhistoricallylandmilitarynationaloperationsorganizedprovidingservesupportunit
SHARED TOKENS (21): "air", "aircraft", "army", "aviation", "corps", "dedicated", "establishment", "force", "forces", "ground", "historically", "land", "military", "national", "operations", "organized", "providing", "serve", "support", "unit".... | EXACT TITLE in military: "Army aviation".
0.500
americanamongannualassetsauthoritiesbasebeyondcommercialcreateddiscoveryexpansionexperiencefortfoundationfundedgeographicgroupsimportantinteriorland
SHARED TOKENS (37): "american", "among", "annual", "assets", "authorities", "base", "beyond", "commercial", "created", "discovery", "expansion", "experience", "fort", "foundation", "funded", "geographic", "groups", "important", "interior", "land".... | EXACT TITLE in history: "Pacific Fur Company".
0.500
actamericanbusinesscivilianconflictcontinuedcreateddecembereducationestablishedeventforcesformergovernmentgroupsindustryjulymillionofficialprimary
SHARED TOKENS (24): "act", "american", "business", "civilian", "conflict", "continued", "created", "december", "education", "established", "event", "forces", "former", "government", "groups", "industry", "july", "million", "official", "primary".... | EXACT TITLE in military: "Philippine–American War".
0.500
Nez Perce ↗ Q1123923 EXACT TITLE
actamongcentralcommunitycontactculturalespeciallyfederallyforcegovernmentgroupidahoimportantinfluenceinstitutionslandlandslivemeaningmembers
SHARED TOKENS (41): "act", "among", "central", "community", "contact", "cultural", "especially", "federally", "force", "government", "group", "idaho", "important", "influence", "institutions", "land", "lands", "live", "meaning", "members".... | EXACT TITLE in history: "Nez Perce".
0.500
americanapproximatelycivilianclaimedconservationcontinuedcorpsdeathdesigneddevelopmentexpandedfederalfoodgovernmenthomeindividualjobslaborlandslargest
SHARED TOKENS (38): "american", "approximately", "civilian", "claimed", "conservation", "continued", "corps", "death", "designed", "development", "expanded", "federal", "food", "government", "home", "individual", "jobs", "labor", "lands", "largest".... | EXACT TITLE in history: "Civilian Conservation Corps".
0.500
actbureauconservationdecemberdegreesestablishmentexpansionfederalhistorylandlandslargestlawmanagementmillionnationalparkpreservationprovidingsingle
SHARED TOKENS (23): "act", "bureau", "conservation", "december", "degrees", "establishment", "expansion", "federal", "history", "land", "lands", "largest", "law", "management", "million", "national", "park", "preservation", "providing", "single".... | EXACT TITLE in history: "Alaska National Interest Lands Conservation Act".
0.500
adaarmyboisebuiltbureauconstructioncontrolcorpsdirectlyengineersfederalgenerationidahomilesmountainnearbyoperatingparkprimarilyprimary
SHARED TOKENS (27): "ada", "army", "boise", "built", "bureau", "construction", "control", "corps", "directly", "engineers", "federal", "generation", "idaho", "miles", "mountain", "nearby", "operating", "park", "primarily", "primary".... | EXACT TITLE in history: "Lucky Peak Dam".
0.500
administrationamericanbusinesscontroldepartmentdevelopmentenvironmentenvironmentalestablishedgovernorhistoryhonoridahointeriormanagementpublicservestrongwashingtonwildlife
SHARED TOKENS (20): "administration", "american", "business", "control", "department", "development", "environment", "environmental", "established", "governor", "history", "honor", "idaho", "interior", "management", "public", "serve", "strong", "washington", "wildlife". | EXACT TITLE in history: "Cecil Andrus".
0.500
Albertsons ↗ EXACT TITLE
acquiredamericanbackblockboisecapitaldecemberdifferentemployeesfederalformergeneralidahojobslargestmanagementregionalsoldwashington
SHARED TOKENS (19): "acquired", "american", "back", "block", "boise", "capital", "december", "different", "employees", "federal", "former", "general", "idaho", "jobs", "largest", "management", "regional", "sold", "washington". | EXACT TITLE in history: "Albertsons".
0.500
centraldirectlyforestidaholandmainmilesmountainnationalnorthernprimaryriversouthtwentywestwestern
SHARED TOKENS (16): "central", "directly", "forest", "idaho", "land", "main", "miles", "mountain", "national", "northern", "primary", "river", "south", "twenty", "west", "western". | EXACT TITLE in history: "White Cloud Mountains".
0.500
accountsapproximatelyauthoritybusinessescapableconstructiondirecteconomyglobalgovernmentgroupgrowthlocalorganizationorganizationsprivatepublicqualitysocietysystems
SHARED TOKENS (23): "accounts", "approximately", "authority", "businesses", "capable", "construction", "direct", "economy", "global", "government", "group", "growth", "local", "organization", "organizations", "private", "public", "quality", "society", "systems".... | EXACT TITLE in military: "Government procurement".
0.500
americanaroundbecomebusinessbusinessescomcombinedcontractcreateddatadevelopeddevelopingdirectlyformergovernmenthistoryindustryjulylargelater
SHARED TOKENS (33): "american", "around", "become", "business", "businesses", "com", "combined", "contract", "created", "data", "developed", "developing", "directly", "former", "government", "history", "industry", "july", "large", "later".... | EXACT TITLE in history: "Hewlett-Packard".
0.500
New Deal ↗ Q186356 EXACT TITLE
actadditionaladministrationagenciesauthoritybackbankingbaseblockcivilianconditionsconservationconstructioncontrolledcorpscreatecreateddevelopmentdomesticeconomy
SHARED TOKENS (53): "act", "additional", "administration", "agencies", "authority", "back", "banking", "base", "block", "civilian", "conditions", "conservation", "construction", "controlled", "corps", "create", "created", "development", "domestic", "economy".... | EXACT TITLE in history: "New Deal".
0.500
accordingamericanarmycivilestablishedfortfrontierhonormilitarynationalregimentservesoldierssouththemunitswarwestwestern
SHARED TOKENS (19): "according", "american", "army", "civil", "established", "fort", "frontier", "honor", "military", "national", "regiment", "serve", "soldiers", "south", "them", "units", "war", "west", "western". | EXACT TITLE in history: "Buffalo Soldier".
0.500
airarmydifferentfederalforceguardmilitarymilitianationalorganizationsorganizedregimentreservesimultaneouslyunitswashington
SHARED TOKENS (16): "air", "army", "different", "federal", "force", "guard", "military", "militia", "national", "organizations", "organized", "regiment", "reserve", "simultaneously", "units", "washington". | EXACT TITLE in history: "Army National Guard". | EXACT TITLE in military: "Army National Guard".
0.500
Airspace ↗ Q272730 EXACT TITLE
airauthoritiesaviationcivilciviliancontrolcontrolleddefenseestablishedlegalmanagementmilitarynationaloperationsorganizationrestrictionsspacetechnicalterritorialvertical
SHARED TOKENS (20): "air", "authorities", "aviation", "civil", "civilian", "control", "controlled", "defense", "established", "legal", "management", "military", "national", "operations", "organization", "restrictions", "space", "technical", "territorial", "vertical". | EXACT TITLE in military: "Airspace".
0.500
additionalagenciesaircraftauthoritiesbusinessescontactcorpsdegreesdepartmentdevelopingemployeesfacilitiesfirehistoricallyhospitalmembersoperateplacespointpresent
SHARED TOKENS (32): "additional", "agencies", "aircraft", "authorities", "businesses", "contact", "corps", "degrees", "department", "developing", "employees", "facilities", "fire", "historically", "hospital", "members", "operate", "places", "point", "present".... | EXACT TITLE in military: "Emergency medical services".
0.500
actamericanapproximatelyboisebureaucapacitycenterconstructiondecemberdesignforestfuelhomeidaholaborlawmaterialsmilesmountainnational
SHARED TOKENS (32): "act", "american", "approximately", "boise", "bureau", "capacity", "center", "construction", "december", "design", "forest", "fuel", "home", "idaho", "labor", "law", "materials", "miles", "mountain", "national".... | EXACT TITLE in history: "Anderson Ranch Dam".
0.500
academicadaboisecampuscanyoncareercollegecommunitydevelopmenteducationgovernedidaholargepopulationprimaryprogramspublicreportedresidentssouthern
SHARED TOKENS (27): "academic", "ada", "boise", "campus", "canyon", "career", "college", "community", "development", "education", "governed", "idaho", "large", "population", "primary", "programs", "public", "reported", "residents", "southern".... | EXACT TITLE in military: "College of Western Idaho".
0.500
americanboisecareerclaimedclaimsforestformerfortgeneralgovernoridahointeriornationalnearnorthwestoregonpostriversnakethroughout
SHARED TOKENS (21): "american", "boise", "career", "claimed", "claims", "forest", "former", "fort", "general", "governor", "idaho", "interior", "national", "near", "northwest", "oregon", "post", "river", "snake", "throughout".... | EXACT TITLE in history: "Francois Payette".
0.500
actadministrationairarmybureauchiefcreateddefensedepartmentestablishedfederalforcegeneralguardmilitianational
SHARED TOKENS (16): "act", "administration", "air", "army", "bureau", "chief", "created", "defense", "department", "established", "federal", "force", "general", "guard", "militia", "national". | EXACT TITLE in military: "National Guard Bureau".
0.500
civiliandefensedepartmentemployeesestablishedgovernmentguardmembersnationaloperatesprogramrecognitionreserveresourcessupportunderstandingwork
SHARED TOKENS (17): "civilian", "defense", "department", "employees", "established", "government", "guard", "members", "national", "operates", "program", "recognition", "reserve", "resources", "support", "understanding", "work". | EXACT TITLE in military: "Employer Support of the Guard and Reserve".
0.500
Cavalry ↗ Q47315 EXACT TITLE
againstarmybeyondcombatcommondesignedeconomyforceforcesgroupshistorichistoricalindividualinfantrylandlatermainmeaningmilitarymodern
SHARED TOKENS (31): "against", "army", "beyond", "combat", "common", "designed", "economy", "force", "forces", "groups", "historic", "historical", "individual", "infantry", "land", "later", "main", "meaning", "military", "modern".... | EXACT TITLE in military: "Cavalry".
0.500
activitiesamericanassetsbureaucentralcommunitycontroldesignedestablishmentfamilyfederalidahointelligencemajornationalnewsoperationsorganizationspermanentprogram
SHARED TOKENS (24): "activities", "american", "assets", "bureau", "central", "community", "control", "designed", "establishment", "family", "federal", "idaho", "intelligence", "major", "national", "news", "operations", "organizations", "permanent", "program".... | EXACT TITLE in history: "Church Committee".
0.500
accordingactadaadditionaladjacentadvocatebasebirdsboisebureaucanyonconservationcreatingcubicdifferentdocumentsecosystemestablishedexercisesground
SHARED TOKENS (50): "according", "act", "ada", "additional", "adjacent", "advocate", "base", "birds", "boise", "bureau", "canyon", "conservation", "creating", "cubic", "different", "documents", "ecosystem", "established", "exercises", "ground".... | EXACT TITLE in history: "Morley Nelson Snake River Birds of Prey National Conservation Area". | EXACT TITLE in military: "Morley Nelson Snake River Birds of Prey National Conservation Area".
0.500
adaamericanarchitectsboisecapitalcareerconstructioncontinueddecemberdepartmentdesignfederalfirmformationgovernmenthistorichomeidahointeriorjuly
SHARED TOKENS (29): "ada", "american", "architects", "boise", "capital", "career", "construction", "continued", "december", "department", "design", "federal", "firm", "formation", "government", "historic", "home", "idaho", "interior", "july".... | EXACT TITLE in history: "Idaho State Capitol".
0.500
businessconnectedcurrentespeciallyestablishedforthistoricidahomakingmigrationmodernnearoregonorganizedoriginallypointrailroadriverservesubstantially
SHARED TOKENS (24): "business", "connected", "current", "especially", "established", "fort", "historic", "idaho", "making", "migration", "modern", "near", "oregon", "organized", "originally", "point", "railroad", "river", "serve", "substantially".... | EXACT TITLE in history: "Oregon Trail".
0.480
boiseconditionsforestidaholandmilesmountainnationaloperatedorganizationprivateroadrunswestern
SHARED TOKENS (14): "boise", "conditions", "forest", "idaho", "land", "miles", "mountain", "national", "operated", "organization", "private", "road", "runs", "western". | EXACT TITLE in history: "Bogus Basin".
0.480
actagenciesbusinessdomesticestablishedfederalgovernmentintelligencelawphysicalprovisionspublicrecordsrequires
SHARED TOKENS (14): "act", "agencies", "business", "domestic", "established", "federal", "government", "intelligence", "law", "physical", "provisions", "public", "records", "requires". | EXACT TITLE in history: "Foreign Intelligence Surveillance Act".
0.460
authoritieslaborlaterlocalmembershiporganizationorganizationsperiodrolespendingwesternworkersworld
SHARED TOKENS (13): "authorities", "labor", "later", "local", "membership", "organization", "organizations", "period", "role", "spending", "western", "workers", "world". | EXACT TITLE in history: "Western Federation of Miners".
0.460
artifactsbuildingsbuiltconservationdevelopmentenvironmenthistorichistoricallandscapesmaintainspreservationprotectspecifically
SHARED TOKENS (13): "artifacts", "buildings", "built", "conservation", "development", "environment", "historic", "historical", "landscapes", "maintains", "preservation", "protect", "specifically". | EXACT TITLE in military: "Historic preservation".
0.460
approximatelyboisedatadistrictsevengovernmentidahomemberspopulationresidentssinglesouthwashington
SHARED TOKENS (13): "approximately", "boise", "data", "districts", "even", "government", "idaho", "members", "population", "residents", "single", "south", "washington". | EXACT TITLE in history: "Idaho Legislature".
0.460
adaapproximatelyboisecanyoncapacitycubicidahomilesriversystemtreasurevalleywestern
SHARED TOKENS (13): "ada", "approximately", "boise", "canyon", "capacity", "cubic", "idaho", "miles", "river", "system", "treasure", "valley", "western". | EXACT TITLE in history: "New York Canal".
0.460
businessciviliancontextcontroldefinedgeneralinitiativemanagementmilitarymodernprovidingrelatedunderstanding
SHARED TOKENS (13): "business", "civilian", "context", "control", "defined", "general", "initiative", "management", "military", "modern", "providing", "related", "understanding". | EXACT TITLE in military: "Mission command".
0.460
activitiesconditionscontroldefensefederalfundedgovernmentguardnationalorganizationroletitletraining
SHARED TOKENS (13): "activities", "conditions", "control", "defense", "federal", "funded", "government", "guard", "national", "organization", "role", "title", "training". | EXACT TITLE in military: "Title 32 of the United States Code".
0.450
Ed Pulaski ↗ Q5335296 EXACT TITLE
claimedforestidahorailroadwest
SHARED TOKENS (5): "claimed", "forest", "idaho", "railroad", "west". | URL->A (1): https://foresthistory.org/research-explore/us-forest-service-history/policy-and-law/fire-u-s-forest-service/famous-fires/the-1910-fires/. | EXACT TITLE in history: "Ed Pulaski".
0.450
centercommunitydepartmenteducationestablishedfederallyformerfortgovernedgovernmentidahoimportantinteriorjulylandlandslargestlawmembersmiles
SHARED TOKENS (38): "center", "community", "department", "education", "established", "federally", "former", "fort", "governed", "government", "idaho", "important", "interior", "july", "land", "lands", "largest", "law", "members", "miles".... | URL->A (1): https://www.sbtribes.com/.
0.440
airaircraftaviationcapacitycombatconductingdesigndevelopmentforcesmilitarynationalwar
SHARED TOKENS (12): "air", "aircraft", "aviation", "capacity", "combat", "conducting", "design", "development", "forces", "military", "national", "war". | EXACT TITLE in military: "Military aviation".
0.440
americanboisecreateddataidahomajormarketsemiconductorsouthstoragetechnologytogether
SHARED TOKENS (12): "american", "boise", "created", "data", "idaho", "major", "market", "semiconductor", "south", "storage", "technology", "together". | EXACT TITLE in history: "Micron Technology".
0.420
Bannock people ↗ EXACT TITLE
federallyfortidaholandsnevadanorthernoregonoriginallyrecognizedsouthernwestern
SHARED TOKENS (11): "federally", "fort", "idaho", "lands", "nevada", "northern", "oregon", "originally", "recognized", "southern", "western". | EXACT TITLE in history: "Bannock people".
0.410
idahojulyorganized
SHARED TOKENS (3): "idaho", "july", "organized". | URL->A (1): https://www.boisecounty.us/visit-boise-county/. | EXACT TITLE in history: "Idaho Territory".
0.400
Teton Dam ↗ Q1595414 EXACT TITLE
agenciesbuiltbureauclaimsfederalgovernmentidahomillionriverwestern
SHARED TOKENS (10): "agencies", "built", "bureau", "claims", "federal", "government", "idaho", "million", "river", "western". | EXACT TITLE in history: "Teton Dam".
0.400
articlecombatfieldgeneralgroundgroupmountainnationalunitsurban
SHARED TOKENS (10): "article", "combat", "field", "general", "ground", "group", "mountain", "national", "units", "urban". | EXACT TITLE in military: "Search and rescue".
0.400
anotherbusinesscontractexistinggeneralmainprojectpublicsmallsupport
SHARED TOKENS (10): "another", "business", "contract", "existing", "general", "main", "project", "public", "small", "support". | EXACT TITLE in military: "Subcontractor".
0.380
departmentdevelopmentgovernoridahoinsurancelaborselectedtechnologyworkforce
SHARED TOKENS (9): "department", "development", "governor", "idaho", "insurance", "labor", "selected", "technology", "workforce". | EXACT TITLE in history: "Idaho Department of Labor". | EXACT TITLE in military: "Idaho Department of Labor".
0.380
advocateamericancivildefenselegalmattersmemberprominentpublic
SHARED TOKENS (9): "advocate", "american", "civil", "defense", "legal", "matters", "member", "prominent", "public". | EXACT TITLE in history: "Clarence Darrow".
0.380
americandecembergovernoridaholabormemberorchardservingwestern
SHARED TOKENS (9): "american", "december", "governor", "idaho", "labor", "member", "orchard", "serving", "western". | EXACT TITLE in history: "Frank Steunenberg".
0.380
boisecaldwellcanyonidaholargestmetropolitanpopulationruralwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "metropolitan", "population", "rural", "western". | EXACT TITLE in history: "Parma, Idaho".
0.360
Taxiway ↗ Q910386 EXACT TITLE
aircraftairportaviationconnectingfacilitiesgeneralmovingsafe
SHARED TOKENS (8): "aircraft", "airport", "aviation", "connecting", "facilities", "general", "moving", "safe". | EXACT TITLE in history: "Taxiway". | EXACT TITLE in military: "Taxiway".
0.360
airairportaviationbasecivilfacilitiesjoint-usemilitary
SHARED TOKENS (8): "air", "airport", "aviation", "base", "civil", "facilities", "joint-use", "military". | EXACT TITLE in military: "Joint-use airport".
0.360
boisecenterculturalhistoricidahomuseumnationalplaces
SHARED TOKENS (8): "boise", "center", "cultural", "historic", "idaho", "museum", "national", "places". | EXACT TITLE in history: "Cyrus Jacobs House".
0.360
americangovernoridahoimportantjulyservingterritorialwashington
SHARED TOKENS (8): "american", "governor", "idaho", "important", "july", "serving", "territorial", "washington". | EXACT TITLE in history: "William H. Wallace".
0.360
Basques ↗ Q126756 EXACT TITLE
amongaroundcommondirectgroupprimarilyregionwestern
SHARED TOKENS (8): "among", "around", "common", "direct", "group", "primarily", "region", "western". | EXACT TITLE in history: "Basques".
0.360
designeddevelopmenteducationmembersmilitaryprofessionalprogramstraining
SHARED TOKENS (8): "designed", "development", "education", "members", "military", "professional", "programs", "training". | EXACT TITLE in military: "Professional military education".
0.350
boisebuiltformerhistoricidahonationalopenedplacesrailroadtrain
SHARED TOKENS (10): "boise", "built", "former", "historic", "idaho", "national", "opened", "places", "railroad", "train". | URL->A (1): https://www.ktvb.com/article/news/local/208/1925-boise-depot-train-city-of-trees/277-c69c10d4-8186-43c0-9659-73118e304569.
0.340
Runway ↗ Q184590 EXACT TITLE
aircraftaviationbuiltdefineddesignedexcepttaxiways
SHARED TOKENS (7): "aircraft", "aviation", "built", "defined", "designed", "except", "taxiways". | EXACT TITLE in military: "Runway".
0.340
Air base ↗ Q695850 EXACT TITLE
airaircraftairportbaseforcemilitaryoperating
SHARED TOKENS (7): "air", "aircraft", "airport", "base", "force", "military", "operating". | EXACT TITLE in history: "Air base".
0.320
directlygeneralgovernmentlawworkworks
SHARED TOKENS (6): "directly", "general", "government", "law", "work", "works". | EXACT TITLE in military: "Prime contractor".
0.320
americancontinuouslydecemberidahomemberoffice
SHARED TOKENS (6): "american", "continuously", "december", "idaho", "member", "office". | EXACT TITLE in history: "Pete Cenarrusa".
0.320
departmentdevelopmentgrowthidahopublicresources
SHARED TOKENS (6): "department", "development", "growth", "idaho", "public", "resources". | EXACT TITLE in military: "Idaho Department of Commerce".
0.300
Homestead Acts ↗ Q974556 KW CROSS HIGH
actagainstaroundfederalgovernmentindividuallaborlandlargelawmillionnearlyopenedoperatepercentperiodpolicyprovidingpublicreceived
SHARED TOKENS (23): "act", "against", "around", "federal", "government", "individual", "labor", "land", "large", "law", "million", "nearly", "opened", "operate", "percent", "period", "policy", "providing", "public", "received"....
0.300
actairarmyarticlechaptercorpscurrentdefensedepartmentdifferentfederalforceforcesformergeneralguardjusticelawlegalmilitary
SHARED TOKENS (29): "act", "air", "army", "article", "chapter", "corps", "current", "defense", "department", "different", "federal", "force", "forces", "former", "general", "guard", "justice", "law", "legal", "military"....
0.300
againstairaircraftcivilcombatcombinedconflictcontinuedcontrolcoordinationdedicateddefineddevelopedespeciallyfireforcesgroundlatermajormilitary
SHARED TOKENS (30): "against", "air", "aircraft", "civil", "combat", "combined", "conflict", "continued", "control", "coordination", "dedicated", "defined", "developed", "especially", "fire", "forces", "ground", "later", "major", "military"....
0.300
Shooting range ↗ Q521839 KW CROSS HIGH
agenciesairdesignedentertainmentevenfacilityfieldgroundlawmilitaryoperatedpracticerangesrelevantsafesafetyspecificallytraining
SHARED TOKENS (18): "agencies", "air", "designed", "entertainment", "even", "facility", "field", "ground", "law", "military", "operated", "practice", "ranges", "relevant", "safe", "safety", "specifically", "training".
0.300
administrationagainstaircraftamericananotherauthoritycapitalcombatconflictcontrolcreatingestablishedforceforcesformergovernmentgroupgroupshistoryhold
SHARED TOKENS (37): "administration", "against", "aircraft", "american", "another", "authority", "capital", "combat", "conflict", "control", "creating", "established", "force", "forces", "former", "government", "group", "groups", "history", "hold"....
0.300
Civil service ↗ KW CROSS HIGH
administrativeappointedauthoritiescareercivilciviliancommonconditionscreateddepartmentdevelopedemployeesestablishedfieldgeneralgovernedgovernmentinstitutionallocalmember
SHARED TOKENS (32): "administrative", "appointed", "authorities", "career", "civil", "civilian", "common", "conditions", "created", "department", "developed", "employees", "established", "field", "general", "governed", "government", "institutional", "local", "member"....
0.300
artifactsconflictcontextdedicateddocumentseducationhistoryindexinstitutioninstitutionsmemorialmilitarymuseumnationalpreservationregionregionalrelatedservetechnology
SHARED TOKENS (22): "artifacts", "conflict", "context", "dedicated", "documents", "education", "history", "index", "institution", "institutions", "memorial", "military", "museum", "national", "preservation", "region", "regional", "related", "serve", "technology"....
0.300
actamericanamongauthoritybureauconstructioncreateddepartmentestablishedfederalfundedinteriorlandlandslaterlawmajornationalnearlynevada
SHARED TOKENS (31): "act", "american", "among", "authority", "bureau", "construction", "created", "department", "established", "federal", "funded", "interior", "land", "lands", "later", "law", "major", "national", "nearly", "nevada"....
0.300
combatdesignedforcesgeneralgroundsimportantinstallationlandmilitarypublicservespecificallytechnologytraintrainingwildlife
SHARED TOKENS (16): "combat", "designed", "forces", "general", "grounds", "important", "installation", "land", "military", "public", "serve", "specifically", "technology", "train", "training", "wildlife".
0.300
Oregon Country ↗ Q388164 KW CROSS HIGH
americanarticlebeyondclaimedcontroldepartmentestablishedexceptfoundationgovernmentidaholandlargemontananationalnorthernnorthwestoperationsoregonperiod
SHARED TOKENS (33): "american", "article", "beyond", "claimed", "control", "department", "established", "except", "foundation", "government", "idaho", "land", "large", "montana", "national", "northern", "northwest", "operations", "oregon", "period"....
0.300
actagainstcivildefensedefinedepartmentfederalforcesgovernmentguardindividuallawmilitarynationalnationallyprotectrequiresrestrictionssecuritytitle
SHARED TOKENS (21): "act", "against", "civil", "defense", "define", "department", "federal", "forces", "government", "guard", "individual", "law", "military", "national", "nationally", "protect", "requires", "restrictions", "security", "title"....
0.300
actairarmyauthoritybecomecapacitycontroldefensedefineddifferentfederalforceforcesgovernmentgovernorgroundguardindividuallawmanagement
SHARED TOKENS (36): "act", "air", "army", "authority", "become", "capacity", "control", "defense", "defined", "different", "federal", "force", "forces", "government", "governor", "ground", "guard", "individual", "law", "management"....
0.300
Military engineering ↗ KW CROSS HIGH
academicaccordingactivitiesaircraftcivilcombatcommunicationsconstructioncontroldefensedefinedengineerengineeringengineersenvironmentenvironmentalfireforceintelligencemilitary
SHARED TOKENS (34): "academic", "according", "activities", "aircraft", "civil", "combat", "communications", "construction", "control", "defense", "defined", "engineer", "engineering", "engineers", "environment", "environmental", "fire", "force", "intelligence", "military"....
0.300
actagenciesauthoritiesauthorityconservationdecemberdesigneddevelopmentdifferentfederalgrowthlawnationalpointpreservationprimaryprotectprovisionsrequiressupreme
SHARED TOKENS (21): "act", "agencies", "authorities", "authority", "conservation", "december", "designed", "development", "different", "federal", "growth", "law", "national", "point", "preservation", "primary", "protect", "provisions", "requires", "supreme"....
0.300
alongsideamericanamongcombatcommonconflictdevelopeddisasterdocumenteddomesticenougheventeventsexceptexperiencefirelargemainmilitaryphysical
SHARED TOKENS (30): "alongside", "american", "among", "combat", "common", "conflict", "developed", "disaster", "documented", "domestic", "enough", "event", "events", "except", "experience", "fire", "large", "main", "military", "physical"....
0.300
alongsidebecomecommoncommunityconsequencesecosystemfireforcesfuelimportantlandlandscapelocalopenpresencequalitysourcewestwildlife
SHARED TOKENS (19): "alongside", "become", "common", "community", "consequences", "ecosystem", "fire", "forces", "fuel", "important", "land", "landscape", "local", "open", "presence", "quality", "source", "west", "wildlife".
0.300
communitiescommunityconnectingdefensedepartmentdirectfamilyguardlawmembersmillionnationalofficepolicyprogramprogramspublicrecognitionreserveresources
SHARED TOKENS (22): "communities", "community", "connecting", "defense", "department", "direct", "family", "guard", "law", "members", "million", "national", "office", "policy", "program", "programs", "public", "recognition", "reserve", "resources"....
0.300
activitiesbroaderciviliancombatdatadecisionsenvironmentforcesidentifiedintelligencemilitaryoperationsperiodpersonalplanningpopulationprovidingselectedsourcesstrategic
SHARED TOKENS (24): "activities", "broader", "civilian", "combat", "data", "decisions", "environment", "forces", "identified", "intelligence", "military", "operations", "period", "personal", "planning", "population", "providing", "selected", "sources", "strategic"....
0.300
approximatelyboisebuildingsbuiltevenformerfuneralhistorichistoricalhonoridaholatermilesnearnearbyoperatedprovidingsinglesitesociety
SHARED TOKENS (22): "approximately", "boise", "buildings", "built", "even", "former", "funeral", "historic", "historical", "honor", "idaho", "later", "miles", "near", "nearby", "operated", "providing", "single", "site", "society"....
0.300
accordingarmyauthoritycommoncontroldefinedevelopmentfieldforceforcesindividualmeaningmilitaryorganizationphysicalresourcessystemtechnical
SHARED TOKENS (18): "according", "army", "authority", "common", "control", "define", "development", "field", "force", "forces", "individual", "meaning", "military", "organization", "physical", "resources", "system", "technical".
0.300
actadjacentairarmyauthoritycapacitycommoncorpsdefensedepartmentexpandedfederalforcegovernorgroupguardhomelawlegalmakes
SHARED TOKENS (30): "act", "adjacent", "air", "army", "authority", "capacity", "common", "corps", "defense", "department", "expanded", "federal", "force", "governor", "group", "guard", "home", "law", "legal", "makes"....
0.300
actairauthoritychiefciviliancontroldefensedepartmentdepartmentsenergyenvironmentfinancialforceforcesgeneralmanagementmilitarynationalofficeoperations
SHARED TOKENS (28): "act", "air", "authority", "chief", "civilian", "control", "defense", "department", "departments", "energy", "environment", "financial", "force", "forces", "general", "management", "military", "national", "office", "operations"....
0.300
aroundcommunicationscreatingcurrentforcesinstitutionslatermilitarypresentsecuritysocialsystemstextthemvisualworld
SHARED TOKENS (16): "around", "communications", "creating", "current", "forces", "institutions", "later", "military", "present", "security", "social", "systems", "text", "them", "visual", "world".
0.300
actarmyciviliancollegecommissionedcorpscreateddefensegroupguardlandlargestmilitarymodernnationalprogramprogramsreservethroughouttrain
SHARED TOKENS (25): "act", "army", "civilian", "college", "commissioned", "corps", "created", "defense", "group", "guard", "land", "largest", "military", "modern", "national", "program", "programs", "reserve", "throughout", "train"....
0.300
activitiesadministrationaircraftaviationcommercialdesigndesignedfederalgeneraloperationspublicsafespacestructuresystemstitletraining
SHARED TOKENS (17): "activities", "administration", "aircraft", "aviation", "commercial", "design", "designed", "federal", "general", "operations", "public", "safe", "space", "structure", "systems", "title", "training".
0.300
againstairaircraftamericananotherarmyciviliancombatcontractcorpsdesigndevelopedforceshistoryinitialmilitarymillionnationaloperationsprimarily
SHARED TOKENS (26): "against", "air", "aircraft", "american", "another", "army", "civilian", "combat", "contract", "corps", "design", "developed", "forces", "history", "initial", "military", "million", "national", "operations", "primarily"....
0.300
administrativeconsequencescontextdecisiondecisionsdevelopmentdocumentationenvironmentalgovernedimpactsmajormakingmanagementpolicyprogramprojectprojectsproposedpublicpurpose
SHARED TOKENS (23): "administrative", "consequences", "context", "decision", "decisions", "development", "documentation", "environmental", "governed", "impacts", "major", "making", "management", "policy", "program", "project", "projects", "proposed", "public", "purpose"....
0.300
actanotherassetsbusinesscapitalcentralcombinedcontrolcreatedepartmentdirectfederalgovernedgovernmentjusticelawlegalmanagementmarketoperating
SHARED TOKENS (32): "act", "another", "assets", "business", "capital", "central", "combined", "control", "create", "department", "direct", "federal", "governed", "government", "justice", "law", "legal", "management", "market", "operating"....
0.300
americanapproximatelycurrentdefensedepartmentfamilyformergenericmembermembersmilitarymillionrelationshipresearchrights
SHARED TOKENS (15): "american", "approximately", "current", "defense", "department", "family", "former", "generic", "member", "members", "military", "million", "relationship", "research", "rights".
0.300
accordingacquiredagainstamericancivilconflictexpansionformergovernmentissueslandslargemajornationaloregonoriginallyprominentwarwestworld
SHARED TOKENS (20): "according", "acquired", "against", "american", "civil", "conflict", "expansion", "former", "government", "issues", "lands", "large", "major", "national", "oregon", "originally", "prominent", "war", "west", "world".
0.300
administrationaroundassetscapitalcontractdevelopmentfinancialfinancingfundinggovernmentinfrastructureinstitutionsinvestmentissuesoperatingoutsideprimarilyprivateprojectspublic
SHARED TOKENS (30): "administration", "around", "assets", "capital", "contract", "development", "financial", "financing", "funding", "government", "infrastructure", "institutions", "investment", "issues", "operating", "outside", "primarily", "private", "projects", "public"....
0.300
James Stewart ↗ Q102462 KW CROSS HIGH
airamericanamongarmyaroundbecomecareercentercombatcommercialforceforcesgeneralhomehonorjulylatermakingmilitarypositions
SHARED TOKENS (30): "air", "american", "among", "army", "around", "become", "career", "center", "combat", "commercial", "force", "forces", "general", "home", "honor", "july", "later", "making", "military", "positions"....
0.300
Military base ↗ Q245016 KW CROSS HIGH
airaviationbasecenterdirectlyfacilityfoodgroundmilitaryoperateoperatedoperationsoutsidetrainingunits
SHARED TOKENS (15): "air", "aviation", "base", "center", "directly", "facility", "food", "ground", "military", "operate", "operated", "operations", "outside", "training", "units".
0.300
administrationamericandepartmenteducationestablishedexpandedfacilitiesfamilyfederalgovernmenthomeinsurancemembermembersmemorialmilitarynationalnetofficesprogram
SHARED TOKENS (23): "administration", "american", "department", "education", "established", "expanded", "facilities", "family", "federal", "government", "home", "insurance", "member", "members", "memorial", "military", "national", "net", "offices", "program"....
0.300
aircraftassetsbecomecontrolcontrolleddevelopedentertainmentenvironmentalexpandedfireforestinfrastructuremilitaryoriginallyriversystemvehicle
SHARED TOKENS (17): "aircraft", "assets", "become", "control", "controlled", "developed", "entertainment", "environmental", "expanded", "fire", "forest", "infrastructure", "military", "originally", "river", "system", "vehicle".
0.300
actadministrativeairaircraftappointedapproximatelyarmyauthoritychiefcivilcivilianconductingcontrolcorecorpsdefensedepartmentdepartmentsestablishedexercises
SHARED TOKENS (43): "act", "administrative", "air", "aircraft", "appointed", "approximately", "army", "authority", "chief", "civil", "civilian", "conducting", "control", "core", "corps", "defense", "department", "departments", "established", "exercises"....
0.300
acquiredamericanarmycampcivilianclaimscommissionedcorpsdirectlydiscoveryfortgeographygrouplandslatermapsmembersnearoregonpresence
SHARED TOKENS (27): "acquired", "american", "army", "camp", "civilian", "claims", "commissioned", "corps", "directly", "discovery", "fort", "geography", "group", "lands", "later", "maps", "members", "near", "oregon", "presence"....
0.300
airairportboisecanyoncapitalcentercentralcollegecommunitycreateddecemberdestinationentertainmenteventsgovernmentheadquartershomeidahoimportantmain
SHARED TOKENS (42): "air", "airport", "boise", "canyon", "capital", "center", "central", "college", "community", "created", "december", "destination", "entertainment", "events", "government", "headquarters", "home", "idaho", "important", "main"....
0.300
accordingactivitiesamericanbasecombatcombinedconditionsconflictcontrolledcoordinationdecisiondecisionsexercisesforcesgeographichomeidentifiedmilitaryoperationsoutside
SHARED TOKENS (33): "according", "activities", "american", "base", "combat", "combined", "conditions", "conflict", "controlled", "coordination", "decision", "decisions", "exercises", "forces", "geographic", "home", "identified", "military", "operations", "outside"....
0.300
boiseidahomakingmilitaryopened
SHARED TOKENS (5): "boise", "idaho", "making", "military", "opened". | EXACT TITLE in military: "Idaho State Veterans Cemetery".
0.300
amongarmyarticlebecomecapitalcommondefensedirectestablishingfederalgeneralgovernmenthouseslargestlawmembersmilitianationalnavyoffice
SHARED TOKENS (36): "among", "army", "article", "become", "capital", "common", "defense", "direct", "establishing", "federal", "general", "government", "houses", "largest", "law", "members", "militia", "national", "navy", "office"....
0.300
agenciesairarmyciviliancollegecontractdefensedepartmentdepartmentsdevelopmentdirectlyemployeesfederalforceforcesgovernmentguardintelligencemanagementmilitary
SHARED TOKENS (38): "agencies", "air", "army", "civilian", "college", "contract", "defense", "department", "departments", "development", "directly", "employees", "federal", "force", "forces", "government", "guard", "intelligence", "management", "military"....
0.300
actagenciesaroundauthoritycreateddecemberdecisionsdesignedenvironmentenvironmentalestablishedfederalgovernmentimpactslawnationalpolicyproposedqualityrequires
SHARED TOKENS (23): "act", "agencies", "around", "authority", "created", "december", "decisions", "designed", "environment", "environmental", "established", "federal", "government", "impacts", "law", "national", "policy", "proposed", "quality", "requires"....
0.300
actcorpsdesignedestablishedforceforceslargestmilitarynationaloperationsorganizationprimarilyprovidingreserveroletrainedtrainingunitswarwork
SHARED TOKENS (20): "act", "corps", "designed", "established", "force", "forces", "largest", "military", "national", "operations", "organization", "primarily", "providing", "reserve", "role", "trained", "training", "units", "war", "work".
0.300
Iraq War ↗ Q545449 KW CROSS HIGH
additionaladministrationagainstamongaroundauthoritybroadercivilclaimscombatcombinedconflictcreatedestablishedforceforcesgovernmentgroundlawmilitary
SHARED TOKENS (28): "additional", "administration", "against", "among", "around", "authority", "broader", "civil", "claims", "combat", "combined", "conflict", "created", "established", "force", "forces", "government", "ground", "law", "military"....
0.300
airamericanarmyaviationchiefcivilciviliancombatconflictdefensedepartmentdepartmentsfieldforcesguardinfantrylandlargestmainmajor
SHARED TOKENS (37): "air", "american", "army", "aviation", "chief", "civil", "civilian", "combat", "conflict", "defense", "department", "departments", "field", "forces", "guard", "infantry", "land", "largest", "main", "major"....
0.300
administrationagainstagenciesaircraftamericananotherarticleaviationbuildingscentercentralcombinedconsequencesconstructioncontinueddeathdedicateddefensedepartmentdesign
SHARED TOKENS (64): "administration", "against", "agencies", "aircraft", "american", "another", "article", "aviation", "buildings", "center", "central", "combined", "consequences", "construction", "continued", "death", "dedicated", "defense", "department", "design"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcontroldevelopmentexpansionfinancialfinancingfirmgeneralinvestmentmanagementofferedprivatepublicrolestrategy
SHARED TOKENS (16): "business", "capital", "control", "development", "expansion", "financial", "financing", "firm", "general", "investment", "management", "offered", "private", "public", "role", "strategy".
0.300
Outsourcing ↗ Q61515 KW CROSS HIGH
anotherassetsbusinesscenterclaimscontrolculturaldomesticemployeesevenfacilityfirmjobslaterlegalmanagementmanufacturingorganizationoutsidepractice
SHARED TOKENS (27): "another", "assets", "business", "center", "claims", "control", "cultural", "domestic", "employees", "even", "facility", "firm", "jobs", "later", "legal", "management", "manufacturing", "organization", "outside", "practice"....
0.300
boisebureaucapacitydesignedgenerationhistoricidahonationalnearplacesprogramprojectrivertreasurevalleywestern
SHARED TOKENS (16): "boise", "bureau", "capacity", "designed", "generation", "historic", "idaho", "national", "near", "places", "program", "project", "river", "treasure", "valley", "western".
0.300
actairappointedarmychiefciviliandefensedepartmentdepartmentsfederalforcegovernmentmembermilitarynationalofficialorganizedoriginallysecuritystaff
SHARED TOKENS (22): "act", "air", "appointed", "army", "chief", "civilian", "defense", "department", "departments", "federal", "force", "government", "member", "military", "national", "official", "organized", "originally", "security", "staff"....
0.300
academicacquiredadditionalagainstaroundcareerdescribesdevelopmentexperiencefieldindividualinstitutionsmanagementmilitaryorganizationsoutsidepersonalplanningprimarilyprofessional
SHARED TOKENS (26): "academic", "acquired", "additional", "against", "around", "career", "describes", "development", "experience", "field", "individual", "institutions", "management", "military", "organizations", "outside", "personal", "planning", "primarily", "professional"....
0.300
Combined arms ↗ Q1418029 KW CROSS HIGH
accordingairaircraftanothercombatcombineddifferentdivisionenvironmentforcesgroundinfantrylandmilitarymodernorganizationprotectrequiressimultaneouslyspace
SHARED TOKENS (25): "according", "air", "aircraft", "another", "combat", "combined", "different", "division", "environment", "forces", "ground", "infantry", "land", "military", "modern", "organization", "protect", "requires", "simultaneously", "space"....
0.300
americanboisebridgebuiltcivilconstructiondesignedengineeringheadquartersidahoinfrastructurelargemajorpipelineprojectsthroughoutworld
SHARED TOKENS (17): "american", "boise", "bridge", "built", "civil", "construction", "designed", "engineering", "headquarters", "idaho", "infrastructure", "large", "major", "pipeline", "projects", "throughout", "world".
0.300
a-10againstairaircraftamericanaroundcombatconflictdesigndesigneddevelopeddirectfacilitiesforceforcesgroundlandmodernprimarilyprogram
SHARED TOKENS (28): "a-10", "against", "air", "aircraft", "american", "around", "combat", "conflict", "design", "designed", "developed", "direct", "facilities", "force", "forces", "ground", "land", "modern", "primarily", "program"....
0.300
activitiesairarmycollegecombinedcommissionedcorpscoveringdefensedegreedepartmenteducationfieldforceforcesfortgroupgroupsguardmilitary
SHARED TOKENS (40): "activities", "air", "army", "college", "combined", "commissioned", "corps", "covering", "defense", "degree", "department", "education", "field", "force", "forces", "fort", "group", "groups", "guard", "military"....
0.300
Memorial Day ↗ Q371781 KW CROSS HIGH
administrationamericanamongannualarmybecomecivilclaimeddepartmentdivisionfederalforceshonorlegallocalmembersmemorialmilitarynationalofficial
SHARED TOKENS (26): "administration", "american", "among", "annual", "army", "become", "civil", "claimed", "department", "division", "federal", "forces", "honor", "legal", "local", "members", "memorial", "military", "national", "official"....
🫐 BERRY50 edges
0.280
authoritycivilcivilianforcesissuesjusticelawlegalmembersmilitarypopulationpreservationsystemswar
SHARED TOKENS (14): "authority", "civil", "civilian", "forces", "issues", "justice", "law", "legal", "members", "military", "population", "preservation", "systems", "war".
0.280
administrativechiefgeneralmilitary
SHARED TOKENS (4): "administrative", "chief", "general", "military". | EXACT TITLE in military: "Adjutant general".
0.280
airconditionsenvironmentevenfirematerialsphysicalpublicsafetysystemthemtrainedwarworld
SHARED TOKENS (14): "air", "conditions", "environment", "even", "fire", "materials", "physical", "public", "safety", "system", "them", "trained", "war", "world".
0.280
defensedescribesespeciallyindustrymeaningmilitarypolicypublicrelationshipsignificantsuppliesthemtogetherwar
SHARED TOKENS (14): "defense", "describes", "especially", "industry", "meaning", "military", "policy", "public", "relationship", "significant", "supplies", "them", "together", "war".
0.260
authoritychiefcontrolexercisesforceforcesgovernmentmilitaryofficialprofessionalsupremetechnicaltitle
SHARED TOKENS (13): "authority", "chief", "control", "exercises", "force", "forces", "government", "military", "official", "professional", "supreme", "technical", "title".
0.260
Simplot ↗ Q3484788 EXACT TITLE
americanboiseidaho
SHARED TOKENS (3): "american", "boise", "idaho". | EXACT TITLE in history: "Simplot".
0.260
americanarmyforcesgeneralguardheadquartersjulymilitarynationaloperationsregimentsouthwest
SHARED TOKENS (13): "american", "army", "forces", "general", "guard", "headquarters", "july", "military", "national", "operations", "regiment", "south", "west".
0.260
Cyberwarfare ↗ Q849340 KW CROSS HIGH
againstamongdefensedigitalevenforcesmilitaryoperationsphysicalscalesignificantwarworld
SHARED TOKENS (13): "against", "among", "defense", "digital", "even", "forces", "military", "operations", "physical", "scale", "significant", "war", "world".
0.260
boisecentercontainsfederallyidaholargestmetropolitannevadaowyheepopulationrecognizedtribalvalley
SHARED TOKENS (13): "boise", "center", "contains", "federally", "idaho", "largest", "metropolitan", "nevada", "owyhee", "population", "recognized", "tribal", "valley".
0.260
governmentinteriorlocal
SHARED TOKENS (3): "government", "interior", "local". | EXACT TITLE in history: "Secretary of the Interior".
0.260
James Hawley ↗ EXACT TITLE
americanidahopublic
SHARED TOKENS (3): "american", "idaho", "public". | EXACT TITLE in history: "James Hawley".
0.240
WinCo Foods ↗ Q8023592 KW CROSS HIGH
americanboisecomemployeesfoodidaholargestmontananevadaoperatedoregonwashington
SHARED TOKENS (12): "american", "boise", "com", "employees", "food", "idaho", "largest", "montana", "nevada", "operated", "oregon", "washington".
0.240
constructiondesigndevelopmentevenfacilitiesforcesmilitaryoperationsplanningpurposestoragesupport
SHARED TOKENS (12): "construction", "design", "development", "even", "facilities", "forces", "military", "operations", "planning", "purpose", "storage", "support".
0.220
americanmember
SHARED TOKENS (2): "american", "member". | EXACT TITLE in history: "George Grimes".
0.220
airarmycorpsforceguardindividualmilitarynavyprimarysystemtraining
SHARED TOKENS (11): "air", "army", "corps", "force", "guard", "individual", "military", "navy", "primary", "system", "training".
0.220
fortidahometropolitannearoregonoriginalpopulationriversitesnakesouth
SHARED TOKENS (11): "fort", "idaho", "metropolitan", "near", "oregon", "original", "population", "river", "site", "snake", "south".
0.220
datadigitalexpandedfieldinfrastructuremodernnetworkphysicalsecuritysystemstechnology
SHARED TOKENS (11): "data", "digital", "expanded", "field", "infrastructure", "modern", "network", "physical", "security", "systems", "technology".
0.220
activitiescentralestablishedforestheadquartersidahomilesmountainnationalnearnorthern
SHARED TOKENS (11): "activities", "central", "established", "forest", "headquarters", "idaho", "miles", "mountain", "national", "near", "northern".
0.210
professional
SHARED TOKENS (1): "professional". | EXACT TITLE in history: "Harry Morrison".
0.210
aircraft
SHARED TOKENS (1): "aircraft". | EXACT TITLE in military: "Aircraft maintenance".
0.210
group
SHARED TOKENS (1): "group". | EXACT TITLE in history: "Irreconcilables".
0.210
industry
SHARED TOKENS (1): "industry". | EXACT TITLE in history: "Nathaniel Wyeth".
0.200
backgroundemployeesindividualorganizationorganizationspositionprivatesecuritystatusthem
SHARED TOKENS (10): "background", "employees", "individual", "organization", "organizations", "position", "private", "security", "status", "them".
0.200
administrativeagencieschapterdefensedescribesfederalgovernmentsystemtitlevalue
SHARED TOKENS (10): "administrative", "agencies", "chapter", "defense", "describes", "federal", "government", "system", "title", "value".
0.200
Camas ↗ Q419373 EXACT TITLE
camastermtopics
EXACT TITLE in history: "Camas".
0.180
adaboisegovernmentidahomainmetropolitannearlypopulationstreet
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "main", "metropolitan", "nearly", "population", "street".
0.180
airanothercivilianfacilitygroundhospitallocalmilitaryrequiring
SHARED TOKENS (9): "air", "another", "civilian", "facility", "ground", "hospital", "local", "military", "requiring".
0.180
Air rights ↗ Q4698374 KW CROSS HIGH
aircommondevelopmentimportantlandlawlegalrightsspace
SHARED TOKENS (9): "air", "common", "development", "important", "land", "law", "legal", "rights", "space".
0.180
agenciescommoncontrolcoordinationdevelopedmanagementnationalprovidingsystem
SHARED TOKENS (9): "agencies", "common", "control", "coordination", "developed", "management", "national", "providing", "system".
0.180
activitiesadditionalbeginscareereducationinstitutionmilitarystafftraining
SHARED TOKENS (9): "activities", "additional", "begins", "career", "education", "institution", "military", "staff", "training".
0.160
americanformergovernoridahoorchardprominentreportedwestern
SHARED TOKENS (8): "american", "former", "governor", "idaho", "orchard", "prominent", "reported", "western".
0.160
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitannearlypercentpopulation
SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "metropolitan", "nearly", "percent", "population".
0.160
againstbusinessgovernmenthistoricallaterpointwestwestern
SHARED TOKENS (8): "against", "business", "government", "historical", "later", "point", "west", "western".
0.160
Ann Morrison Park ↗ KW CROSS HIGH
boisedepartmenteventsfacilitiesidahoparkriverurban
SHARED TOKENS (8): "boise", "department", "events", "facilities", "idaho", "park", "river", "urban".
0.160
articlecurrentforcesgovernmentgovernoridahomilitaryoffice
SHARED TOKENS (8): "article", "current", "forces", "government", "governor", "idaho", "military", "office".
0.160
degreesdifferentmilitarymodelsoutsideprofessionalsocialwar
SHARED TOKENS (8): "degrees", "different", "military", "models", "outside", "professional", "social", "war".
0.160
administrationdepartmentforceshomeinsurancememorialmilitarysocial
SHARED TOKENS (8): "administration", "department", "forces", "home", "insurance", "memorial", "military", "social".
0.160
actcivilianfederallawmilitaryprotectreserverights
SHARED TOKENS (8): "act", "civilian", "federal", "law", "military", "protect", "reserve", "rights".
0.140
aroundcivilgeneralhistorymigrationthroughoutwar
SHARED TOKENS (7): "around", "civil", "general", "history", "migration", "throughout", "war".
0.140
Sacagawea ↗ Q238960 KW CROSS HIGH
americanculturaldecemberdifferenthistorymilesnational
SHARED TOKENS (7): "american", "cultural", "december", "different", "history", "miles", "national".
0.140
armyforceforcesguardnationalreservetogether
SHARED TOKENS (7): "army", "force", "forces", "guard", "national", "reserve", "together".
0.140
boisecenterculturalhistoryidahoinstitutionmuseum
SHARED TOKENS (7): "boise", "center", "cultural", "history", "idaho", "institution", "museum".
0.140
administrationindividualmembersnavyreserveselectedtraining
SHARED TOKENS (7): "administration", "individual", "members", "navy", "reserve", "selected", "training".
0.120
agenciesdatagovgovernmentmanagementsystem
SHARED TOKENS (6): "agencies", "data", "gov", "government", "management", "system".
0.120
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahomilesnorthwestpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "miles", "northwest", "population".
0.100
homehospitalinstitutionmilitarysoldiers
SHARED TOKENS (5): "home", "hospital", "institution", "military", "soldiers".
0.100
boiseidahometropolitanmilespopulation
SHARED TOKENS (5): "boise", "idaho", "metropolitan", "miles", "population".
0.100
defineddepartmentforceslegalmilitary
SHARED TOKENS (5): "defined", "department", "forces", "legal", "military".
0.100
Placerville, Idaho ↗ KW CROSS HIGH
boiseidahometropolitanpopulatedpopulation
SHARED TOKENS (5): "boise", "idaho", "metropolitan", "populated", "population".
0.100
conservationgroupsmanagementpracticeprotect
SHARED TOKENS (5): "conservation", "groups", "management", "practice", "protect".
◈ Frequently Asked Questions
History × Military — Treasure Valley
HAIKU · HIGH GATE
What role did Fort Boise play in the military and settlement history of the Treasure Valley?
Fort Boise served as a critical military outpost along the Snake River Plain during the 19th century, protecting settlers and trade routes in what became Idaho's capital region. The fort's presence directly influenced the development of Boise and the surrounding Treasure Valley, establishing the area as a significant population center in the western United States.
How does the Idaho Military Department connect to the historical development of Boise and Ada County?
The Idaho Military Department maintains historical records and oversight of military installations that shaped Boise's growth from a frontier settlement into the largest metropolitan area in Idaho. Ada County's development as a population center was influenced by military infrastructure and personnel stationed throughout the Treasure Valley since the territorial period.
What military resources does the Treasure Valley region around Boise and Nampa provide today?
Boise Airport and surrounding infrastructure in Ada County support the Idaho Military Department's operational capabilities across the Treasure Valley and Snake River Plain region. The metropolitan population of Boise and Nampa provides military recruitment and support services across multiple miles of developed territory in Idaho's largest urban center.
How has the United States Forest Service's military history affected land management in the Treasure Valley?
The United States Forest Service evolved from military conservation programs that protected millions of acres across the Snake River Plain and surrounding Idaho landscape near Boise. Historical military involvement in land management continues to influence wildfire suppression strategies and national forest administration throughout the Treasure Valley region.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
History × Military 17 QID bridges 229 edges 5,718 ext links 2026-07-17 21:15:20 UTC c7b7442c1269b97c
History corridor ↗ Military corridor ↗ Military × History ↗ boisestandard.org/standard ↗
Parent Corridors
History × All Other Verticals