—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Coworking Commercial Space ↔ relates to ↔ Financial

13 Wikipedia bridge articles confirmed in both vertical ledgers. 277 deterministic cross-vertical edges. 6,941 external source links harvested. Every edge provenance-stamped. Every claim auditable.

13 QID Bridge Articles
277 Cross Edges
6,941 External Sources
305 Wikipedia Articles
13 🌲 Evergreen
174 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Coworking Commercial Space
× Financial
QID Bridge Articles
13
confirmed Wikipedia overlap
Total Cross Edges
277
External Sources Harvested
6,941
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Venture capital
score: 1.0000  ·  type: exact_title_cross  ·  47 shared tokens
QID Bridge Titles (13)
Venture capitalSmall Business AdministrationPrivate equityTreasure ValleyEagle, IdahoReal estate investment trustMergers and acquisitionsBoise, IdahoNampa, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
capitalboiseidahopopulationbusinessdevelopmentprivateadafinanceinvestmentoperationsownershipactnorthwestcanyonannualanotherentityentrepreneursfirms
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:07:12 UTC
Content Hash
e71f4ae3db856166
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
13 BRIDGES
V
Q219409 EXACT TITLE 1.000
QID OVERLAP: Q219409 in coworking_commercial_space (tier:branch) and financial (tier:evergreen). | SHARED TOKENS (47): "annual", "another", "become", "business", "capital", "complete", "decisions", "development", "employees", "entity", "entrepreneurs", "event", "exit", "face", "finance", "firms", "growth", "high", "history", "information".... | EXACT TITLE in financial: "Venture capital".
annualanotherbecomebusinesscapitalcompletedecisionsdevelopmentemployeesentityentrepreneurseventexitfacefinancefirmsgrowthhighhistoryinformationinstitutionalinvestmentinvestmentsinvestorsmarketmarketsmodeloperatingoperationsowned+17
provided by firms or funds to startup, early-stage, and emerging companies, that have been deemed to have high growth potential or that have demonstrated high growth in terms of number of employees, annual revenue, scale of operations, etc. Venture capital firms or funds invest in these early-stage companies in exchange for equity, or an ownership stake. Venture capitalists take on the risk of financing start-ups in the hopes that some of the companies they support will become successful. Because startups face high uncertainty, VC investments have high rates of failure. Start-ups are usually based on an innovative technology or business model and often come from high technology industries such as information technology (IT) or biotechnology. Pre-seed and seed rounds are the initial stages of funding for a startup company, typically occurring early in its development. During a seed round, entrepreneurs seek investment from angel investors, venture capital firms, or other sources to finance the initial operations and development of their business idea. Seed funding is often used to validate the concept, build a prototype, or conduct market research. This initial capital injection is crucial for startups to kickstart their journey and attract further investment in subsequent funding rounds. Typical venture capital investments occur after an initial "seed funding" round. The first round of institutional venture capital to fund growth is called the Series A round. Venture capitalists provide this financing in the interest of generating a return through an eventual "exit" event, such as the company selling shares to the public for the first time in an initial public offering (IPO), or disposal of shares happening via a merger, via a sale to another entity such as a financial buyer in the private equity secondary market or via a sale to a trading company such as a competitor. In addition to angel investing, equity crowdfunding and other seed funding options, venture capital is attractive for new companies with limited operating history that are too small to raise capital in the public markets and have not reached the point where they are able to secure a bank loan or complete a debt offering. In exchange for the high risk that venture capitalists assume by investing in smaller and early-stage companies, venture capitalists usually get significant control over company decisions, in addition to a significant portion of the companies' ownership (and consequently value). Privately owned companies who have reached a market valuation of over $1 billion are referred to as unicorns. As of May 2024, there were a reported total of 1248 unicorn companies.
Before World War II (1939–1945) venture capital was primarily the domain of wealthy individuals and families. J.P. Morgan, the Wallenbergs, the Vanderbilts, the Whitneys, the Rockefellers, and the Warburgs were notable investors in private companies. In 1938, Laurance S. Rockefeller helped finance the creation of both Eastern Air Lines and Douglas Aircraft, and the Rockefeller family had vast holdings in a variety of companies. Eric M. Warburg founded E.M. Warburg & Co. in 1938, which would ultimately become Warburg Pincus, with investments in both leveraged buyouts and venture capital. The Wallenberg family started Investor AB in 1916 in Sweden and were early investors in several Swedish companies such as ABB, Atlas Copco, and Ericsson in the first half of the 20th century. Only after 1945 did modern venture capital investment firms begin to emerge, notably with the founding of American Research and Development Corporation (ARDC) and J.H. Whitney & Company in 1946. Georges Doriot, the "father of venture capitalism", along with Ralph Flanders and Karl Compton (former president of MIT) founded ARDC in 1946 to encourage private-sector investment in businesses run by soldiers returning from World War II. ARDC became the first institutional private-equity investment firm to raise capital from sources other than wealthy families. Unlike most present-day venture capital firms, ARDC was a publicly traded company. ARDC's most successful investment was its 1957 funding of Digital Equipment Corporation (DEC), which would later be valued at more than $355 million after its initial public offering in 1968. This represented a return of over 1200 times its investment and an annualized rate of return of 101% to ARDC. Former employees of ARDC went on to establish several prominent venture capital firms including Greylock Partners, founded in 1965 by Charlie Waite and Bill Elfers; Morgan, Holland Ventures, the predecessor of Flagship Ventures, founded in 1982 by James Morgan; Fidelity Ventures, now Volition Capital, founded in 1969 by Henry Hoagland; and Charles River Ventures, founded in 1970 by Richard Burnes. ARDC continued investing until 1971, when Doriot retired.
One of the first steps toward a professionally managed venture capital industry was the passage of the Small Business Investment Act of 1958. The 1958 Act officially allowed the U.S. Small Business Administration (SBA) to license private "Small Business Investment Companies" (SBICs) to help the financing and management of the small entrepreneurial businesses in the United States. The Small Business Investment Act of 1958 provided tax breaks that helped contribute to the rise of private-equity firms. During the 1950s, putting a venture capital deal together may have required the help of two or three other organizations to complete the transaction. It was a business that was growing very rapidly, and as the business grew, the transactions grew exponentially. Arthur Rock, one of the pioneers of Silicon Valley during his venturing the Fairchild Semiconductor is often credited with the introduction of the term "venture capitalist" that has since become widely accepted. During the 1960s and 1970s, venture capital firms concentrated their investments mainly on launching and growing companies. These companies frequently capitalized on breakthroughs in electronic, medical, or data-processing technologies. As a result, venture capital came to be almost synonymous with financing of technology ventures. An early West Coast venture capital company was Draper and Johnson Investment Company, formed in 1962 by William Henry Draper III and Franklin P. Johnson, Jr. In 1965, Sutter Hill Ventures acquired the portfolio of Draper and Johnson as a founding action. Bill Draper and Paul Wythes were the founders, and Pitch Johnson formed Asset Management Company at that time. It was also in the 1960s that the common form of private-equity fund, still in use today, emerged. Private-equity firms organized limited partnerships to hold investments in which the investment professionals served as general partner and the investors, who were passive limited partners, put up the capital.
Small Business Administration
EXACT TITLE 1.000
QID OVERLAP: Q495354 in coworking_commercial_space (tier:evergreen) and financial (tier:evergreen). | SHARED TOKENS (33): "access", "act", "activities", "administration", "banks", "business", "businesses", "capital", "centers", "communities", "connect", "credit", "development", "directory", "economic", "economy", "entrepreneurs", "federal", "government", "independent".... | EXACT TITLE in coworking_commercial_space: "Small Business Administration".
accessactactivitiesadministrationbanksbusinessbusinessescapitalcenterscommunitiesconnectcreditdevelopmentdirectoryeconomiceconomyentrepreneursfederalgovernmentindependentjanuaryjobslenderslendingmarchofficeownerspartnersprogramprograms+3
vides a government-backed guarantee on part of the loan. Under the Recovery Act and the Small Business Jobs Act, SBA loans were enhanced to provide up to a 90 percent guarantee in order to strengthen access to capital for small businesses after credit froze in 2008. The agency had record lending volumes in late 2010. The SBA helps lead the federal government's efforts to deliver 23 percent of prime federal contracts to small businesses. Small business contracting programs include efforts to ensure that certain federal contracts reach woman-owned and service-disabled veteran-owned small businesses as well as businesses participating in programs such as the 8(a) Business Development Program and HUBZone. In March 2018 the SBA launched the SBA Franchise Directory, aiming to connect entrepreneurs to lines of credit and capital in order to grow their businesses. The SBA has at least one office in each U.S. state. In addition, the agency provides grants to support counseling partners, including approximately 900 Small Business Development Centers (often located at colleges and universities), 110 Women's Business Centers, and SCORE, a volunteer mentor corps of retired and experienced business leaders with approximately 350 chapters. These counseling services provide services to over 1 million entrepreneurs and small business owners annually.
History The SBA was created on July 30, 1953, by Republican President Eisenhower with the signing of the Small Business Act, currently codified at 15 U.S.C. ch. 14A. The Small Business Act was originally enacted as the "Small Business Act of 1953" in Title II (67 Stat. 232) of Pub. L. 83–163 (ch. 282, 67 Stat. 230, July 30, 1953); The "Reconstruction Finance Corporation Liquidation Act" was Title I, which abolished the Reconstruction Finance Corporation (RFC). The Small Business Act Amendments of 1958 (Pub. L. 85–536, 72 Stat. 384, enacted July 18, 1958) withdrew Title II as part of that act and made it a separate act to be known as the "Small Business Act". Its function was and is to "aid, counsel, assist and protect, insofar as is possible, the interests of small business concerns". The SBA has survived a number of threats to its existence. In 1996, the Republican-controlled House of Representatives planned to eliminate the agency. It survived and went on to receive a record high budget in 2000. Renewed efforts by the Bush Administration to end the SBA loan program met congressional resistance, although the SBA's budget was repeatedly cut, and in 2004 certain expenditures were frozen. The Obama administration supported SBA budgets and strengthened it through The American Recovery and Reinvestment Act of 2009. SBA budgets were further strengthened by the Small Business Jobs Act of 2010, and in 2011, President Obama announced that the SBA would double its support of rural small businesses to $350 million in the next 5 years. Organizational structure The SBA has an administrator and a deputy administrator.
SCORE, the nation's largest network of volunteer, expert business mentors, was founded in 1964 as a resource partner of the U.S. Small Business Administration. SCORE has since educated more than 10 million current and aspiring U.S. small business owners through its free mentoring and free and low-cost workshops. In 2016, SCORE's more than 10,000 volunteer mentors helped their 125,000 clients create 54,072 small businesses, adding 78,691 non-owner jobs to the U.S. economy. SCORE's core service offering is its mentoring program, through which volunteer mentors (all experienced in entrepreneurship and related areas of expertise) provide free counsel to small business clients. Mentors, operating out of 300 chapters nationwide, work with their clients to address issues related to starting and growing a business, including writing business plans, developing products, conceiving marketing strategies, hiring staff, and more. Clients access their mentors via free, ongoing face-to-face mentoring sessions or through email or video mentoring services. In addition to mentoring, SCORE also offers free and low-cost educational workshops each year, both online and in-person.
P
Q476115 EXACT TITLE 1.000
QID OVERLAP: Q476115 in coworking_commercial_space (tier:branch) and financial (tier:evergreen). | SHARED TOKENS (24): "active", "business", "capital", "changes", "development", "enterprise", "expansion", "finance", "firm", "firms", "investment", "investments", "long-term", "management", "operational", "ownership", "private", "products", "public", "rather".... | EXACT TITLE in financial: "Private equity".
activebusinesscapitalchangesdevelopmententerpriseexpansionfinancefirmfirmsinvestmentinvestmentslong-termmanagementoperationalownershipprivateproductspublicratherrolespecializedspecificventure
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in coworking_commercial_space (tier:evergreen) and financial (tier:evergreen). | SHARED TOKENS (12): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in coworking_commercial_space: "Treasure Valley". | EXACT TITLE in financial: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalregionresourcestreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Eagle, Idaho
Q1516870 EXACT TITLE 0.840
QID OVERLAP: Q1516870 in coworking_commercial_space (tier:branch) and financial (tier:evergreen). | SHARED TOKENS (7): "ada", "boise", "downtown", "eagle", "idaho", "northwest", "population". | EXACT TITLE in financial: "Eagle, Idaho".
adaboisedowntowneagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
R
Q697852 QID OVERLAP 0.800
QID OVERLAP: Q697852 in coworking_commercial_space (tier:evergreen) and financial (tier:evergreen). | SHARED TOKENS (27): "act", "assets", "capital", "centers", "commercial", "development", "estate", "finance", "global", "housing", "industry", "institutional", "investment", "investors", "main", "major", "markets", "office", "operates", "operations"....
actassetscapitalcenterscommercialdevelopmentestatefinanceglobalhousingindustryinstitutionalinvestmentinvestorsmainmajormarketsofficeoperatesoperationsownsprivaterealrecognizedresidentialtaxvalue
many types of real estate, including office and apartment buildings, studios, warehouses, hospitals, shopping centers, hotels and commercial forests. Some REITs engage in financing real estate. REITs act as a bridge from financial markets and institutional investors to housing and urban development. They are typically categorized into commercial REITs (C-REITs) and residential REITs (R-REITs), with the latter focusing on housing assets, such as apartments and single-family homes. Most countries' laws governing REITs entitle a real estate company to pay less corporation tax and capital gains tax. REITs have been criticised as enabling speculation on housing, and reducing housing affordability, without increasing finance for building. REITs can be publicly traded on major exchanges, publicly registered but non-listed, or private. The two main types of REITs are equity REITs and mortgage REITs (mREITs). In November 2014, equity REITs were recognized as a distinct asset class in the Global Industry Classification Standard by S&P Dow Jones Indices and MSCI.
FO). History Creation REITs were created in the United States after President Dwight D. Eisenhower signed Public Law 86-779, sometimes called the Cigar Excise Tax Extension of 1960. The law was enacted to allow all investors to invest in large-scale, diversified portfolios of income-producing real estate in the same way they typically invest in other asset classes – through the purchase and sale of liquid securities. The first REIT was American Realty Trust founded by Thomas J. Broyhill, cousin of Virginia U.S. Congressman Joel Broyhill in 1961 who pushed for the creation under Eisenhower. As of 2021, at least 39 countries around the world have established REITs. A comprehensive index for the REIT and the global listed property market is the FTSE EPRA/Nareit Global Real Estate Index Series, which was created jointly in October 2001 by the index provider FTSE Group, Nareit and the European Public Real Estate Association (EPRA).
Evolution Around the time of their creation in 1960, the first REITs primarily consisted of mortgage companies. The industry expanded significantly in the late 1960s and early 1970s. The growth primarily resulted from the increased use of mREITs in land development and construction deals. The Tax Reform Act of 1976 authorized REITs to be established as corporations in addition to business trusts. The Tax Reform Act of 1986 also affected REITs. The legislation included new rules designed to prevent taxpayers from using partnerships to shelter their earnings from other sources. Three years later, REITs witnessed significant losses in the stock market. Retail REIT Taubman Centers Inc. launched the modern era of REITs in 1992 with its UPREIT, in which the parties of an existing partnership and a REIT become partners in a new "operating partnership". The REIT typically is the general partner and the majority owner of the operating partnership units, and the partners who contributed properties have the right to exchange their operating partnership units for REIT shares or cash. The industry struggled during the 2008 financial crisis, after which listed REITs responded by paying off debt and re-equitizing their balance sheets by selling stock for cash. Listed REITs and REOCs raised $37.5 billion in 91 secondary equity offerings, nine IPOs and 37 unsecured debt offerings as investors continued to act favorably to companies strengthening their balance sheets following the credit crisis. REIT dividends have a 100 percent payout ratio for all income at lower rates. This inhibits the internal growth of the REIT and causes investors to not tolerate low or non-existent yields as the interest rates are more sensitive. Economic climates characterized by rising interest rates can cause a net negative effect on REIT shares. The dividends paid by REITs look less attractive when compared to bonds that have increasing coupon rates.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in coworking_commercial_space (tier:branch) and financial (tier:branch). | SHARED TOKENS (37): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "commission", "competitive", "consolidation", "corporate", "create", "department", "direct", "entities", "entity", "federal", "government", "law"....
acquisitionactactivityanotherassetsbusinesscapitalcentralcommissioncompetitiveconsolidationcorporatecreatedepartmentdirectentitiesentityfederalgovernmentlawlegalmanagementmarketoperatingoperationsownershipregulatoryrequirerequiresreview+7
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in coworking_commercial_space (tier:branch) and financial (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "downtown", "employers", "idaho", "level", "locally", "major", "population", "sectors", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownemployersidaholevellocallymajorpopulationsectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in coworking_commercial_space (tier:branch) and financial (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "idaho", "interstate", "meridian", "nampa", "northwest", "population", "university", "west", "western".
boisecanyoncollegeidahointerstatemeridiannampanorthwestpopulationuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in coworking_commercial_space (tier:evergreen) and financial (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "highway", "idaho", "largest", "local", "northwest", "population", "private".
adaboisecapitaldistricthighwayidaholargestlocalnorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in coworking_commercial_space (tier:branch) and financial (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "college", "idaho", "locally", "population", "west".
boisecanyoncollegeidaholocallypopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Education Caldwell K-12 students are split between two school districts: Caldwell School District and Vallivue School District. The Caldwell district is the smallest school district geographically in the state, at just 22 square miles. The district is bordered on the west, south and east by the much larger Vallivue district, which also encompasses the northern parts of Nampa.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in coworking_commercial_space (tier:branch) and financial (tier:branch). | SHARED TOKENS (6): "boise", "canyon", "idaho", "largest", "nampa", "population".
boisecanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in coworking_commercial_space (tier:branch) and financial (tier:branch). | SHARED TOKENS (6): "ada", "boise", "capital", "idaho", "meridian", "population".
adaboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
264 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP264 edges
🌿 BRANCH174 edges
0.500
bureaucommercialestatefirmindividualindustrialoccupationalofficeoperatingownedpersonpropertyrealreportedresidentialsharetitle
SHARED TOKENS (17): "bureau", "commercial", "estate", "firm", "individual", "industrial", "occupational", "office", "operating", "owned", "person", "property", "real", "reported", "residential", "share", "title". | EXACT TITLE in coworking_commercial_space: "Property manager".
0.500
accessactcomcommoncompletecreateentitiesgroupincreaseorganizationsphysicalrelationshipresourcesspaceteamstechnologythoughtradevaluevirtual
SHARED TOKENS (20): "access", "act", "com", "common", "complete", "create", "entities", "group", "increase", "organizations", "physical", "relationship", "resources", "space", "teams", "technology", "though", "trade", "value", "virtual". | EXACT TITLE in coworking_commercial_space: "Collaboration".
0.500
additionalagenciesassetsbankingbanksbasebeyondbusinessescommercialcommunitiescommunitydecisionsemployeesfederalgovernmentinstitutioninstitutionsinsurancelendinglocal
SHARED TOKENS (28): "additional", "agencies", "assets", "banking", "banks", "base", "beyond", "businesses", "commercial", "communities", "community", "decisions", "employees", "federal", "government", "institution", "institutions", "insurance", "lending", "local".... | EXACT TITLE in financial: "Community bank".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalboisecapitaleasterneconomygemidahojulylandlargestnationalnorthwestofficialorganizedpopulationproductssectorseparatesignificantsmall
SHARED TOKENS (26): "agricultural", "boise", "capital", "eastern", "economy", "gem", "idaho", "july", "land", "largest", "national", "northwest", "official", "organized", "population", "products", "sector", "separate", "significant", "small".... | EXACT TITLE in coworking_commercial_space: "Idaho". | EXACT TITLE in financial: "Idaho".
0.500
Accountant ↗ Q326653 EXACT TITLE
accountingconsultingcultureemployersfirmfirmsimpactindustrylargestpersonalprofessionalpublicrequiresrolesectorsignificantstatutory
SHARED TOKENS (17): "accounting", "consulting", "culture", "employers", "firm", "firms", "impact", "industry", "largest", "personal", "professional", "public", "requires", "role", "sector", "significant", "statutory". | EXACT TITLE in coworking_commercial_space: "Accountant".
0.500
bankingbankscommercialconsolidationcreditdevelopmententitiesformationframeworkinstitutioninstitutionsnationalprimarysavingsseparatesignificantstatussystems
SHARED TOKENS (18): "banking", "banks", "commercial", "consolidation", "credit", "development", "entities", "formation", "framework", "institution", "institutions", "national", "primary", "savings", "separate", "significant", "status", "systems". | EXACT TITLE in financial: "Savings bank".
0.500
bankingbanksbecomebusinessescentralcommercialcommondivisioninstitutioninvestmentlargelargerprivatepublicsector
SHARED TOKENS (15): "banking", "banks", "become", "businesses", "central", "commercial", "common", "division", "institution", "investment", "large", "larger", "private", "public", "sector". | EXACT TITLE in financial: "Commercial bank".
0.500
alongsidebeginningbusinesscapitalcommercialcompletionconstructioncostestatefirmsinfrastructuremanagementplanningprofessionalprojectsreal
SHARED TOKENS (16): "alongside", "beginning", "business", "capital", "commercial", "completion", "construction", "cost", "estate", "firms", "infrastructure", "management", "planning", "professional", "projects", "real". | EXACT TITLE in coworking_commercial_space: "Construction management".
0.500
activitiesassetsbankingbanksbrandcommercialcorporatecreditdevelopmentdivisionfirmfoundedglobalheadquarteredhistoryinstitutioninvestmentlargestlegallist
SHARED TOKENS (33): "activities", "assets", "banking", "banks", "brand", "commercial", "corporate", "credit", "development", "division", "firm", "founded", "global", "headquartered", "history", "institution", "investment", "largest", "legal", "list".... | EXACT TITLE in financial: "JPMorgan Chase".
0.500
adaboisecanyoncountiesgemidaholargerlargestmainmeridianmetronampanorthwestpopulationtotaltreasurevalley
SHARED TOKENS (17): "ada", "boise", "canyon", "counties", "gem", "idaho", "larger", "largest", "main", "meridian", "metro", "nampa", "northwest", "population", "total", "treasure", "valley". | EXACT TITLE in coworking_commercial_space: "Boise metropolitan area".
0.500
Podcast ↗ Q20899 EXACT TITLE
additionalbusinesscommercialcommunityconsumercostdedicateddigitaleventfreemodelpagepersonalplatformprimaryprogramreportedresearchresourcesrevenue
SHARED TOKENS (22): "additional", "business", "commercial", "community", "consumer", "cost", "dedicated", "digital", "event", "free", "model", "page", "personal", "platform", "primary", "program", "reported", "research", "resources", "revenue".... | EXACT TITLE in coworking_commercial_space: "Podcast".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiescommondensitydevelopeddevelopmentgovernmentgrowthindustriallandlocalplanningpolicypropertyregulatoryresidentialrulessinglesizesystemsuses
SHARED TOKENS (20): "activities", "common", "density", "developed", "development", "government", "growth", "industrial", "land", "local", "planning", "policy", "property", "regulatory", "residential", "rules", "single", "size", "systems", "uses". | EXACT TITLE in coworking_commercial_space: "Zoning".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
accessacquisitionbecomebeyondbusinesscapitalcreatedevelopmentemployersentrepreneurseventsfirmsgloballyinformationlargestlinkedinlistlistingsmembersnetwork
SHARED TOKENS (32): "access", "acquisition", "become", "beyond", "business", "capital", "create", "development", "employers", "entrepreneurs", "events", "firms", "globally", "information", "largest", "linkedin", "list", "listings", "members", "network".... | EXACT TITLE in coworking_commercial_space: "LinkedIn". | EXACT TITLE in financial: "LinkedIn".
0.500
Landlord ↗ Q618532 EXACT TITLE
businesseconomyestateincomeindividuallandlicensednaturalownersownspersonpropertyrealresourcestenantterms
SHARED TOKENS (16): "business", "economy", "estate", "income", "individual", "land", "licensed", "natural", "owners", "owns", "person", "property", "real", "resources", "tenant", "terms". | EXACT TITLE in coworking_commercial_space: "Landlord".
0.500
acquiredacquisitionactivitiesassetsbankingbrokeragebrokersbusinesscenterclientcompletedcomplexcontinuingdirectlydivisionedgefirmfirmsglobalheadquartered
SHARED TOKENS (28): "acquired", "acquisition", "activities", "assets", "banking", "brokerage", "brokers", "business", "center", "client", "completed", "complex", "continuing", "directly", "division", "edge", "firm", "firms", "global", "headquartered".... | EXACT TITLE in financial: "Merrill (company)".
0.500
agriculturalbankingcommercialcommoncommunityconstructionconsumerestatefederalglobalheadquarteredidahoinsurancemarketmemberofficesownedrealresidential
SHARED TOKENS (19): "agricultural", "banking", "commercial", "common", "community", "construction", "consumer", "estate", "federal", "global", "headquartered", "idaho", "insurance", "market", "member", "offices", "owned", "real", "residential". | EXACT TITLE in financial: "Banner Bank".
0.500
accessibleactivitiesbusinesscentercentralcommercialcommonconcentrationdevelopmentdistrictdowntownhistoryindustrialinternationallargelargerlargestlimitsmultipleoffices
SHARED TOKENS (24): "accessible", "activities", "business", "center", "central", "commercial", "common", "concentration", "development", "district", "downtown", "history", "industrial", "international", "large", "larger", "largest", "limits", "multiple", "offices".... | EXACT TITLE in coworking_commercial_space: "Central business district".
0.500
Entrepreneurship ↗ EXACT TITLE
activitiesbusinessbusinessescentralcreatecreateseconomicenterpriseentityentrepreneursfirmsindividualinnovationoperatingproductsrequiressmallstartupsvalueventure
SHARED TOKENS (20): "activities", "business", "businesses", "central", "create", "creates", "economic", "enterprise", "entity", "entrepreneurs", "firms", "individual", "innovation", "operating", "products", "requires", "small", "startups", "value", "venture". | EXACT TITLE in coworking_commercial_space: "Entrepreneurship".
0.500
Audit ↗ Q181487 EXACT TITLE
corporatedocumententitiesentityfreeimproveindependentinformationlawlegalmanagementpersonpublicreportrequiredsizethird-partyview
SHARED TOKENS (18): "corporate", "document", "entities", "entity", "free", "improve", "independent", "information", "law", "legal", "management", "person", "public", "report", "required", "size", "third-party", "view". | EXACT TITLE in financial: "Audit".
0.500
addedassetsbankingbanksbusinessescommercialconsumercorporatecreditinstitutioninstitutionslendingmembermembersoperationspublicsavingssharesizesmall
SHARED TOKENS (23): "added", "assets", "banking", "banks", "businesses", "commercial", "consumer", "corporate", "credit", "institution", "institutions", "lending", "member", "members", "operations", "public", "savings", "share", "size", "small".... | EXACT TITLE in financial: "Credit union".
0.500
actassociationauthoritycentralchangescommunitiescommunitycomprehensivecreatingdevelopmenteconomicfacilitiesfoundedhealthlandnaturalphysicalplanplanningregional
SHARED TOKENS (24): "act", "association", "authority", "central", "changes", "communities", "community", "comprehensive", "creating", "development", "economic", "facilities", "founded", "health", "land", "natural", "physical", "plan", "planning", "regional".... | EXACT TITLE in coworking_commercial_space: "Land-use planning".
0.500
anotherbankingcommoncontextcorporatecrediteconomicfinancefreemanagementminimummonthlymultiplepersonalprimaryrateratestaxterms
SHARED TOKENS (19): "another", "banking", "common", "context", "corporate", "credit", "economic", "finance", "free", "management", "minimum", "monthly", "multiple", "personal", "primary", "rate", "rates", "tax", "terms". | EXACT TITLE in financial: "Refinancing".
0.500
actadministrationchaptercodeemployeesemployersenvironmentfederalfreegovernmenthealthlawmainnationaloccupationalprivaterecognizedsectorsignedtitle
SHARED TOKENS (20): "act", "administration", "chapter", "code", "employees", "employers", "environment", "federal", "free", "government", "health", "law", "main", "national", "occupational", "private", "recognized", "sector", "signed", "title". | EXACT TITLE in coworking_commercial_space: "Occupational Safety and Health Act (United States)".
0.500
Wells Fargo ↗ Q744149 EXACT TITLE
acquisitionadditionalalongsideassetsbankingbanksbasebusinessequipmentfallsfederalgrowinginstitutioninternationalinvestmentjunelargestlistmainmajor
SHARED TOKENS (31): "acquisition", "additional", "alongside", "assets", "banking", "banks", "base", "business", "equipment", "falls", "federal", "growing", "institution", "international", "investment", "june", "largest", "list", "main", "major".... | EXACT TITLE in financial: "Wells Fargo".
0.500
bankingbusinessbusinessescommercialcommunityconsumerentitiesestateheadquarteredidahoorganizationspersonalproductspublicrealregionalsmallutah
SHARED TOKENS (18): "banking", "business", "businesses", "commercial", "community", "consumer", "entities", "estate", "headquartered", "idaho", "organizations", "personal", "products", "public", "real", "regional", "small", "utah". | EXACT TITLE in financial: "Glacier Bancorp".
0.500
Coworking ↗ Q869457 EXACT TITLE
commoncostdigitalequipmentimpactindependentmajormembershipofficeofficesparcelsavingssharespacetravel
SHARED TOKENS (15): "common", "cost", "digital", "equipment", "impact", "independent", "major", "membership", "office", "offices", "parcel", "savings", "share", "space", "travel". | EXACT TITLE in coworking_commercial_space: "Coworking".
0.500
businesscommercialcoveredestatefireindependentinstitutionalinsurancelandlargelawlegallendersownershippolicypropertiespropertyraterealrequire
SHARED TOKENS (28): "business", "commercial", "covered", "estate", "fire", "independent", "institutional", "insurance", "land", "large", "law", "legal", "lenders", "ownership", "policy", "properties", "property", "rate", "real", "require".... | EXACT TITLE in financial: "Title insurance".
0.500
SBA 504 Loan ↗ EXACT TITLE
actadministrationassetsbusinessbusinessescapitaldevelopmenteconomicestatefixedgrowinggrowthinvestmentlocalmarketminimumpolicyprivateprogramprograms
SHARED TOKENS (26): "act", "administration", "assets", "business", "businesses", "capital", "development", "economic", "estate", "fixed", "growing", "growth", "investment", "local", "market", "minimum", "policy", "private", "program", "programs".... | EXACT TITLE in financial: "SBA 504 Loan".
0.500
activitiesassetsbusinesscapitaldevelopmenteconomiceconomyfoundedgrowthincreasedinformationinnovationnaturalorganizationsphysicalprimarypropertyresourcesrolevalue
SHARED TOKENS (20): "activities", "assets", "business", "capital", "development", "economic", "economy", "founded", "growth", "increased", "information", "innovation", "natural", "organizations", "physical", "primary", "property", "resources", "role", "value". | EXACT TITLE in coworking_commercial_space: "Knowledge economy".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialentityestategovernmentgrowinghousinglandlawlegalnaturalownedownershippersonpersonalprivatepropertypublicreal
SHARED TOKENS (24): "acquisition", "business", "commercial", "entity", "estate", "government", "growing", "housing", "land", "law", "legal", "natural", "owned", "ownership", "person", "personal", "private", "property", "public", "real".... | EXACT TITLE in coworking_commercial_space: "Real estate". | EXACT TITLE in financial: "Real estate".
0.500
accountingbusinessbusinessesdevelopmenteducationmanagementprofessionalpublicrequiresectorsectorsspecificsupportsupportingtaxtraining
SHARED TOKENS (16): "accounting", "business", "businesses", "development", "education", "management", "professional", "public", "require", "sector", "sectors", "specific", "support", "supporting", "tax", "training". | EXACT TITLE in financial: "Professional services".
0.500
accessanothercloudcommonconferencedevelopeddowntownemployeesemployerslargenetworkofficeofficesrapidrathersmallsoftwarespacetechnology
SHARED TOKENS (19): "access", "another", "cloud", "common", "conference", "developed", "downtown", "employees", "employers", "large", "network", "office", "offices", "rapid", "rather", "small", "software", "space", "technology". | EXACT TITLE in coworking_commercial_space: "Remote work".
0.500
Insurance ↗ Q43183 EXACT TITLE
anothercoveredentityeventhealthinsurancelargemanagementownershippersonpolicyprimaryrelationshiprequiredsmalltermstransaction
SHARED TOKENS (17): "another", "covered", "entity", "event", "health", "insurance", "large", "management", "ownership", "person", "policy", "primary", "relationship", "required", "small", "terms", "transaction". | EXACT TITLE in coworking_commercial_space: "Insurance". | EXACT TITLE in financial: "Insurance".
0.500
VA loan ↗ Q7906577 EXACT TITLE
additionalconstructioncreditdepartmentdirectlyincomeinsurancelargerlenderslimitmembersminimummonthlyprivateprogrampropertiespropertyraterulessales
SHARED TOKENS (23): "additional", "construction", "credit", "department", "directly", "income", "insurance", "larger", "lenders", "limit", "members", "minimum", "monthly", "private", "program", "properties", "property", "rate", "rules", "sales".... | EXACT TITLE in financial: "VA loan".
0.500
commercialcompletedconstructiondevelopmententertainmentinstitutionalmultipleplanningpolicyprivateprojectsresidentialsinglesitespaceuses
SHARED TOKENS (16): "commercial", "completed", "construction", "development", "entertainment", "institutional", "multiple", "planning", "policy", "private", "projects", "residential", "single", "site", "space", "uses". | EXACT TITLE in coworking_commercial_space: "Mixed-use development".
0.500
activityboisebusinesscollegecompeteconferencedivisioneducationfoundedhealthhighidahoindependentinstitutionmemberprogramprogramspublicreportedresearch
SHARED TOKENS (24): "activity", "boise", "business", "college", "compete", "conference", "division", "education", "founded", "health", "high", "idaho", "independent", "institution", "member", "program", "programs", "public", "reported", "research".... | EXACT TITLE in coworking_commercial_space: "Boise State University". | EXACT TITLE in financial: "Boise State University".
0.500
Retail ↗ Q126793 EXACT TITLE
accessalongsidebroaderbusinesscenterchaincreditdecisionsdigitaldirectlyemployeesfinalfirmshistoryhoursinstitutionallargelevelmanagementmarket
SHARED TOKENS (34): "access", "alongside", "broader", "business", "center", "chain", "credit", "decisions", "digital", "directly", "employees", "final", "firms", "history", "hours", "institutional", "large", "level", "management", "market".... | EXACT TITLE in coworking_commercial_space: "Retail".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
bankingbusinessbusinessescapitalcommercialcreditdemanddevelopeddirectlyestateeventfullinstitutioninvestmentinvestorslawlegalmarketsownersownership
SHARED TOKENS (33): "banking", "business", "businesses", "capital", "commercial", "credit", "demand", "developed", "directly", "estate", "event", "full", "institution", "investment", "investors", "law", "legal", "markets", "owners", "ownership".... | EXACT TITLE in financial: "Mortgage".
0.500
Finance ↗ EXACT TITLE
accountingactivitiesadministrationassetsbankingbusinessbusinessescorporatecoveredentitiesentityfinancefoundationglobalhistoryincomeinvestmentinvestmentslawlevel
SHARED TOKENS (30): "accounting", "activities", "administration", "assets", "banking", "business", "businesses", "corporate", "covered", "entities", "entity", "finance", "foundation", "global", "history", "income", "investment", "investments", "law", "level".... | EXACT TITLE in coworking_commercial_space: "Finance". | EXACT TITLE in financial: "Finance".
0.500
administrationagenciesassetsbankscentralcommercialcommunitycreditdevelopmentfederalfullgovernmentindependentinstitutionsinsurancenationaloperatesoperatingoperationssavings
SHARED TOKENS (22): "administration", "agencies", "assets", "banks", "central", "commercial", "community", "credit", "development", "federal", "full", "government", "independent", "institutions", "insurance", "national", "operates", "operating", "operations", "savings".... | EXACT TITLE in financial: "National Credit Union Administration".
0.500
additionalbecomeconstructionenvironmentfacilitieshealthindependentinfrastructurelandoperatingpersonplanningprojectspublicrecognizedsystems
SHARED TOKENS (16): "additional", "become", "construction", "environment", "facilities", "health", "independent", "infrastructure", "land", "operating", "person", "planning", "projects", "public", "recognized", "systems". | EXACT TITLE in coworking_commercial_space: "Civil engineer".
0.500
businessbusinessescapitalentrepreneursfoundersgrowinghighincreasedindividualinvestmentinvestorsownershipportfolioprivatesharesmallstartupssupportventure
SHARED TOKENS (19): "business", "businesses", "capital", "entrepreneurs", "founders", "growing", "high", "increased", "individual", "investment", "investors", "ownership", "portfolio", "private", "share", "small", "startups", "support", "venture". | EXACT TITLE in financial: "Angel investor".
0.500
activitycommunitiescompetitivecreatingculturedigitalemployeesincentivesindividualinformationinnovationmajormanagementorganizationsrecognizedshareteamstechnologytool
SHARED TOKENS (19): "activity", "communities", "competitive", "creating", "culture", "digital", "employees", "incentives", "individual", "information", "innovation", "major", "management", "organizations", "recognized", "share", "teams", "technology", "tool". | EXACT TITLE in coworking_commercial_space: "Knowledge sharing".
0.500
accountingactadministrationannualassetsbusinessbusinessesemployeesgovernmentindustrylargemedicaloperationsorganizationspolicyprogramsregulatoryrequirerevenuesales
SHARED TOKENS (27): "accounting", "act", "administration", "annual", "assets", "business", "businesses", "employees", "government", "industry", "large", "medical", "operations", "organizations", "policy", "programs", "regulatory", "require", "revenue", "sales".... | EXACT TITLE in coworking_commercial_space: "Small business". | EXACT TITLE in financial: "Small business".
0.500
acquiredacquisitionadministrationagreementassetsbusinesscapitalcommercialequipmentestateincomeindustrialinformationlandmanagementpersonalphysicalprofessionalpropertypublic
SHARED TOKENS (29): "acquired", "acquisition", "administration", "agreement", "assets", "business", "capital", "commercial", "equipment", "estate", "income", "industrial", "information", "land", "management", "personal", "physical", "professional", "property", "public".... | EXACT TITLE in coworking_commercial_space: "Property management". | EXACT TITLE in financial: "Property management".
0.500
Franchising ↗ Q171947 EXACT TITLE
agreementanotherbrandbusinesscapitalchaincompetecorporatedirecteconomicentityexpansiongrowthindividualinvestmentlargelegallicensingmarketmodel
SHARED TOKENS (29): "agreement", "another", "brand", "business", "capital", "chain", "compete", "corporate", "direct", "economic", "entity", "expansion", "growth", "individual", "investment", "large", "legal", "licensing", "market", "model".... | EXACT TITLE in coworking_commercial_space: "Franchising".
0.500
accessacquisitionadditionalassetsbusinesscapitaldevelopmentequipmenteventexpansionfinancegrowinggrowthinvestmentinvestmentsinvestorsmajormarketsoperationsownership
SHARED TOKENS (26): "access", "acquisition", "additional", "assets", "business", "capital", "development", "equipment", "event", "expansion", "finance", "growing", "growth", "investment", "investments", "investors", "major", "markets", "operations", "ownership".... | EXACT TITLE in financial: "Growth capital".
0.500
adaboisecampuscanyoncollegecommunitycomprehensivecountiescreditcwidevelopmenteasterneducationidaholargenampapopulationprimaryprogramspublic
SHARED TOKENS (28): "ada", "boise", "campus", "canyon", "college", "community", "comprehensive", "counties", "credit", "cwi", "development", "eastern", "education", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in coworking_commercial_space: "College of Western Idaho".
0.500
Fiduciary ↗ Q537098 EXACT TITLE
actanotherassetscommoncorporatedepartmentgroupinvestmentlawlegallevelpersonpersonalplansratherrelationshiprequiresservingstatutes
SHARED TOKENS (19): "act", "another", "assets", "common", "corporate", "department", "group", "investment", "law", "legal", "level", "person", "personal", "plans", "rather", "relationship", "requires", "serving", "statutes". | EXACT TITLE in financial: "Fiduciary".
0.500
acquiredacquisitionactivitiesanotherassetsbankingbuiltbusinesscentercenterscommercialcommunityconsumercorporateeconomicfederalfoundedglobalgrowthheadquartered
SHARED TOKENS (43): "acquired", "acquisition", "activities", "another", "assets", "banking", "built", "business", "center", "centers", "commercial", "community", "consumer", "corporate", "economic", "federal", "founded", "global", "growth", "headquartered".... | EXACT TITLE in financial: "Bank of America".
0.500
businesscapitalcreatedirectentityfirmgrowthinvestmentsinvestorsmarketportfolioprivateproductsstartupventure
SHARED TOKENS (15): "business", "capital", "create", "direct", "entity", "firm", "growth", "investments", "investors", "market", "portfolio", "private", "products", "startup", "venture". | EXACT TITLE in financial: "Portfolio company".
0.500
LoopNet ↗ Q6675775 EXACT TITLE
acquiredbrokersbusinesscommercialcomprehensivedevelopmentdigitaldirectlyeconomicestatefoundedgroupindustryinformationlistingsloopnetmarketplacemonthlymultipleoperates
SHARED TOKENS (30): "acquired", "brokers", "business", "commercial", "comprehensive", "development", "digital", "directly", "economic", "estate", "founded", "group", "industry", "information", "listings", "loopnet", "marketplace", "monthly", "multiple", "operates".... | EXACT TITLE in coworking_commercial_space: "LoopNet". | EXACT TITLE in financial: "LoopNet".
0.500
actagentsapprovalapprovalscommercialconstructioncontextcreatesdevelopmenteconomicestategrowthhousingincreasejobslandplanningplansprogramprojects
SHARED TOKENS (27): "act", "agents", "approval", "approvals", "commercial", "construction", "context", "creates", "development", "economic", "estate", "growth", "housing", "increase", "jobs", "land", "planning", "plans", "program", "projects".... | EXACT TITLE in financial: "Real estate development".
0.500
authoritybusinesscapitalcenterscommercialestatehousingincomeinvestmentlandlocalmedicalmultipleofficeofficespropertyrealrentalresidentialsignificant
SHARED TOKENS (22): "authority", "business", "capital", "centers", "commercial", "estate", "housing", "income", "investment", "land", "local", "medical", "multiple", "office", "offices", "property", "real", "rental", "residential", "significant".... | EXACT TITLE in coworking_commercial_space: "Commercial property".
0.480
adjacentassetscentralcreditdepartmentfinanceheadquarteredidaholargestmemberspocatelloservingunionwestern
SHARED TOKENS (14): "adjacent", "assets", "central", "credit", "department", "finance", "headquartered", "idaho", "largest", "members", "pocatello", "serving", "union", "western". | EXACT TITLE in financial: "Idaho Central Credit Union".
0.480
administrationcollegecrediteducationenrollmentfoundedidahomajormedicalpreviouslyprivateprofessionalprogramsstudents
SHARED TOKENS (14): "administration", "college", "credit", "education", "enrollment", "founded", "idaho", "major", "medical", "previously", "private", "professional", "programs", "students". | EXACT TITLE in coworking_commercial_space: "College of Idaho".
0.480
assetsbusinesscapitalentitiesentityequipmentexpensesfirmfixedmanagementoperatingoperationaloperationsrequired
SHARED TOKENS (14): "assets", "business", "capital", "entities", "entity", "equipment", "expenses", "firm", "fixed", "management", "operating", "operational", "operations", "required". | EXACT TITLE in financial: "Working capital".
0.480
Downtown ↗ Q1050303 EXACT TITLE
businesscentercentralcommercialculturedistrictdowntownentertainmenthistoricaljobsofficepopulationpublicsmall
SHARED TOKENS (14): "business", "center", "central", "commercial", "culture", "district", "downtown", "entertainment", "historical", "jobs", "office", "population", "public", "small". | EXACT TITLE in coworking_commercial_space: "Downtown". | EXACT TITLE in financial: "Downtown".
0.460
activitiesbuiltconstructiondevelopmenteconomicfacilitiesglobalimproveindustrialindustryinfrastructureplanningproducts
SHARED TOKENS (13): "activities", "built", "construction", "development", "economic", "facilities", "global", "improve", "industrial", "industry", "infrastructure", "planning", "products". | EXACT TITLE in coworking_commercial_space: "Construction". | EXACT TITLE in financial: "Construction".
0.460
Lease ↗ Q716894 EXACT TITLE
agreementassetsbusinesscommonequipmentindustriallandlegalpersonpersonalprogrampropertyrental
SHARED TOKENS (13): "agreement", "assets", "business", "common", "equipment", "industrial", "land", "legal", "person", "personal", "program", "property", "rental". | EXACT TITLE in coworking_commercial_space: "Lease". | EXACT TITLE in financial: "Lease".
0.460
Allstate ↗ EXACT TITLE
foundedheadquarteredindependentinsurancejunelargelargestlistoperationsownedpersonalrevenuetotal
SHARED TOKENS (13): "founded", "headquartered", "independent", "insurance", "june", "large", "largest", "list", "operations", "owned", "personal", "revenue", "total". | EXACT TITLE in financial: "Allstate".
0.440
Innovation ↗ Q174165 EXACT TITLE
businesscommondevelopmententityimpactimprovementinnovationmarketmarketsproductsrequirevalue
SHARED TOKENS (12): "business", "common", "development", "entity", "impact", "improvement", "innovation", "market", "markets", "products", "require", "value". | EXACT TITLE in coworking_commercial_space: "Innovation". | EXACT TITLE in financial: "Innovation".
0.440
actbusinesscompetitivecorporateeventincubatorslargerprogramspublicspecificstartupstartups
SHARED TOKENS (12): "act", "business", "competitive", "corporate", "event", "incubators", "larger", "programs", "public", "specific", "startup", "startups". | EXACT TITLE in financial: "Startup accelerator".
0.440
bankingfederalgovernmentmembermultiplenationalofficeoperatesoperatingprivateregulatoryrequired
SHARED TOKENS (12): "banking", "federal", "government", "member", "multiple", "national", "office", "operates", "operating", "private", "regulatory", "required". | EXACT TITLE in financial: "National bank (United States)".
0.420
accessactdigitalinformationjobsmodelorganizationsphysicalpolicyrequiresignificant
SHARED TOKENS (11): "access", "act", "digital", "information", "jobs", "model", "organizations", "physical", "policy", "require", "significant". | EXACT TITLE in coworking_commercial_space: "Access control".
0.420
agentsbrokerbrokersclosingestatelicensedpropertyrealrequiredsalestransactions
SHARED TOKENS (11): "agents", "broker", "brokers", "closing", "estate", "licensed", "property", "real", "required", "sales", "transactions". | EXACT TITLE in financial: "Real estate agent".
0.400
constructiondevelopmentenvironmentmanagementplanningplansprojectsresearchsitespace
SHARED TOKENS (10): "construction", "development", "environment", "management", "planning", "plans", "projects", "research", "site", "space". | EXACT TITLE in coworking_commercial_space: "Interior design".
0.400
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadigitalhighlevelnetworktechnologyuseswireless
SHARED TOKENS (10): "access", "context", "data", "digital", "high", "level", "network", "technology", "uses", "wireless". | EXACT TITLE in coworking_commercial_space: "Broadband".
0.400
brokerbrokersclientcompensationinsuranceinternationallargestmultiplerevenuespecific
SHARED TOKENS (10): "broker", "brokers", "client", "compensation", "insurance", "international", "largest", "multiple", "revenue", "specific". | EXACT TITLE in financial: "Insurance broker".
0.400
accountingacquisitionbusinessconsolidationcontextentitiesentitygrouplargertax
SHARED TOKENS (10): "accounting", "acquisition", "business", "consolidation", "context", "entities", "entity", "group", "larger", "tax". | EXACT TITLE in coworking_commercial_space: "Consolidation (business)". | EXACT TITLE in financial: "Consolidation (business)".
0.380
commercialheadquarteredhealthinsuranceinvestmentprivateproductspropertyreported
SHARED TOKENS (9): "commercial", "headquartered", "health", "insurance", "investment", "private", "products", "property", "reported". | EXACT TITLE in financial: "American Family Insurance".
0.380
Deal flow ↗ Q5245854 EXACT TITLE
businessfinancehighinvestmentinvestorsprivateraterevenueventure
SHARED TOKENS (9): "business", "finance", "high", "investment", "investors", "private", "rate", "revenue", "venture". | EXACT TITLE in financial: "Deal flow".
0.380
accountingbusinessbusinessescompeteconcentrationgloballyincreaseinstitutionsmanagement
SHARED TOKENS (9): "accounting", "business", "businesses", "compete", "concentration", "globally", "increase", "institutions", "management". | EXACT TITLE in coworking_commercial_space: "Business cluster".
0.380
annualestateincomeinvestmentsmarketraterealrentalvalue
SHARED TOKENS (9): "annual", "estate", "income", "investments", "market", "rate", "real", "rental", "value". | EXACT TITLE in coworking_commercial_space: "Capitalization rate".
0.360
Escrow ↗ Q338451 EXACT TITLE
brokercompletedescrowinsurancepersonprimarypropertytransaction
SHARED TOKENS (8): "broker", "completed", "escrow", "insurance", "person", "primary", "property", "transaction". | EXACT TITLE in coworking_commercial_space: "Escrow". | EXACT TITLE in financial: "Escrow".
0.360
Workplace ↗ Q628858 EXACT TITLE
centraldevelopmentemployerentitieslargeofficephysicalvirtual
SHARED TOKENS (8): "central", "development", "employer", "entities", "large", "office", "physical", "virtual". | EXACT TITLE in coworking_commercial_space: "Workplace".
0.360
Architecture ↗ Q12271 EXACT TITLE
constructionculturedevelopedeconomichistoricallocalplanningwritten
SHARED TOKENS (8): "construction", "culture", "developed", "economic", "historical", "local", "planning", "written". | EXACT TITLE in coworking_commercial_space: "Architecture".
0.360
Sales tax ↗ Q11055488 EXACT TITLE
bodyconsumerdirectlyeducationfoodsalessellertax
SHARED TOKENS (8): "body", "consumer", "directly", "education", "food", "sales", "seller", "tax". | EXACT TITLE in financial: "Sales tax".
0.360
State Farm ↗ Q2007336 EXACT TITLE
corporatefoundedgroupheadquartersinsurancelargestpropertythroughout
SHARED TOKENS (8): "corporate", "founded", "group", "headquarters", "insurance", "largest", "property", "throughout". | EXACT TITLE in financial: "State Farm".
0.360
acquisitioncredithistorylimitlimitsscoresinglesize
SHARED TOKENS (8): "acquisition", "credit", "history", "limit", "limits", "score", "single", "size". | EXACT TITLE in financial: "Conforming loan".
0.360
Shared space ↗ EXACT TITLE
creatinglevelratesresidentialseparatespacetravelusers
SHARED TOKENS (8): "creating", "level", "rates", "residential", "separate", "space", "travel", "users". | EXACT TITLE in coworking_commercial_space: "Shared space".
0.340
completeemployerlevelprofessionalsectorstradetraining
SHARED TOKENS (7): "complete", "employer", "level", "professional", "sectors", "trade", "training". | EXACT TITLE in coworking_commercial_space: "Apprenticeship".
0.320
KeyBank ↗ Q1740314 EXACT TITLE
headquarteredlargestnorthwestoperatesregionalutah
SHARED TOKENS (6): "headquartered", "largest", "northwest", "operates", "regional", "utah". | EXACT TITLE in financial: "KeyBank".
0.320
groupindexinternationalmarkofficeoffices
SHARED TOKENS (6): "group", "index", "international", "mark", "office", "offices". | EXACT TITLE in coworking_commercial_space: "International Workplace Group".
0.300
accountingactiveanotherbureaucollegecontinuingdemandeducationfirmsgrowinggrowthlicensinglicensuremembersminimumpersonprofessionalpublicrequiredstatus
SHARED TOKENS (21): "accounting", "active", "another", "bureau", "college", "continuing", "demand", "education", "firms", "growing", "growth", "licensing", "licensure", "members", "minimum", "person", "professional", "public", "required", "status"....
0.300
bankingbanksbecomebrokerbrokersbusinessescompetitiveconsumercreditdevelopeddirectestatefinanceindividualinstitutionslargestlenderslendingmarketsproducts
SHARED TOKENS (24): "banking", "banks", "become", "broker", "brokers", "businesses", "competitive", "consumer", "credit", "developed", "direct", "estate", "finance", "individual", "institutions", "largest", "lenders", "lending", "markets", "products"....
0.300
activityagentsassetsbanksbroaderbusinessbusinessesclientcomprehensivecorporatedetailedentitiesforceglobalidentityindustryinformationinstitutioninstitutionslaw
SHARED TOKENS (29): "activity", "agents", "assets", "banks", "broader", "business", "businesses", "client", "comprehensive", "corporate", "detailed", "entities", "force", "global", "identity", "industry", "information", "institution", "institutions", "law"....
0.300
administrationagentsassistancebusinessescommercialcompensationcompletecreatingelectronicentitiesfederalfreeincomeindividuallicensedlicensingpublicrevenuesoftwaretax
SHARED TOKENS (20): "administration", "agents", "assistance", "businesses", "commercial", "compensation", "complete", "creating", "electronic", "entities", "federal", "free", "income", "individual", "licensed", "licensing", "public", "revenue", "software", "tax".
0.300
actadministrationbankingbankscommonconsumercreditdocumentfederalfixedinstitutioninstitutionsinsurancelargerminimumnationalratesrequiresavingsshare
SHARED TOKENS (22): "act", "administration", "banking", "banks", "common", "consumer", "credit", "document", "federal", "fixed", "institution", "institutions", "insurance", "larger", "minimum", "national", "rates", "require", "savings", "share"....
0.300
Shopping center ↗ Q11315 KW CROSS HIGH
addedadjacentbuiltcentercenterscommercialcommoncomplexconcentrationcovereddepartmentdowntowneasternentertainmentgrouphighlargelargermarketsowners
SHARED TOKENS (26): "added", "adjacent", "built", "center", "centers", "commercial", "common", "complex", "concentration", "covered", "department", "downtown", "eastern", "entertainment", "group", "high", "large", "larger", "markets", "owners"....
0.300
codescommercialcommonconstructioncostdirectlyequipmentfacilitiesoperatingplanningregulatoryresearchresidentialrolespacespecializedsystemsteam
SHARED TOKENS (18): "codes", "commercial", "common", "construction", "cost", "directly", "equipment", "facilities", "operating", "planning", "regulatory", "research", "residential", "role", "space", "specialized", "systems", "team".
0.300
Life insurance ↗ Q626608 KW CROSS HIGH
capitalcommoneventeventsexpensesgrowthindustryinsuranceinvestmentlegallimitmainmajormedicalpersonphysicalpolicyproductssinglespecific
SHARED TOKENS (22): "capital", "common", "event", "events", "expenses", "growth", "industry", "insurance", "investment", "legal", "limit", "main", "major", "medical", "person", "physical", "policy", "products", "single", "specific"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
becomecommercialdensitydevelopmentenvironmentexpansiongrowthhousingincreasedindustrialinfrastructurejobslandlargeplanningpopulationprivatepropertyrapidrates
SHARED TOKENS (28): "become", "commercial", "density", "development", "environment", "expansion", "growth", "housing", "increased", "industrial", "infrastructure", "jobs", "land", "large", "planning", "population", "private", "property", "rapid", "rates"....
0.300
accessactivitiesadditionalbusinessbusinessescapitalcloudconferencecostcreatedigitalemployeesemployersentrepreneursenvironmentexpensesindustrylargerlong-termmanagement
SHARED TOKENS (40): "access", "activities", "additional", "business", "businesses", "capital", "cloud", "conference", "cost", "create", "digital", "employees", "employers", "entrepreneurs", "environment", "expenses", "industry", "larger", "long-term", "management"....
0.300
assetscommercialcomplexentityestatefixedinvestmentlawlevelpropertyrateratherrealresidentialtaxtransactions
SHARED TOKENS (16): "assets", "commercial", "complex", "entity", "estate", "fixed", "investment", "law", "level", "property", "rate", "rather", "real", "residential", "tax", "transactions".
0.300
Inflation ↗ Q35865 KW CROSS HIGH
bankscentralchangescommonconsumercostdemandeconomiceconomyhighincreaseindexinvestmentlevelmarketoperationspolicyrapidraterates
SHARED TOKENS (24): "banks", "central", "changes", "common", "consumer", "cost", "demand", "economic", "economy", "high", "increase", "index", "investment", "level", "market", "operations", "policy", "rapid", "rate", "rates"....
0.300
bankscenterclosingcommercialcomplexindustrialinsurancejuneofficepropertyratereportsreviewtermsthird-party
SHARED TOKENS (15): "banks", "center", "closing", "commercial", "complex", "industrial", "insurance", "june", "office", "property", "rate", "reports", "review", "terms", "third-party".
0.300
accountingannualcapitalconsumereconomiceconomygrowthincomeincreaseincreasedinnovationlevelmarketnationalphysicalpopulationraterealusesvalue
SHARED TOKENS (20): "accounting", "annual", "capital", "consumer", "economic", "economy", "growth", "income", "increase", "increased", "innovation", "level", "market", "national", "physical", "population", "rate", "real", "uses", "value".
0.300
assetsbankingbanksbrokeragededicatedhighincomeinstitutionsinvestmentmanagementpersonalprivaterelationshipservingsinglesubstantialtax
SHARED TOKENS (17): "assets", "banking", "banks", "brokerage", "dedicated", "high", "income", "institutions", "investment", "management", "personal", "private", "relationship", "serving", "single", "substantial", "tax".
0.300
basechangescommoncostcreditdirectfallsfederalfixedgovernmentindexlendersmarketmarketsrateratesratherrealspecific
SHARED TOKENS (19): "base", "changes", "common", "cost", "credit", "direct", "falls", "federal", "fixed", "government", "index", "lenders", "market", "markets", "rate", "rates", "rather", "real", "specific".
0.300
Bond market ↗ Q540626 KW CROSS HIGH
actassociationauthoritycentralchangescorporatecostcreditfullglobalgovernmentindustryinstitutionsinvestorslargemarketmarketsprimaryprivatepublic
SHARED TOKENS (29): "act", "association", "authority", "central", "changes", "corporate", "cost", "credit", "full", "global", "government", "industry", "institutions", "investors", "large", "market", "markets", "primary", "private", "public"....
0.300
bodybrandbusinessclientcorporatedevelopmentemergencyenvironmenteventeventsindustrymanagementmarketorganizationspersonpersonalplanningplanspublicrelationships
SHARED TOKENS (24): "body", "brand", "business", "client", "corporate", "development", "emergency", "environment", "event", "events", "industry", "management", "market", "organizations", "person", "personal", "planning", "plans", "public", "relationships"....
0.300
associationauthoritybrokeragecommissionfederalfirmsgovernmentindustrymarketsmembernationaloperationsprivateregulationregulatory
SHARED TOKENS (15): "association", "authority", "brokerage", "commission", "federal", "firms", "government", "industry", "markets", "member", "national", "operations", "private", "regulation", "regulatory".
0.300
assetscapitaldecisionsdevelopmentestateexpensesfixedimproveincomeincreaseinvestmentinvestmentsinvestorslenderslong-termmanagementmarketoperatingprimaryprojects
SHARED TOKENS (29): "assets", "capital", "decisions", "development", "estate", "expenses", "fixed", "improve", "income", "increase", "investment", "investments", "investors", "lenders", "long-term", "management", "market", "operating", "primary", "projects"....
0.300
actbusinesscapitalcodecommonestateinvestmentinvestorsjobslawlong-termownerspersonalpropertiespropertyratherrealrevenuetaxtransaction
SHARED TOKENS (20): "act", "business", "capital", "code", "common", "estate", "investment", "investors", "jobs", "law", "long-term", "owners", "personal", "properties", "property", "rather", "real", "revenue", "tax", "transaction".
0.300
agenciesbankscreditfreefullhighindividuallargelargerlenderslimitlimitsratesresidentialvalue
SHARED TOKENS (15): "agencies", "banks", "credit", "free", "full", "high", "individual", "large", "larger", "lenders", "limit", "limits", "rates", "residential", "value".
0.300
activitiesagriculturalannualbureaufederalfoundedgroupheadquarteredindustryinsurancelargerlargestmembersparentpolicyrealrevenue
SHARED TOKENS (17): "activities", "agricultural", "annual", "bureau", "federal", "founded", "group", "headquartered", "industry", "insurance", "larger", "largest", "members", "parent", "policy", "real", "revenue".
0.300
approvalcodecodescompletionconstructiondevelopmenteconomyexpansiongovernmentlawlocalnationalneededplanplanningplansregionalrequiredsignificant
SHARED TOKENS (19): "approval", "code", "codes", "completion", "construction", "development", "economy", "expansion", "government", "law", "local", "national", "needed", "plan", "planning", "plans", "regional", "required", "significant".
0.300
assetsbrokeragebusinessbusinessesclientcreatingdivisionglobalindividualinvestorsjanuarylargemanagementorganizationssmall
SHARED TOKENS (15): "assets", "brokerage", "business", "businesses", "client", "creating", "division", "global", "individual", "investors", "january", "large", "management", "organizations", "small".
0.300
businesscentercentraldedicateddevelopmentgrowthincreaselandmilenetworkplanningprivatepublicrelationshipresidentialservingspace
SHARED TOKENS (17): "business", "center", "central", "dedicated", "development", "growth", "increase", "land", "mile", "network", "planning", "private", "public", "relationship", "residential", "serving", "space".
0.300
accessaccountingbusinessescreditdemanddirecteconomicelectronicfreeinstitutionlocalpersonalratessharetermstransactionunionusersuses
SHARED TOKENS (19): "access", "accounting", "businesses", "credit", "demand", "direct", "economic", "electronic", "free", "institution", "local", "personal", "rates", "share", "terms", "transaction", "union", "users", "uses".
0.300
acquiredacquisitionactivityassetscapitalcorporatecostcreatingfinancefirmhighincentivesincreaseincreasedinvestmentlenderslimitoperationalprivatesignificant
SHARED TOKENS (20): "acquired", "acquisition", "activity", "assets", "capital", "corporate", "cost", "creating", "finance", "firm", "high", "incentives", "increase", "increased", "investment", "lenders", "limit", "operational", "private", "significant".
0.300
activeassetsbankingbanksbrokeragecentersclientcommercialconsultingdigitaleconomicexpansionfoundedfounderheadquarteredinstitutionalinvestmentslargestmanagementpioneer
SHARED TOKENS (23): "active", "assets", "banking", "banks", "brokerage", "centers", "client", "commercial", "consulting", "digital", "economic", "expansion", "founded", "founder", "headquartered", "institutional", "investments", "largest", "management", "pioneer"....
0.300
accessactadditionalbanksbureauconsumercreditdecisionsfreehistoryindividualinsurancelenderslendingmajorprimaryproductsrecordsreportscore
SHARED TOKENS (22): "access", "act", "additional", "banks", "bureau", "consumer", "credit", "decisions", "free", "history", "individual", "insurance", "lenders", "lending", "major", "primary", "products", "records", "report", "score"....
0.300
Federal Reserve ↗ Q53536 KW CROSS HIGH
actactivityannualbankingbankscapitalcentralcommercialdecisionsdepartmenteconomiceconomyentityeventsexecutiveexpansionfederalgovernmentincomeindependent
SHARED TOKENS (40): "act", "activity", "annual", "banking", "banks", "capital", "central", "commercial", "decisions", "department", "economic", "economy", "entity", "events", "executive", "expansion", "federal", "government", "income", "independent"....
0.300
activityadditionalagreementbanksbusinesscentralchangescrediteconomyfederalinstitutionslargerlevelmarketmarketsmembersoperationspolicypublishedrate
SHARED TOKENS (22): "activity", "additional", "agreement", "banks", "business", "central", "changes", "credit", "economy", "federal", "institutions", "larger", "level", "market", "markets", "members", "operations", "policy", "published", "rate"....
0.300
accountingassetsassociationbusinesscommercialcommissionfinanceinternationallawlendingmainmarketsnetworkofficialrequiredsellertradetransaction
SHARED TOKENS (18): "accounting", "assets", "association", "business", "commercial", "commission", "finance", "international", "law", "lending", "main", "markets", "network", "official", "required", "seller", "trade", "transaction".
0.300
Family office ↗ Q751314 KW CROSS HIGH
accountingactivitiesassetsbuiltcapitalcommercialcosteducationestategroupincentivesinvestmentinvestmentslegalmanagementmembersofficeofficesoperatesplanning
SHARED TOKENS (26): "accounting", "activities", "assets", "built", "capital", "commercial", "cost", "education", "estate", "group", "incentives", "investment", "investments", "legal", "management", "members", "office", "offices", "operates", "planning"....
0.300
becomecompletecomplexconsumercreditestatehistoryinformationlenderslendingproductspropertyraterealspecializedtaxtransaction
SHARED TOKENS (17): "become", "complete", "complex", "consumer", "credit", "estate", "history", "information", "lenders", "lending", "products", "property", "rate", "real", "specialized", "tax", "transaction".
0.300
actadministrationagenciesassetsauthoritybanksbureaubusinesschangesconsumercouncilcreditdataeconomicfederalfirmsgrowthinstitutionsinvestmentsjuly
SHARED TOKENS (30): "act", "administration", "agencies", "assets", "authority", "banks", "bureau", "business", "changes", "consumer", "council", "credit", "data", "economic", "federal", "firms", "growth", "institutions", "investments", "july"....
0.300
Network effect ↗ Q649124 KW CROSS HIGH
additionalbecomecommonconsumercostdemanddirecteconomygroupgrowthincreaseinformationlinkedinmarketmarketsmultiplenetworknetworkingproductsrather
SHARED TOKENS (27): "additional", "become", "common", "consumer", "cost", "demand", "direct", "economy", "group", "growth", "increase", "information", "linkedin", "market", "markets", "multiple", "network", "networking", "products", "rather"....
0.300
businesscapitalcommonconsistentlycorporatedirectlyexpensesfederalgovernmentincomeincreaseincreasedindividuallimitslocalminimumpartnerspartnershippersonalrate
SHARED TOKENS (24): "business", "capital", "common", "consistently", "corporate", "directly", "expenses", "federal", "government", "income", "increase", "increased", "individual", "limits", "local", "minimum", "partners", "partnership", "personal", "rate"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
accessadditionalbasecommunitiesdecisionsdevelopmenteconomiceconomyfacilitieshealthhealthcarehistoryimprovementincomeinformationinsurancemedicaloccupationalorganizationspersonal
SHARED TOKENS (29): "access", "additional", "base", "communities", "decisions", "development", "economic", "economy", "facilities", "health", "healthcare", "history", "improvement", "income", "information", "insurance", "medical", "occupational", "organizations", "personal"....
0.300
collegecommunitycontextseconomiceducationindividualinstitutionlevelpersonsectorsspecializedspecifictechnologytradetraining
SHARED TOKENS (15): "college", "community", "contexts", "economic", "education", "individual", "institution", "level", "person", "sectors", "specialized", "specific", "technology", "trade", "training".
0.300
consumercreditdirectlyeducationexpensesindustryinvestmentlenderslendinglevelmajormedicalminimumproductsprojectspropertyratesrequiretermsuses
SHARED TOKENS (20): "consumer", "credit", "directly", "education", "expenses", "industry", "investment", "lenders", "lending", "level", "major", "medical", "minimum", "products", "projects", "property", "rates", "require", "terms", "uses".
0.300
activeactivityassetsauthoritybanksbroaderbusinesscentralchangesdevelopeddevelopmentdirectdirectlyeconomiceconomyfixedframeworkgovernmenthighindependent
SHARED TOKENS (31): "active", "activity", "assets", "authority", "banks", "broader", "business", "central", "changes", "developed", "development", "direct", "directly", "economic", "economy", "fixed", "framework", "government", "high", "independent"....
0.300
associationconstructioncostdataemployeesgovernmentindustryinternationalmembersnationalprogramspublictradetrainingunionvoice
SHARED TOKENS (16): "association", "construction", "cost", "data", "employees", "government", "industry", "international", "members", "national", "programs", "public", "trade", "training", "union", "voice".
0.300
activecentereconomicemergencyenvironmenteventsexitsfacilitiesfireimprovelocalmanagementownersplanningprogramprogramspropertyregulationreviewspace
SHARED TOKENS (24): "active", "center", "economic", "emergency", "environment", "events", "exits", "facilities", "fire", "improve", "local", "management", "owners", "planning", "program", "programs", "property", "regulation", "review", "space"....
0.300
banksbecomebrokerbusinesscommercialfirmfirmsholdingsindependentinstitutioninvestmentmainnaturalpersontradetransactions
SHARED TOKENS (16): "banks", "become", "broker", "business", "commercial", "firm", "firms", "holdings", "independent", "institution", "investment", "main", "natural", "person", "trade", "transactions".
0.300
accessadditionalbrokerbrokeragebusinessbusinessescentercenterscentralequipmentexecutiveindividualindustrylargemanagementofficeofficesoperationsownersrental
SHARED TOKENS (28): "access", "additional", "broker", "brokerage", "business", "businesses", "center", "centers", "central", "equipment", "executive", "individual", "industry", "large", "management", "office", "offices", "operations", "owners", "rental"....
0.300
assistanceassociationbusinessbusinessescapitalcorporatedevelopmenteconomicentrepreneursfirmsgovernmentincubatorsindividualinstitutionsmanagementmembersnationalofficeprogramprograms
SHARED TOKENS (33): "assistance", "association", "business", "businesses", "capital", "corporate", "development", "economic", "entrepreneurs", "firms", "government", "incubators", "individual", "institutions", "management", "members", "national", "office", "program", "programs"....
0.300
additionalbusinesscapitalcommoncostdivisioneconomicenterpriseequipmentfacilitiesincreaseincreasedindustrialindustrylargelargerlimitlimitsmarketphysical
SHARED TOKENS (25): "additional", "business", "capital", "common", "cost", "division", "economic", "enterprise", "equipment", "facilities", "increase", "increased", "industrial", "industry", "large", "larger", "limit", "limits", "market", "physical"....
0.300
administrationauthoritybusinesscentralconsolidationconsumercorporatecreditelectronicemployeesfacefederalgovernmentindustryinstitutioninvestmentslargestleaguelocalmarch
SHARED TOKENS (33): "administration", "authority", "business", "central", "consolidation", "consumer", "corporate", "credit", "electronic", "employees", "face", "federal", "government", "industry", "institution", "investments", "largest", "league", "local", "march"....
0.300
actaddedbasebeginningbusinessbusinessescapitalcorporatedevelopmentdistrictentitiesentityestatefederalhistoricalhistoryincomeindividualinvestmentjanuary
SHARED TOKENS (43): "act", "added", "base", "beginning", "business", "businesses", "capital", "corporate", "development", "district", "entities", "entity", "estate", "federal", "historical", "history", "income", "individual", "investment", "january"....
0.300
Property tax ↗ Q607695 KW CROSS HIGH
authorityestategovernmentincomelandmultiplenationalpropertyraterealregionrentalrequirestaxtransactionvalue
SHARED TOKENS (16): "authority", "estate", "government", "income", "land", "multiple", "national", "property", "rate", "real", "region", "rental", "requires", "tax", "transaction", "value".
0.300
assetsassociationcommunityeasternfederalfull-serviceheadquarteredheadquartersidahoindependentinsurancemembersoutherntreasureutahvalleywestern
SHARED TOKENS (17): "assets", "association", "community", "eastern", "federal", "full-service", "headquartered", "headquarters", "idaho", "independent", "insurance", "member", "southern", "treasure", "utah", "valley", "western".
0.300
anotherassetsbankscommercialcomplexestatefacegovernmentgroupinvestmentinvestorslevelmajormarketmonthlyofficeownedratherrealresidential
SHARED TOKENS (26): "another", "assets", "banks", "commercial", "complex", "estate", "face", "government", "group", "investment", "investors", "level", "major", "market", "monthly", "office", "owned", "rather", "real", "residential"....
0.300
departmenteducationemployeesexecutivefederalgovernmentheadquartersindependentinformationjanuaryjulylegallevellocalnationalofficesprogramspublicrecognizedregional
SHARED TOKENS (22): "department", "education", "employees", "executive", "federal", "government", "headquarters", "independent", "information", "january", "july", "legal", "level", "local", "national", "offices", "programs", "public", "recognized", "regional"....
0.300
Money market ↗ Q627543 KW CROSS HIGH
actassetsbroadercapitalcommercialcrediteconomyfederalglobalgovernmentlendingmarketmarketsrelevantvaluewestern
SHARED TOKENS (16): "act", "assets", "broader", "capital", "commercial", "credit", "economy", "federal", "global", "government", "lending", "market", "markets", "relevant", "value", "western".
0.300
agreementestatefixedlandlawlegalmarketmonthlyownershippersonalpropertyrealresidentialrightstenanttermstitle
SHARED TOKENS (17): "agreement", "estate", "fixed", "land", "law", "legal", "market", "monthly", "ownership", "personal", "property", "real", "residential", "rights", "tenant", "terms", "title".
0.300
401(k) ↗ Q1206798 KW CROSS HIGH
addedassetscodedirectlyemployeesemployeremployersimpactincomelimitspersonalplanplansrevenuerulessavingstax
SHARED TOKENS (17): "added", "assets", "code", "directly", "employees", "employer", "employers", "impact", "income", "limits", "personal", "plan", "plans", "revenue", "rules", "savings", "tax".
0.300
annualcommercialconsultingcorporateemployeesestateexecutivefacilitiesfirmgroupheadquartersindustrialinternationalinvestmentinvestorsjunemanagementofficeofficesowners
SHARED TOKENS (28): "annual", "commercial", "consulting", "corporate", "employees", "estate", "executive", "facilities", "firm", "group", "headquarters", "industrial", "international", "investment", "investors", "june", "management", "office", "offices", "owners"....
0.300
Freddie Mac ↗ Q935969 KW CROSS HIGH
assetsassociationdepartmenteconomyenterprisefederalfinancefullgovernmentheadquarteredhousingincreasedinvestmentinvestorsjunelargestlendinglistmanagementmarket
SHARED TOKENS (29): "assets", "association", "department", "economy", "enterprise", "federal", "finance", "full", "government", "headquartered", "housing", "increased", "investment", "investors", "june", "largest", "lending", "list", "management", "market"....
0.300
commercialcostdevelopeddevelopmentincreaseindustriallandmainpolicypreviouslyrequirerequiressitesitesspecialized
SHARED TOKENS (15): "commercial", "cost", "developed", "development", "increase", "industrial", "land", "main", "policy", "previously", "require", "requires", "site", "sites", "specialized".
0.300
Bank failure ↗ KW CROSS HIGH
assetsbankingbanksbecomebusinesscreatesdemandeconomyfallsfirmsgovernmentinstitutionsmajormarketminimumpolicypublicregulationregulatoryresearch
SHARED TOKENS (23): "assets", "banking", "banks", "become", "business", "creates", "demand", "economy", "falls", "firms", "government", "institutions", "major", "market", "minimum", "policy", "public", "regulation", "regulatory", "research"....
0.300
Trust company ↗ Q8303885 KW CROSS HIGH
accountingactadministersagenciesanotherassetsexpensesfirmincomeinstitutioninvestmentslawlegalmedicalownedprofessionalrecords
SHARED TOKENS (17): "accounting", "act", "administers", "agencies", "another", "assets", "expenses", "firm", "income", "institution", "investments", "law", "legal", "medical", "owned", "professional", "records".
0.300
activitiesadministrationcapitalcommoncorporatecreatecreditentitiesfederalinvestmentinvestmentslawlegalmanagementnationalorganizationsownedprofessionalrecordsregulation
SHARED TOKENS (24): "activities", "administration", "capital", "common", "corporate", "create", "credit", "entities", "federal", "investment", "investments", "law", "legal", "management", "national", "organizations", "owned", "professional", "records", "regulation"....
0.300
Microfinance ↗ Q926217 KW CROSS HIGH
accessbankingbecomebusinessescreatecreditdevelopmenteconomicecosystementrepreneursgroupgrowthhighincomeindividualinstitutionsinsurancelargermainmodel
SHARED TOKENS (28): "access", "banking", "become", "businesses", "create", "credit", "development", "economic", "ecosystem", "entrepreneurs", "group", "growth", "high", "income", "individual", "institutions", "insurance", "larger", "main", "model"....
0.300
Credit score ↗ Q1787103 KW CROSS HIGH
bankscreditdatadigitalfinancegovernmentindividualinformationinsurancelenderslendinglevellimitsorganizationspersonratereportrevenuescore
SHARED TOKENS (19): "banks", "credit", "data", "digital", "finance", "government", "individual", "information", "insurance", "lenders", "lending", "level", "limits", "organizations", "person", "rate", "report", "revenue", "score".
0.300
actadabusinesschangescouncilcoveredemployeesemployersfinalidentityjanuaryjulylawnationaloriginpublicrequiresrightssigned
SHARED TOKENS (19): "act", "ada", "business", "changes", "council", "covered", "employees", "employers", "final", "identity", "january", "july", "law", "national", "origin", "public", "requires", "rights", "signed".
0.300
beyondbusinessbusinessesfacegrowinggrowthhighlargemodelprivatepublicrapidratessignificantstartupstartups
SHARED TOKENS (16): "beyond", "business", "businesses", "face", "growing", "growth", "high", "large", "model", "private", "public", "rapid", "rates", "significant", "startup", "startups".
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adabaseboisecentercommercialcommissiondepartmentdowntownfallsfireidahoincreaseinternationallandingnationaloperatesrightssupportuseswestern
SHARED TOKENS (20): "ada", "base", "boise", "center", "commercial", "commission", "department", "downtown", "falls", "fire", "idaho", "increase", "international", "landing", "national", "operates", "rights", "support", "uses", "western".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
activitiesadministrationanotherbroaderbuiltbusinesscapitalcodescommunicationscommunitiescommunitycontextscreatingculturedevelopmenteconomicenvironmentgeographygrowthhealth
SHARED TOKENS (44): "activities", "administration", "another", "broader", "built", "business", "capital", "codes", "communications", "communities", "community", "contexts", "creating", "culture", "development", "economic", "environment", "geography", "growth", "health"....
0.300
estateinvestmentmanagementplanningtax
SHARED TOKENS (5): "estate", "investment", "management", "planning", "tax". | EXACT TITLE in financial: "Wealth management".
0.300
collegecreatescrediteducationexpensesfinancefixedhistoryincomeinstitutionlawlendinglimitmainmajormedicalminimummonthlypersonpersonal
SHARED TOKENS (27): "college", "creates", "credit", "education", "expenses", "finance", "fixed", "history", "income", "institution", "law", "lending", "limit", "main", "major", "medical", "minimum", "monthly", "person", "personal"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
authoritycodecodesconstructioncouncildistrictestatehealthinsuranceinternationallawlevellocalmainmodelnationalplanningprivateproductspublic
SHARED TOKENS (27): "authority", "code", "codes", "construction", "council", "district", "estate", "health", "insurance", "international", "law", "level", "local", "main", "model", "national", "planning", "private", "products", "public"....
0.300
activitiesactivitybeyondbusinessconnectcostcreateculturedigitalframeworkfulllevelofficeorganizationspersonpersonalphysicalsavingsspacesupport
SHARED TOKENS (23): "activities", "activity", "beyond", "business", "connect", "cost", "create", "culture", "digital", "framework", "full", "level", "office", "organizations", "person", "personal", "physical", "savings", "space", "support"....
0.300
administrationagenciesassociationcreditdepartmentdevelopmentfederalfoundedfullgovernmenthousinginvestorsnationalofficeownedpublicrates
SHARED TOKENS (17): "administration", "agencies", "association", "credit", "department", "development", "federal", "founded", "full", "government", "housing", "investors", "national", "office", "owned", "public", "rates".
0.300
U.S. Bancorp ↗ Q739084 KW CROSS HIGH
acquiredactadministrationannualassociationbankingbasebusinessbusinessescreditentitiesentityeventsfirmglobalheadquarteredhistoryinstitutioninstitutionsinvestment
SHARED TOKENS (37): "acquired", "act", "administration", "annual", "association", "banking", "base", "business", "businesses", "credit", "entities", "entity", "events", "firm", "global", "headquartered", "history", "institution", "institutions", "investment"....
0.300
actadministrationassistancecreditdepartmenteducationfederalfirmhealthlawoccupationalratesregulatorysalessignedstatutestraining
SHARED TOKENS (17): "act", "administration", "assistance", "credit", "department", "education", "federal", "firm", "health", "law", "occupational", "rates", "regulatory", "sales", "signed", "statutes", "training".
0.300
assetscentercommercialcoveringdistrictfederalformeridaholargestmarketmemberofficespopulationroleutahwestern
SHARED TOKENS (16): "assets", "center", "commercial", "covering", "district", "federal", "former", "idaho", "largest", "market", "member", "offices", "population", "role", "utah", "western".
0.300
Edge city ↗ Q1266029 KW CROSS HIGH
activitybecomebusinesscenterscentralconcentrationdevelopeddistrictdowntownedgeentertainmentgrowthmajorpreviouslyresidentialterms
SHARED TOKENS (16): "activity", "become", "business", "centers", "central", "concentration", "developed", "district", "downtown", "edge", "entertainment", "growth", "major", "previously", "residential", "terms".
0.300
accessaccessibleadministrationbroadercreditexpandingfederalgovernmenthistoryhousingincomeinsurancelenderslong-termmarketprimaryprogramsavingssector
SHARED TOKENS (19): "access", "accessible", "administration", "broader", "credit", "expanding", "federal", "government", "history", "housing", "income", "insurance", "lenders", "long-term", "market", "primary", "program", "savings", "sector".
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
actadjacentanotherauthoritybodycommercialcommissioncommunitycouncilcreatingdistrictgovernmentindustriallandlargerlayerlocalownersparcelplan
SHARED TOKENS (32): "act", "adjacent", "another", "authority", "body", "commercial", "commission", "community", "council", "creating", "district", "government", "industrial", "land", "larger", "layer", "local", "owners", "parcel", "plan"....
0.300
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | EXACT TITLE in coworking_commercial_space: "Northwest Nazarene University".
0.300
actagenciesbankingbankscommercialcommunitiescommunitycreditdevelopmentfederalhousinginformationinstitutionslawlocalregulatorysavingstitle
SHARED TOKENS (18): "act", "agencies", "banking", "banks", "commercial", "communities", "community", "credit", "development", "federal", "housing", "information", "institutions", "law", "local", "regulatory", "savings", "title".
0.300
activitiesadministersadministrationdepartmentdirectlyeconomicemployersexecutivefederalgovernmentheadquartershealthhistoryhourimprovememberoccupationalreportsresponsiblerights
SHARED TOKENS (20): "activities", "administers", "administration", "department", "directly", "economic", "employers", "executive", "federal", "government", "headquarters", "health", "history", "hour", "improve", "member", "occupational", "reports", "responsible", "rights".
0.300
assistancebankingbankscapitaldirectlydocumentfirmfoundersfreegrowthholdingsinformationinstitutionalinvestmentinvestmentsinvestorslargerlegalmarketminimum
SHARED TOKENS (28): "assistance", "banking", "banks", "capital", "directly", "document", "firm", "founders", "free", "growth", "holdings", "information", "institutional", "investment", "investments", "investors", "larger", "legal", "market", "minimum"....
0.300
administrationagenciesbureaudepartmentdirectlyenvironmentexecutivefederalgovernmentheadquarteredlawmanagementmembernationalnaturalofficeofficesreportsresourcesrights
SHARED TOKENS (21): "administration", "agencies", "bureau", "department", "directly", "environment", "executive", "federal", "government", "headquartered", "law", "management", "member", "national", "natural", "office", "offices", "reports", "resources", "rights"....
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
communitycreatingdevelopmentestatefacilitieshousingincreaseinfrastructurejobslandplanningpopulationrealregionalspacesupport
SHARED TOKENS (16): "community", "creating", "development", "estate", "facilities", "housing", "increase", "infrastructure", "jobs", "land", "planning", "population", "real", "regional", "space", "support".
0.300
anotherauthoritybuiltchangescodescommercialconstructiondepartmentdocumentgovernmentindustriallawlocalownershipplansrequiredresidentialspace
SHARED TOKENS (18): "another", "authority", "built", "changes", "codes", "commercial", "construction", "department", "document", "government", "industrial", "law", "local", "ownership", "plans", "required", "residential", "space".
0.300
activitiescommunitycomprehensivedevelopmentdocumentfoundationgrowthhousingindividuallandlargelong-termparcelplanplanningplanspolicypublicregionregional
SHARED TOKENS (21): "activities", "community", "comprehensive", "development", "document", "foundation", "growth", "housing", "individual", "land", "large", "long-term", "parcel", "plan", "planning", "plans", "policy", "public", "region", "regional"....
0.300
Fannie Mae ↗ Q621096 KW CROSS HIGH
additionalassetsassociationenterprisefederalfoundedglobalgloballylargestlenderslendinglocalmarketnationalrevenuesavingstermstotal
SHARED TOKENS (18): "additional", "assets", "association", "enterprise", "federal", "founded", "global", "globally", "largest", "lenders", "lending", "local", "market", "national", "revenue", "savings", "terms", "total".
0.300
Idaho State Capitol ↗ KW CROSS HIGH
adaaddedboisecapitalcompletedconstructioncostdepartmentdistrictfederalfinalfirmformationgovernmentidahojulylegislaturelistingnationalpartnership
SHARED TOKENS (22): "ada", "added", "boise", "capital", "completed", "construction", "cost", "department", "district", "federal", "final", "firm", "formation", "government", "idaho", "july", "legislature", "listing", "national", "partnership"....
🫐 BERRY90 edges
0.280
NNN lease ↗ Q6954788 KW CROSS HIGH
basecommercialcommonestateexpensesinsurancelawownershippropertyratherrealresponsiblesingletenant
SHARED TOKENS (14): "base", "commercial", "common", "estate", "expenses", "insurance", "law", "ownership", "property", "rather", "real", "responsible", "single", "tenant".
0.280
actactivitiesactivityagenciesgovernmentindividualinstitutionslawrecordsreportreportsrequirestaxtransactions
SHARED TOKENS (14): "act", "activities", "activity", "agencies", "government", "individual", "institutions", "law", "records", "report", "reports", "requires", "tax", "transactions".
0.280
acquisitionbusinesscapitaldevelopmentindividualindustrylargemanagementparentprivaterolethroughouttransactionsventure
SHARED TOKENS (14): "acquisition", "business", "capital", "development", "individual", "industry", "large", "management", "parent", "private", "role", "throughout", "transactions", "venture".
0.280
Net lease ↗ Q6998482 KW CROSS HIGH
agreementcentercommercialestateexpensesinsuranceoperationspropertiespropertyrealrequiressizetenantwritten
SHARED TOKENS (14): "agreement", "center", "commercial", "estate", "expenses", "insurance", "operations", "properties", "property", "real", "requires", "size", "tenant", "written".
0.280
broadercompletedirectlyeducationhighinstitutionneededprofessionalratherrequiredspecificstudentstradetraining
SHARED TOKENS (14): "broader", "complete", "directly", "education", "high", "institution", "needed", "professional", "rather", "required", "specific", "students", "trade", "training".
0.280
businessexecutiveofficesspecific
SHARED TOKENS (4): "business", "executive", "offices", "specific". | EXACT TITLE in coworking_commercial_space: "Executive suite".
0.280
activitiesbecomedevelopmenteconomiceconomyeducationindustryinformationinnovationprivatepublicsectorsectorssoftware
SHARED TOKENS (14): "activities", "become", "development", "economic", "economy", "education", "industry", "information", "innovation", "private", "public", "sector", "sectors", "software".
0.280
centerfireinterstateplaza
SHARED TOKENS (4): "center", "fire", "interstate", "plaza". | EXACT TITLE in financial: "First Interstate Bank".
0.280
agenciesbanksentitiesfirmsframeworkinstitutionalinstitutionslawpolicyregulatoryrelevantreportreportstransaction
SHARED TOKENS (14): "agencies", "banks", "entities", "firms", "framework", "institutional", "institutions", "law", "policy", "regulatory", "relevant", "report", "reports", "transaction".
0.280
Wire transfer ↗ Q334501 KW CROSS HIGH
anotherbankscentralcostcreditelectronicentityfederalofficepersonsystemstransactiontransactionsvalue
SHARED TOKENS (14): "another", "banks", "central", "cost", "credit", "electronic", "entity", "federal", "office", "person", "systems", "transaction", "transactions", "value".
0.280
Warehouse ↗ Q181623 EXACT TITLE
businessesdirectlyindustriallarge
SHARED TOKENS (4): "businesses", "directly", "industrial", "large". | EXACT TITLE in coworking_commercial_space: "Warehouse".
0.280
Tax credit ↗ Q1062630 EXACT TITLE
anothercredittaxtotal
SHARED TOKENS (4): "another", "credit", "tax", "total". | EXACT TITLE in financial: "Tax credit".
0.260
beginningcostfixedhighmonthlypersonplanrateratesrealresponsiblesinglevalue
SHARED TOKENS (13): "beginning", "cost", "fixed", "high", "monthly", "person", "plan", "rate", "rates", "real", "responsible", "single", "value".
0.260
administrationassetscomplexestateexpenseslegalmanagementpersonplanningpropertyspecifictaxvalue
SHARED TOKENS (13): "administration", "assets", "complex", "estate", "expenses", "legal", "management", "person", "planning", "property", "specific", "tax", "value".
0.260
actagenciesbanksbureaudepartmentfederalindependentinstitutionsjulylicensednationalofficeregulatory
SHARED TOKENS (13): "act", "agencies", "banks", "bureau", "department", "federal", "independent", "institutions", "july", "licensed", "national", "office", "regulatory".
0.260
Electrician ↗ Q165029 EXACT TITLE
dataequipmentinfrastructure
SHARED TOKENS (3): "data", "equipment", "infrastructure". | EXACT TITLE in coworking_commercial_space: "Electrician".
0.260
Limited partnership ↗ KW CROSS HIGH
actactivitiesagentsauthoritybusinessfirmlegalmajormanagementpartnerspartnershippropertyshare
SHARED TOKENS (13): "act", "activities", "agents", "authority", "business", "firm", "legal", "major", "management", "partners", "partnership", "property", "share".
0.260
builtcomplexconstructioncreateequipmentmedicalphysicalprojectsresponsiblesitestructuralsystemsuses
SHARED TOKENS (13): "built", "complex", "construction", "create", "equipment", "medical", "physical", "projects", "responsible", "site", "structural", "systems", "uses".
0.260
Hot desking ↗ Q3472398 KW CROSS HIGH
costestatehighmembermultipleofficepersonalprimaryratherrealsavingsspacespecific
SHARED TOKENS (13): "cost", "estate", "high", "member", "multiple", "office", "personal", "primary", "rather", "real", "savings", "space", "specific".
0.260
officeplanningspace
SHARED TOKENS (3): "office", "planning", "space". | EXACT TITLE in coworking_commercial_space: "Office space". | EXACT TITLE in financial: "Office space".
0.260
businesschangesdemandeconomicestatefinancehousingindustrymarketsrealresearchresidentialstructural
SHARED TOKENS (13): "business", "changes", "demand", "economic", "estate", "finance", "housing", "industry", "markets", "real", "research", "residential", "structural".
0.260
agenciesauthoritybankingbanksfederalindividualinsurancelendinglevelregulationregulatoryseparatesingle
SHARED TOKENS (13): "agencies", "authority", "banking", "banks", "federal", "individual", "insurance", "lending", "level", "regulation", "regulatory", "separate", "single".
0.260
businessescloudconsumerdevelopmentdigitalgloballylargestproductsresearchsoftwaresupporttechnologyvalley
SHARED TOKENS (13): "businesses", "cloud", "consumer", "development", "digital", "globally", "largest", "products", "research", "software", "support", "technology", "valley".
0.260
agriculturalannualeconomyfoodgroupidahoincomelandlargestmajorownedproductssouthern
SHARED TOKENS (13): "agricultural", "annual", "economy", "food", "group", "idaho", "income", "land", "largest", "major", "owned", "products", "southern".
0.240
assetscorporategovernmentindividualindustryinvestmentlevelpersonpopulationprimaryregulationtotal
SHARED TOKENS (12): "assets", "corporate", "government", "individual", "industry", "investment", "level", "person", "population", "primary", "regulation", "total".
0.240
firmfixedinstitutionalinvestmentinvestmentsinvestorspartnershipprivatesinglespecifictermsview
SHARED TOKENS (12): "firm", "fixed", "institutional", "investment", "investments", "investors", "partnership", "private", "single", "specific", "terms", "view".
0.240
Seed money ↗ Q939645 KW CROSS HIGH
builtbusinesscapitalcommunityinvestmentinvestmentspolicyprogramspublicstartupsupportventure
SHARED TOKENS (12): "built", "business", "capital", "community", "investment", "investments", "policy", "programs", "public", "startup", "support", "venture".
0.240
actauthoritybusinesscommissioncompensationfirmfirmsindividualinvestmentmanagementrequiredsize
SHARED TOKENS (12): "act", "authority", "business", "commission", "compensation", "firm", "firms", "individual", "investment", "management", "required", "size".
0.240
broaderbusinesscompetitivecontextcorporateculturedecisionsemployeesidentitymanagementnationalorganizations
SHARED TOKENS (12): "broader", "business", "competitive", "context", "corporate", "culture", "decisions", "employees", "identity", "management", "national", "organizations".
0.240
administersdepartmentdevelopmentdirectlyexecutivefederalfoundedgovernmenthousingmemberprogramreports
SHARED TOKENS (12): "administers", "department", "development", "directly", "executive", "federal", "founded", "government", "housing", "member", "program", "reports".
0.240
Boise Centre ↗ Q4938442 KW CROSS HIGH
boisecentercompleteddistrictdowntownentityeventexpansionidaholargestoperatingspace
SHARED TOKENS (12): "boise", "center", "completed", "district", "downtown", "entity", "event", "expansion", "idaho", "largest", "operating", "space".
0.240
assetseconomyestatehousingincreaseinvestorslargelargerlargestmainmarketreal
SHARED TOKENS (12): "assets", "economy", "estate", "housing", "increase", "investors", "large", "larger", "largest", "main", "market", "real".
0.220
facilitiesinternationalmanagementneededoperationsplanningsectorsitesspacesupportsystems
SHARED TOKENS (11): "facilities", "international", "management", "needed", "operations", "planning", "sector", "sites", "space", "support", "systems".
0.220
agentsbusinessesemployeesfiregroupindependentinsuranceownedproductssmalltrade
SHARED TOKENS (11): "agents", "businesses", "employees", "fire", "group", "independent", "insurance", "owned", "products", "small", "trade".
0.220
environmentestatelandmarketpropertyrealreportreportsrolesizevalue
SHARED TOKENS (11): "environment", "estate", "land", "market", "property", "real", "report", "reports", "role", "size", "value".
0.220
actcreatesemployeesemployerenterprisehoursinterstatelawminimumovertimesigned
SHARED TOKENS (11): "act", "creates", "employees", "employer", "enterprise", "hours", "interstate", "law", "minimum", "overtime", "signed".
0.220
bankscoveredestatelenderspropertyrealsellersizetotaltransactionvalue
SHARED TOKENS (11): "banks", "covered", "estate", "lenders", "property", "real", "seller", "size", "total", "transaction", "value".
0.220
comprehensivecontinuingfacilitieshealthhealthcareidahonetworkoperatesoperatingseniorsupport
SHARED TOKENS (11): "comprehensive", "continuing", "facilities", "health", "healthcare", "idaho", "network", "operates", "operating", "senior", "support".
0.220
beginningboisedowntownfallshighwayidahointerstatemajornorthwesttwinutah
SHARED TOKENS (11): "beginning", "boise", "downtown", "falls", "highway", "idaho", "interstate", "major", "northwest", "twin", "utah".
0.210
Studio ↗ Q746628 EXACT TITLE
space
SHARED TOKENS (1): "space". | EXACT TITLE in coworking_commercial_space: "Studio".
0.210
Plumber ↗ Q252924 EXACT TITLE
systems
SHARED TOKENS (1): "systems". | EXACT TITLE in coworking_commercial_space: "Plumber".
0.210
Tenant ↗ Q528278 EXACT TITLE
tenant
SHARED TOKENS (1): "tenant". | EXACT TITLE in coworking_commercial_space: "Tenant". | EXACT TITLE in financial: "Tenant".
0.200
actcommissionfederalfirmsgovernmentindependentinvestmentmarketprimarystatutes
SHARED TOKENS (10): "act", "commission", "federal", "firms", "government", "independent", "investment", "market", "primary", "statutes".
0.200
actfederalinterstatelawmarketregulationrequirestransactionusesvirtually
SHARED TOKENS (10): "act", "federal", "interstate", "law", "market", "regulation", "requires", "transaction", "uses", "virtually".
0.200
adaboisecentercentraleasternidahonationalpopulationvalleywestern
SHARED TOKENS (10): "ada", "boise", "center", "central", "eastern", "idaho", "national", "population", "valley", "western".
0.200
commondirectlyeventexpenseshealthindividualinsurancemedicalpolicyproperty
SHARED TOKENS (10): "common", "directly", "event", "expenses", "health", "individual", "insurance", "medical", "policy", "property".
0.180
assetscapitalincomeinvestmentinvestmentslong-termratetaxtotal
SHARED TOKENS (9): "assets", "capital", "income", "investment", "investments", "long-term", "rate", "tax", "total".
0.180
eventsinsurancelegalnaturalphysicalprimaryregionspecificterms
SHARED TOKENS (9): "events", "insurance", "legal", "natural", "physical", "primary", "region", "specific", "terms".
0.180
Stock market ↗ Q475000 KW CROSS HIGH
businessesinvestmentinvestmentsinvestorsmarketownershipprivatepublicshare
SHARED TOKENS (9): "businesses", "investment", "investments", "investors", "market", "ownership", "private", "public", "share".
0.180
accessadministrationclouddemandinternationalnetworkphysicalresourcesvirtual
SHARED TOKENS (9): "access", "administration", "cloud", "demand", "international", "network", "physical", "resources", "virtual".
0.180
capitalcommercialestateprivatepropertyratesrealresidentialspecific
SHARED TOKENS (9): "capital", "commercial", "estate", "private", "property", "rates", "real", "residential", "specific".
0.180
additionalanotherinternationalmanagementofficeofficesprivateunionvirtual
SHARED TOKENS (9): "additional", "another", "international", "management", "office", "offices", "private", "union", "virtual".
0.180
commoneventsfireinsurancemainpolicypropertyrequirespecialized
SHARED TOKENS (9): "common", "events", "fire", "insurance", "main", "policy", "property", "require", "specialized".
0.180
businesscentersdataemergencyequipmentlargesinglesizeuses
SHARED TOKENS (9): "business", "centers", "data", "emergency", "equipment", "large", "single", "size", "uses".
0.160
builtconstructionenvironmentindustryinfrastructurepersonphysicalthough
SHARED TOKENS (8): "built", "construction", "environment", "industry", "infrastructure", "person", "physical", "though".
0.160
Carpentry ↗ Q203605 KW CROSS HIGH
commonconstructionnaturalprimaryprogramstructuraltradetraining
SHARED TOKENS (8): "common", "construction", "natural", "primary", "program", "structural", "trade", "training".
0.160
centercenterscommonconferencelargemajorsharetrade
SHARED TOKENS (8): "center", "centers", "common", "conference", "large", "major", "share", "trade".
0.160
centraldirectemergencyexitexitsfirefreeoperations
SHARED TOKENS (8): "central", "direct", "emergency", "exit", "exits", "fire", "free", "operations".
0.160
businessfoundedheadquarterednationaloperatesratherutahwestern
SHARED TOKENS (8): "business", "founded", "headquartered", "national", "operates", "rather", "utah", "western".
0.160
Wireless LAN ↗ Q212607 KW CROSS HIGH
accesscampuslocalnetworkofficesmalluserswireless
SHARED TOKENS (8): "access", "campus", "local", "network", "office", "small", "users", "wireless".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictgrowingidahopopulationwest
SHARED TOKENS (8): "ada", "boise", "canyon", "district", "growing", "idaho", "population", "west".
0.160
Bridge loan ↗ KW CROSS HIGH
additionalbusinesscommonfinanceindividuallargerraterequire
SHARED TOKENS (8): "additional", "business", "common", "finance", "individual", "larger", "rate", "require".
0.160
actactivitiescommissionfederalinvestmentlawprimaryregulation
SHARED TOKENS (8): "act", "activities", "commission", "federal", "investment", "law", "primary", "regulation".
0.160
Medicine ↗ Q11190 KW CROSS HIGH
becomeculturehealthlevellocalmedicalresearchtechnology
SHARED TOKENS (8): "become", "culture", "health", "level", "local", "medical", "research", "technology".
0.160
assetsincomeindividualinstitutionsinvestmentplansavingstax
SHARED TOKENS (8): "assets", "income", "individual", "institutions", "investment", "plan", "savings", "tax".
0.160
businessdevelopmentestateindustrialindustryofficeofficesrather
SHARED TOKENS (8): "business", "development", "estate", "industrial", "industry", "office", "offices", "rather".
0.140
adaboisegovernmentidahomainpopulationseparate
SHARED TOKENS (7): "ada", "boise", "government", "idaho", "main", "population", "separate".
0.140
agriculturalidaholandlargestmajornorthwestsouthern
SHARED TOKENS (7): "agricultural", "idaho", "land", "largest", "major", "northwest", "southern".
0.140
constructionenvironmentindustrialindustryresourcessectoruses
SHARED TOKENS (7): "construction", "environment", "industrial", "industry", "resources", "sector", "uses".
0.140
boisecenteridaholargestpopulationrecognizedvalley
SHARED TOKENS (7): "boise", "center", "idaho", "largest", "population", "recognized", "valley".
0.140
activitiesbusinessenvironmentgovernmentorganizationsprimarytravel
SHARED TOKENS (7): "activities", "business", "environment", "government", "organizations", "primary", "travel".
0.140
Closing costs ↗ Q5135446 KW CROSS HIGH
closingestatepropertyrealsellertitletransaction
SHARED TOKENS (7): "closing", "estate", "property", "real", "seller", "title", "transaction".
0.140
accountingexpensesfinancefirmincomeoperatingtax
SHARED TOKENS (7): "accounting", "expenses", "finance", "firm", "income", "operating", "tax".
0.140
Gross lease ↗ Q5610497 KW CROSS HIGH
commercialexpensesoperatingownershippropertyrentaltenant
SHARED TOKENS (7): "commercial", "expenses", "operating", "ownership", "property", "rental", "tenant".
0.120
accessiblecommoncreatecreatingproductsrelevant
SHARED TOKENS (6): "accessible", "common", "create", "creating", "products", "relevant".
0.120
anotherhighinformationlocalrequiredvoice
SHARED TOKENS (6): "another", "high", "information", "local", "required", "voice".
0.120
becomehealthintersectionpersonalprivateresearch
SHARED TOKENS (6): "become", "health", "intersection", "personal", "private", "research".
0.120
Exit strategy ↗ Q596613 KW CROSS HIGH
continuingcostexitfaceindividualplan
SHARED TOKENS (6): "continuing", "cost", "exit", "face", "individual", "plan".
0.120
activecommercialfirelargesmallsystems
SHARED TOKENS (6): "active", "commercial", "fire", "large", "small", "systems".
0.120
bankingheadquarteredindependentinvestmentmanagementplanning
SHARED TOKENS (6): "banking", "headquartered", "independent", "investment", "management", "planning".
0.120
Tax deduction ↗ Q1893102 KW CROSS HIGH
additionalexpensesincentivesincomerevenuetax
SHARED TOKENS (6): "additional", "expenses", "incentives", "income", "revenue", "tax".
0.120
anotherbankingbanksbusinessinstitutiontransactions
SHARED TOKENS (6): "another", "banking", "banks", "business", "institution", "transactions".
0.120
Debt-to-income ratio ↗ KW CROSS HIGH
consumerincomeindustryinsurancemainmonthly
SHARED TOKENS (6): "consumer", "income", "industry", "insurance", "main", "monthly".
0.100
boisegemidaholargestpopulation
SHARED TOKENS (5): "boise", "gem", "idaho", "largest", "population".
0.100
associationconstructionheadquartersindustrytrade
SHARED TOKENS (5): "association", "construction", "headquarters", "industry", "trade".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahopopulation
SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "population".
0.100
Business park ↗ Q338313 KW CROSS HIGH
accessbusinesslandmajoroffice
SHARED TOKENS (5): "access", "business", "land", "major", "office".
0.100
insurancelendersprivatepropertyrequired
SHARED TOKENS (5): "insurance", "lenders", "private", "property", "required".
0.100
impactoperatingprojectssystemstechnology
SHARED TOKENS (5): "impact", "operating", "projects", "systems", "technology".
0.100
contextimproveplanningrevenuesavings
SHARED TOKENS (5): "context", "improve", "planning", "revenue", "savings".
◈ Frequently Asked Questions
Coworking Commercial Space × Financial — Treasure Valley
HAIKU · HIGH GATE
How do coworking spaces in Boise and Meridian support Small Business Administration lending requirements?
Coworking facilities in Boise and Meridian provide documented business addresses and operational infrastructure that qualify startups for SBA loan applications and demonstrate business legitimacy to lenders. Ada County commercial real estate investment trusts increasingly acquire and lease coworking properties because they meet SBA standards for business operation verification.
What role do coworking rents play in mergers and acquisitions across the Treasure Valley?
Acquirers evaluating Nampa and Caldwell technology companies factor coworking occupancy costs and lease terms into operational due diligence during mergers and acquisitions transactions. Canyon County private equity firms analyzing target companies in the region assess coworking rental rates alongside traditional real estate holdings as variable cost structures.
How do venture capital investors evaluate coworking space density when funding startups in Eagle and Boise?
Venture capital firms examining Treasure Valley startups consider proximity to established coworking hubs in Boise and Eagle as indicators of available talent networks and reduced capital requirements for office buildout. Private equity groups reviewing portfolio companies in Ada County benchmark coworking utilization rates to forecast operational efficiency and cash preservation metrics.
Why do financial service firms track coworking commercial development in Meridian and Nampa?
Real estate investment trusts operating across Canyon County and Ada County monitor coworking expansion as a measure of private capital investment and business formation activity in secondary Treasure Valley markets. Venture capital analysts use Nampa and Meridian coworking leasing data to assess regional economic development and identify emerging commercial finance opportunities.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Coworking Commercial Space × Financial 13 QID bridges 277 edges 6,941 ext links 2026-07-17 20:07:12 UTC a7ec6ed13856c54d
Coworking Commercial Space corridor ↗ Financial corridor ↗ Financial × Coworking Commercial Space ↗ boisestandard.org/standard ↗
Parent Corridors
Coworking Commercial Space × All Other Verticals