—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Biotech Life Sciences ↔ relates to ↔ Vision Optical

15 Wikipedia bridge articles confirmed in both vertical ledgers. 253 deterministic cross-vertical edges. 7,143 external source links harvested. Every edge provenance-stamped. Every claim auditable.

15 QID Bridge Articles
253 Cross Edges
7,143 External Sources
282 Wikipedia Articles
16 🌲 Evergreen
193 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Biotech Life Sciences
× Vision Optical
QID Bridge Articles
15
confirmed Wikipedia overlap
Total Cross Edges
253
External Sources Harvested
7,143
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  30 shared tokens
QID Bridge Titles (15)
IdahoMedical deviceCollege of Western IdahoFood and Drug AdministrationBoise metropolitan areaTreasure ValleyCenters for Medicare & Medicaid ServicesPrivate equityTrinity HealthBoise, IdahoNampa, IdahoCaldwell, IdahoAda County, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitancapitaladacanyonwesternnampatreasurevalleyassociatedlaboratoryproductsfederalcollegepublichealthmeridianapproximately
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:48:12 UTC
Content Hash
0f25fc07b6963357
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
15 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (30): "approximately", "associated", "best", "boise", "capital", "contains", "distinct", "divided", "early", "geographic", "idaho", "isolated", "laboratory", "manufacturing", "national", "official", "organized", "people", "population", "products".... | EXACT TITLE in biotech_life_sciences: "Idaho". | EXACT TITLE in vision_optical: "Idaho".
approximatelyassociatedbestboisecapitalcontainsdistinctdividedearlygeographicidahoisolatedlaboratorymanufacturingnationalofficialorganizedpeoplepopulationproductssciencesectorseparatesignificantsmallsquaresuppliestechnologyuseswestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Medical device
Q6554101 EXACT TITLE 1.000
QID OVERLAP: Q6554101 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:branch). | SHARED TOKENS (37): "amendments", "amount", "associated", "benefit", "complex", "controls", "design", "device", "devices", "discovery", "drug", "establish", "established", "federal", "food", "general", "global", "increase", "intended", "later".... | EXACT TITLE in biotech_life_sciences: "Medical device".
amendmentsamountassociatedbenefitcomplexcontrolsdesigndevicedevicesdiscoverydrugestablishestablishedfederalfoodgeneralglobalincreaseintendedlatermajormarketmedicaloversightpatientregulatedregulationrequiredriskrule+7
. In the United States, it was not until the Federal Food, Drug, and Cosmetic Act (FD&C Act) in 1938 that medical devices were regulated at all. It was not until later in 1976 that the Medical Device Amendments to the FD&C Act established medical device regulation and oversight as we know it today in the United States. Medical device regulation in Europe as we know it today came into effect in 1993 by what is collectively known as the Medical Device Directive (MDD). On May 26, 2017, the Medical Device Regulation (MDR) replaced the MDD. Medical devices vary in both their intended use and indications for use. Examples range from simple, low-risk devices such as tongue depressors, medical thermometers, disposable gloves, and bedpans to complex, high-risk devices that are implanted and sustain life. Examples of high-risk devices include artificial hearts, pacemakers, joint replacements, and CT scans. The design of medical devices constitutes a major segment of the field of biomedical engineering. The global medical device market was estimated to be between $220 and US$250 billion in 2013. The United States controls ≈40% of the global market followed by Europe (25%), Japan (15%), and the rest of the world (20%). Although collectively Europe has a larger share, Japan has the second largest country market share. The largest market shares in Europe (in order of market share size) belong to Germany, Italy, France, and the United Kingdom.
proved safe and effective with reasonable assurance before regulating governments allow marketing of the device in their country. As a general rule, as the associated risk of the device increases the amount of testing required to establish safety and efficacy also increases. Further, as associated risk increases the potential benefit to the patient must also increase. Discovery of what would be considered a medical device by modern standards dates as far back as c. 7000 BC in Baluchistan where Neolithic dentists used flint-tipped drills and bowstrings. Study of archeology and Roman medical literature also indicate that many types of medical devices were in widespread use during the time of ancient Rome. In the United States, it was not until the Federal Food, Drug, and Cosmetic Act (FD&C Act) in 1938 that medical devices were regulated at all. It was not until later in 1976 that the Medical Device Amendments to the FD&C Act established medical device regulation and oversight as we know it today in the United States. Medical device regulation in Europe as we know it today came into effect in 1993 by what is collectively known as the Medical Device Directive (MDD). On May 26, 2017, the Medical Device Regulation (MDR) replaced the MDD. Medical devices vary in both their intended use and indications for use. Examples range from simple, low-risk devices such as tongue depressors, medical thermometers, disposable gloves, and bedpans to complex, high-risk devices that are implanted and sustain life. Examples of high-risk devices include artificial hearts, pacemakers, joint replacements, and CT scans. The design of medical devices constitutes a major segment of the field of biomedical engineering. The global medical device market was estimated to be between $220 and US$250 billion in 2013. The United States controls ≈40% of the global market followed by Europe (25%), Japan (15%), and the rest of the world (20%). Although collectively Europe has a larger share, Japan has the second largest country market share. The largest market shares in Europe (in order of market share size) belong to Germany, Italy, France, and the United Kingdom.
marketing of the device in their country. As a general rule, as the associated risk of the device increases the amount of testing required to establish safety and efficacy also increases. Further, as associated risk increases the potential benefit to the patient must also increase. Discovery of what would be considered a medical device by modern standards dates as far back as c. 7000 BC in Baluchistan where Neolithic dentists used flint-tipped drills and bowstrings. Study of archeology and Roman medical literature also indicate that many types of medical devices were in widespread use during the time of ancient Rome. In the United States, it was not until the Federal Food, Drug, and Cosmetic Act (FD&C Act) in 1938 that medical devices were regulated at all. It was not until later in 1976 that the Medical Device Amendments to the FD&C Act established medical device regulation and oversight as we know it today in the United States. Medical device regulation in Europe as we know it today came into effect in 1993 by what is collectively known as the Medical Device Directive (MDD). On May 26, 2017, the Medical Device Regulation (MDR) replaced the MDD. Medical devices vary in both their intended use and indications for use. Examples range from simple, low-risk devices such as tongue depressors, medical thermometers, disposable gloves, and bedpans to complex, high-risk devices that are implanted and sustain life. Examples of high-risk devices include artificial hearts, pacemakers, joint replacements, and CT scans. The design of medical devices constitutes a major segment of the field of biomedical engineering. The global medical device market was estimated to be between $220 and US$250 billion in 2013. The United States controls ≈40% of the global market followed by Europe (25%), Japan (15%), and the rest of the world (20%). Although collectively Europe has a larger share, Japan has the second largest country market share. The largest market shares in Europe (in order of market share size) belong to Germany, Italy, France, and the United Kingdom.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (28): "academic", "ada", "adult", "board", "boise", "canyon", "college", "colleges", "community", "development", "education", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents", "southwest".... | EXACT TITLE in biotech_life_sciences: "College of Western Idaho". | EXACT TITLE in vision_optical: "College of Western Idaho".
academicadaadultboardboisecanyoncollegecollegescommunitydevelopmenteducationidaholargenampapopulationprogramspublicreportedresidentssouthweststudentstudentstechnicaltransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Food and Drug Administration
Q204711 EXACT TITLE 1.000
QID OVERLAP: Q204711 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (31): "administration", "agency", "associated", "authority", "consent", "control", "current", "department", "devices", "directly", "diseases", "drug", "drugs", "fda", "federal", "feed", "food", "health", "human", "laboratories".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration". | EXACT TITLE in vision_optical: "Food and Drug Administration".
administrationagencyassociatedauthorityconsentcontrolcurrentdepartmentdevicesdirectlydiseasesdrugdrugsfdafederalfeedfoodhealthhumanlaboratorieslaboratorymedicalpharmaceuticalproductspublicregulatedregulationsrelatedusesveterinary+1
The Food and Drug Administration (FDA) is a federal agency of the United States Department of Health and Human Services (HHS). The FDA is responsible for protecting and promoting public health through the control and supervision of food safety, tobacco products, caffeine products, dietary supplements, prescription and over-the-counter pharmaceutical drugs (medications), vaccines, biopharmaceuticals, blood transfusions, medical devices, electromagnetic radiation emitting devices (ERED), cosmetics, animal foods & feed, and veterinary products. The FDA's primary focus is enforcing the Federal Food, Drug, and Cosmetic Act (FD&C). However, the agency also enforces other laws, notably Section 361 of the Public Health Service Act as well as associated regulations. Much of this regulatory-enforcement work is not directly related to food or drugs but involves other regulated products like lasers, cellular phones, and condoms. In addition, the FDA uses its authority to mitigate diseases in a variety of contexts, from household pets to human sperm for use in assisted reproduction. The FDA is led by the commissioner of food and drugs, who is appointed by the president with the advice and consent of the Senate. The commissioner reports to the secretary of health and human services. Marty Makary is the current commissioner. The FDA's headquarters is located in the White Oak area of Silver Spring, Maryland, occupying the former Naval Ordnance Laboratory. The agency has 223 field offices and 13 laboratories located across the 50 states, the United States Virgin Islands, and Puerto Rico. In 2008, the FDA began to post employees to foreign countries, including China, India, Costa Rica, Chile, Belgium, and the United Kingdom.
White Oak Federal Research Center Since 1990, the FDA has had employees and facilities on 130 acres (53 hectares) of the White Oak Federal Research Center in the White Oak area of Silver Spring, Maryland. In 2001, the General Services Administration (GSA) began new construction on the campus to consolidate the FDA's 25 existing operations in the Washington metropolitan area, its headquarters in Rockville, and several fragmented office buildings. The first building, the Life Sciences Laboratory, was dedicated and opened with 104 employees in December 2003. As of December 2018, the FDA campus has a population of 10,987 employees housed in approximately 3,800,000 square feet (350,000 square metres) of space, divided into ten offices and four laboratory buildings. The campus houses the Office of the Commissioner (OC), the Office of Regulatory Affairs (ORA), the Center for Drug Evaluation and Research (CDER), the Center for Devices and Radiological Health (CDRH), the Center for Biologics Evaluation and Research (CBER) and offices for the Center for Veterinary Medicine (CVM). With the passing of the FDA Reauthorization Act of 2017, the FDA projects a 64% increase in employees to 18,000 over the next 15 years and wants to add approximately 1,600,000 square feet (150,000 square metres) of office and special use space to their existing facilities.
Regulations The programs for safety regulation vary widely by the type of product, its potential risks, and the regulatory powers granted to the agency. For example, the FDA regulates almost every facet of prescription drugs, including testing, manufacturing, labeling, advertising, marketing, efficacy, and safety—yet FDA regulation of cosmetics focuses primarily on labeling and safety. The FDA regulates most products with a set of published standards enforced by a modest number of facility inspections. Inspection observations are documented on Form 483. In June 2018, the FDA released a statement regarding new guidelines to help food and drug manufacturers "implement protections against potential attacks on the U.S. food supply". One of the guidelines includes the Intentional Adulteration (IA) rule, which requires strategies and procedures by the food industry to reduce the risk of compromise in facilities and processes that are significantly vulnerable. The FDA also uses tactics of regulatory shaming, mainly through online publication of non-compliance, warning letters, and "shaming lists." Regulation by shaming harnesses firms' sensitivity to reputational damage. For example, in 2018, the agency published an online "black list", in which it named dozens of branded drug companies that are supposedly using unlawful or unethical means to attempt to impede competition from generic drug companies. The FDA frequently works with other federal agencies, including the Department of Agriculture, the Drug Enforcement Administration, Customs and Border Protection, and the Consumer Product Safety Commission.
Boise metropolitan area
Q4938481 EXACT TITLE 0.980
QID OVERLAP: Q4938481 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:branch). | SHARED TOKENS (14): "ada", "adds", "boise", "canyon", "commonly", "component", "designated", "idaho", "meridian", "metropolitan", "nampa", "population", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
adaaddsboisecanyoncommonlycomponentdesignatedidahomeridianmetropolitannampapopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (11): "association", "boise", "idaho", "local", "lower", "metropolitan", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in biotech_life_sciences: "Treasure Valley". | EXACT TITLE in vision_optical: "Treasure Valley".
associationboiseidaholocallowermetropolitanregionresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Centers for Medicare & Medicaid Services
Q5060058 QID OVERLAP 0.800
QID OVERLAP: Q5060058 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:branch). | SHARED TOKENS (31): "administer", "administers", "administration", "agency", "amendments", "care", "centers", "certification", "children", "clinical", "commonly", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "human", "insurance"....
administeradministersadministrationagencyamendmentscarecenterscertificationchildrenclinicalcommonlydepartmentfacilitiesfederalfinancinggovhealthhealthcarehumaninsurancelaboratorymedicaidmedicarenursingoversightprocessprogramprogramsqualitystandards+1
The Centers for Medicare & Medicaid Services (CMS) is a federal agency within the United States Department of Health and Human Services (HHS) that administers the Medicare program and works in partnership with state governments to administer Medicaid, the Children's Health Insurance Program (CHIP), and health insurance portability standards. In addition to these programs, CMS has other responsibilities, including the administrative simplification standards from the Health Insurance Portability and Accountability Act of 1996 (HIPAA), quality standards in long-term care facilities (more commonly referred to as nursing homes) through its survey and certification process, clinical laboratory quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States.
rtification process, clinical laboratory quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States. This includes maintaining the 5-Star Quality Rating System. Organization The agency carries out its responsibilities from its national headquarters located in Woodlawn, Maryland, and its 10 regional offices. It is organized around six centers to support its key functions.
History Originally, the name "Medicare" in the United States referred to a program providing medical care for families of people serving in the military as part of the Dependents' Medical Care Act, which was passed in 1956. President Dwight D. Eisenhower held the first White House Conference on Aging in January 1961, in which creating a health care program for social security beneficiaries was proposed. President Lyndon B. Johnson signed the Social Security Amendments on July 30, 1965, establishing both Medicare and Medicaid. Arthur E. Hess, a deputy commissioner of the Social Security Administration, was named as first director of the Bureau of Health Insurance in 1965, placing him as the first executive in charge of the Medicare program. At the time, the program provided health insurance to 19 million Americans. The Social Security Administration (SSA) became responsible for the administration of Medicare and the Social and Rehabilitation Service (SRS) became responsible for the administration of Medicaid. Both agencies were organized under what was then known as the Department of Health, Education, and Welfare (HEW), in 1965. Since then, HEW, has been reorganized as the Department of Health and Human Services (HHS) in 1980. This consequently brought Medicare and Medicaid under the jurisdiction of the HHS. In March 1977, the Health Care Financing Administration (HCFA) was established under HEW. HCFA became responsible for the coordination of Medicare and Medicaid. The responsibility for enrolling beneficiaries into Medicare and processing premium payments remained with SSA. HCFA was renamed the Centers for Medicare & Medicaid Services on July 1, 2001. This was later codified in law by the Medicare Prescription Drug, Improvement, and Modernization Act of 2003. In 2013, a report by the inspector general found that CMS had paid $23 million in benefits to deceased beneficiaries in 2011. In April 2014, CMS released raw claims data from 2012 that gave a look into what types of doctors billed Medicare the most. In January 2018, CMS released guidelines for states to use to require Medicaid beneficiaries to continue receiving coverage. These guidelines came in response to then-President Trump's announcement that he would allow states to impose work requirements in Medicaid. In October, CMS reported a data breach of 75,000 people's personal data due to a hack. In February 2018, CMS removed a notice from its website that informed insurance companies they were not allowed to charge physicians a fee when the companies paid the doctors for their work. This has resulted in doctors being charged up to a 5% fee on their compensation, adding up to billions of dollars annually. In January 2021, CMS passed a rule that would cover "breakthrough technology" for four years after they received FDA approval. In September 2021, CMS submitted a proposal to repeal the rule based on safety concerns. On September 19, 2023, the Subcommittee on Health held a hearing titled "Examining Policies to Improve Seniors’ Access to Innovative Drugs, Medical Devices, and Technology." Dora Hughes, the acting director of the Center for Clinical Standards and Quality at the U.S. Centers for Medicare and Medicaid Services (CMS), defended the proposed Transitional Coverage for Emerging Technologies (TCET) pathway, which aims to restrict coverage for breakthrough medical devices to five reviews a year. Some lawmakers and medtech trade groups called for expanding the pathway to include diagnostics.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (26): "active", "business", "capital", "category", "control", "described", "development", "expansion", "financing", "general", "management", "operational", "otherwise", "ownership", "partnerships", "private", "private-equity", "product", "products", "provide"....
activebusinesscapitalcategorycontroldescribeddevelopmentexpansionfinancinggeneralmanagementoperationalotherwiseownershippartnershipsprivateprivate-equityproductproductsprovidepublicratherrolespecializedstockstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
T
Q7842827 QID OVERLAP 0.800
QID OVERLAP: Q7842827 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (16): "care", "clinics", "facilities", "health", "healthcare", "hospital", "hospitals", "idaho", "network", "operates", "operating", "patients", "people", "physicians", "support", "system".
careclinicsfacilitieshealthhealthcarehospitalhospitalsidahonetworkoperatesoperatingpatientspeoplephysicianssupportsystem
Trinity Health is an American not-for-profit Catholic health system operating 92 hospitals in 22 states, including 120 continuing care locations encompassing home care, hospice, PACE and senior living facilities. Based in Livonia, Michigan, Trinity Health employs more than 120,000 people including 5,300 physicians. Sponsored by Catholic Health Ministries, Trinity Health operates facilities in the US states of Alabama, California, Connecticut, Delaware, Florida, Georgia, Idaho, Illinois, Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area.
Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area. The system includes a hospital, a network of outpatient clinics, and a variety of support services. History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "sectors", "technology", "treasure", "valley".
adaannualboisecapitalidaholocallymajormanufacturingmetropolitanpopulationsectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "western".
boisecanyoncollegeidahomeridianmetropolitannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Ada County, Idaho
Q109820 QID OVERLAP 0.660
QID OVERLAP: Q109820 in biotech_life_sciences (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (8): "ada", "boise", "capital", "idaho", "local", "metropolitan", "population", "private".
adaboisecapitalidaholocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahometropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in biotech_life_sciences (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "meridian", "population".
adaamongboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
238 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP238 edges
🌲 EVERGREEN1 edges
0.650
Optometry ↗ EXACT TITLE
academicadvancedcarecollegeconditionsdegreediseasediseasesdoctoralhealthcarelicensedmanagementmedicalmedicinemonitoringparticipateperformpracticeprescribeprovide
SHARED TOKENS (26): "academic", "advanced", "care", "college", "conditions", "degree", "disease", "diseases", "doctoral", "healthcare", "licensed", "management", "medical", "medicine", "monitoring", "participate", "perform", "practice", "prescribe", "provide".... | URL->B (1): http://idaho.aoa.org/. | EXACT TITLE in vision_optical: "Optometry".
🌿 BRANCH193 edges
0.590
Vision therapy ↗ EXACT TITLE
addresschildrenclaimconvergenceeducationalevidencemedicineproblemsscientificsupportsupportingtreatment
SHARED TOKENS (12): "address", "children", "claim", "convergence", "educational", "evidence", "medicine", "problems", "scientific", "support", "supporting", "treatment". | URL->B (1): https://aapos.org/glossary/vision-therapy. | EXACT TITLE in vision_optical: "Vision therapy".
0.500
Antibody ↗ Q79460 EXACT TITLE
becomecapacitychainsclassificationcompositioncontainsdemonstratedescribesdescribingdifferentdirectlydiseasedistinctdistributiondividedessentialformfunctionfunctionsgeneral
SHARED TOKENS (40): "become", "capacity", "chains", "classification", "composition", "contains", "demonstrate", "describes", "describing", "different", "directly", "disease", "distinct", "distribution", "divided", "essential", "form", "function", "functions", "general".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
addressanotherapplicationsappliesapprovalbasicbenefitsconsequentlycoredevelopeddevelopingdevelopmentdirectlydrugsfieldsfunctionsgenerallyglobalhigherhuman
SHARED TOKENS (54): "address", "another", "applications", "applies", "approval", "basic", "benefits", "consequently", "core", "developed", "developing", "development", "directly", "drugs", "fields", "functions", "generally", "global", "higher", "human".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
amongapproximatelyboiseclassifieddivisiondoctorateestablishedgraduateidaholateroperatesproductionprofessionalpublicrepresentedresearchstatewidestudentsundergraduateuniversity
SHARED TOKENS (20): "among", "approximately", "boise", "classified", "division", "doctorate", "established", "graduate", "idaho", "later", "operates", "production", "professional", "public", "represented", "research", "statewide", "students", "undergraduate", "university". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
0.500
administrationapplycannotcommunitydemanddrugformhospitalhospitalsmanufacturersmanufacturingneedspharmaciespreparationprovideregulations
SHARED TOKENS (16): "administration", "apply", "cannot", "community", "demand", "drug", "form", "hospital", "hospitals", "manufacturers", "manufacturing", "needs", "pharmacies", "preparation", "provide", "regulations". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.500
activityamountconditionsdependsdevelopingdirectlydiseasefoodformhealthmaintainmajorpeoplephysicalpreparationrequiredsuppliedwaterwork
SHARED TOKENS (19): "activity", "amount", "conditions", "depends", "developing", "directly", "disease", "food", "form", "health", "maintain", "major", "people", "physical", "preparation", "required", "supplied", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
amountappliedbecomecapablecomplexdifferentfieldsfunctionidentifiedidentitymechanismpatternprocedureresultssamplestructurethem
SHARED TOKENS (17): "amount", "applied", "become", "capable", "complex", "different", "fields", "function", "identified", "identity", "mechanism", "pattern", "procedure", "results", "sample", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
anothercollectioncreatedevelopmentessentialhigherimaginginsidephysicalprocessremainssamplesmallstandardtechnicaluses
SHARED TOKENS (16): "another", "collection", "create", "development", "essential", "higher", "imaging", "inside", "physical", "process", "remains", "sample", "small", "standard", "technical", "uses". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
activitiesanotherappliedappliesapplyauthoritybenefitsboardcapacityclinicalcodifiedcommitteeconditionsconductconsentdecisionsevidenceformgenerallyhealthcare
SHARED TOKENS (53): "activities", "another", "applied", "applies", "apply", "authority", "benefits", "board", "capacity", "clinical", "codified", "committee", "conditions", "conduct", "consent", "decisions", "evidence", "form", "generally", "healthcare".... | EXACT TITLE in vision_optical: "Informed consent".
0.500
caredistincthealthmedicalmedicinephysicalphysicianphysicianspractitionersrelatedscopespecialistsspecialtiesstandardsteamstrainingtreatmentwork
SHARED TOKENS (18): "care", "distinct", "health", "medical", "medicine", "physical", "physician", "physicians", "practitioners", "related", "scope", "specialists", "specialties", "standards", "teams", "training", "treatment", "work". | EXACT TITLE in vision_optical: "Sports medicine".
0.500
Myopia ↗ Q168403 EXACT TITLE
affectamongassociatedchangechildrencommoncommonlydiagnosisdifferenthigherinsidelargeloweroutsidepeopleplacementpopulationproceduresprovideresults
SHARED TOKENS (21): "affect", "among", "associated", "change", "children", "common", "commonly", "diagnosis", "different", "higher", "inside", "large", "lower", "outside", "people", "placement", "population", "procedures", "provide", "results".... | EXACT TITLE in vision_optical: "Myopia".
0.500
Vaccine ↗ Q134808 EXACT TITLE
activeadministrationagainstalreadyassociatedcontainsdescribeddevelopeddevelopmentdifferentdiseasediseaseshealthlicensedorganizationpracticepreparationproductionsciencesystem
SHARED TOKENS (23): "active", "administration", "against", "already", "associated", "contains", "described", "developed", "development", "different", "disease", "diseases", "health", "licensed", "organization", "practice", "preparation", "production", "science", "system".... | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
Neonatology ↗ Q898674 EXACT TITLE
academicbasiccareclinicalcommonlycomplexconditionsdecisionsdevelopmentdiseasesgenerallymedicalmedicinemonitoringneedprovideresearchroomssciencesupport
SHARED TOKENS (22): "academic", "basic", "care", "clinical", "commonly", "complex", "conditions", "decisions", "development", "diseases", "generally", "medical", "medicine", "monitoring", "need", "provide", "research", "rooms", "science", "support".... | EXACT TITLE in vision_optical: "Neonatology".
0.500
accessapplicationscarecentersdiagnosisdiagnosticdiseasediseasesequipmenthighermajormedicalmonitoringneedneedsonlinepatientspopulationsremoterequiring
SHARED TOKENS (28): "access", "applications", "care", "centers", "diagnosis", "diagnostic", "disease", "diseases", "equipment", "higher", "major", "medical", "monitoring", "need", "needs", "online", "patients", "populations", "remote", "requiring".... | EXACT TITLE in vision_optical: "Teleophthalmology".
0.500
administrationauthoritycontroldevicesdrugdrugsfdafederalfoodformimplementationlawmedicalmembersnationalpatientsprincipalproductprovisionsregulations
SHARED TOKENS (22): "administration", "authority", "control", "devices", "drug", "drugs", "fda", "federal", "food", "form", "implementation", "law", "medical", "members", "national", "patients", "principal", "product", "provisions", "regulations".... | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
absenceamongbenefitchildrencommonconditionsdegreedevelopingdevicesdiagnosisdirectlyeducationalestimateshealthindividualmedicalorganizationpeopleproblemssignificant
SHARED TOKENS (22): "absence", "among", "benefit", "children", "common", "conditions", "degree", "developing", "devices", "diagnosis", "directly", "educational", "estimates", "health", "individual", "medical", "organization", "people", "problems", "significant".... | EXACT TITLE in vision_optical: "Visual impairment".
0.500
administrationauthoritycareclinicaldiseaseeducationfunctionhealthhealthcaremanagementmedicalmedicineneurologypatientphysicalpracticeprescribeprivateprovidepublic
SHARED TOKENS (23): "administration", "authority", "care", "clinical", "disease", "education", "function", "health", "healthcare", "management", "medical", "medicine", "neurology", "patient", "physical", "practice", "prescribe", "private", "provide", "public".... | EXACT TITLE in vision_optical: "Physical therapy".
0.500
approvalcannotclinicaldesigneddevelopingdevelopmentdevicedevicesdrugdrugsevidenceexperiencefdaforminstitutionsinternationallargemaintainmanagementmarkets
SHARED TOKENS (39): "approval", "cannot", "clinical", "designed", "developing", "development", "device", "devices", "drug", "drugs", "evidence", "experience", "fda", "form", "institutions", "international", "large", "maintain", "management", "markets".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingcommondensitydevelopeddevelopmentdifferentformgovernmentgrowthguidelinesland-uselocalplacesplanningpolicyprocedureregulationsregulatoryresidential
SHARED TOKENS (26): "activities", "building", "common", "density", "developed", "development", "different", "form", "government", "growth", "guidelines", "land-use", "local", "places", "planning", "policy", "procedure", "regulations", "regulatory", "residential".... | EXACT TITLE in biotech_life_sciences: "Zoning". | EXACT TITLE in vision_optical: "Zoning".
0.500
Glaucoma ↗ Q159701 EXACT TITLE
associatedcommonconditionsdifferentdiseasesearlyemergencyessentialevenfamilyhistoryincreaseinformationinsidemaintainmajormedicalrelatedrequiringrisk
SHARED TOKENS (24): "associated", "common", "conditions", "different", "diseases", "early", "emergency", "essential", "even", "family", "history", "increase", "information", "inside", "maintain", "major", "medical", "related", "requiring", "risk".... | EXACT TITLE in vision_optical: "Glaucoma".
0.500
associationcentersdevelopmentdivisioninstitutionlaboratoriesmedicalnationalpublicresearchsciencescientificspacesquaresystemsteamsuniversity
SHARED TOKENS (17): "association", "centers", "development", "division", "institution", "laboratories", "medical", "national", "public", "research", "science", "scientific", "space", "square", "systems", "teams", "university". | EXACT TITLE in vision_optical: "University of Washington".
0.500
awaycentercommoncommonlydiagnosisemergencyimaginginformationinsidelayermedicalrequiresrisksmalltissuetreatment
SHARED TOKENS (16): "away", "center", "common", "commonly", "diagnosis", "emergency", "imaging", "information", "inside", "layer", "medical", "requires", "risk", "small", "tissue", "treatment". | EXACT TITLE in vision_optical: "Retinal detachment".
0.500
boardcreatedesignatedequipmentheadquarteredinsuranceleadershiplicensingmajormanufacturersmarketsownershippositionspurchaserevenuesharestockthem
SHARED TOKENS (18): "board", "create", "designated", "equipment", "headquartered", "insurance", "leadership", "licensing", "major", "manufacturers", "markets", "ownership", "positions", "purchase", "revenue", "share", "stock", "them". | EXACT TITLE in vision_optical: "EssilorLuxottica".
0.500
advancedagenciesagencybuildingcategoryclassificationcomplexcomponentsconditionsdevicesdifferentdirectlydrugdrugsgeneralhumanisolatedmarketmedicalmedicine
SHARED TOKENS (41): "advanced", "agencies", "agency", "building", "category", "classification", "complex", "components", "conditions", "devices", "different", "directly", "drug", "drugs", "general", "human", "isolated", "market", "medical", "medicine".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
amonganalysisappearsappliedassessmentbasicchangeclinicalcollectionconditionsdatadecisionsdescriptiondesigndiseasediseasesdistributiondrawfunctiongeneral
SHARED TOKENS (47): "among", "analysis", "appears", "applied", "assessment", "basic", "change", "clinical", "collection", "conditions", "data", "decisions", "description", "design", "disease", "diseases", "distribution", "draw", "function", "general".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
basicclinicclinicaldegreedirecteducationexperiencefieldsgraduatehospitalindividualknowledgelaboratorylicensemedicalmedicineobtainphysicalphysicianphysicians
SHARED TOKENS (27): "basic", "clinic", "clinical", "degree", "direct", "education", "experience", "fields", "graduate", "hospital", "individual", "knowledge", "laboratory", "license", "medical", "medicine", "obtain", "physical", "physician", "physicians".... | EXACT TITLE in vision_optical: "Residency (medicine)".
0.500
administrationagencyappliesapplydrugfdafederalfoodintendedlawprivateprotectionpublicqualityregulatedrequiredstandardssystemsystemswater
SHARED TOKENS (20): "administration", "agency", "applies", "apply", "drug", "fda", "federal", "food", "intended", "law", "private", "protection", "public", "quality", "regulated", "required", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Hypertension ↗ Q41861 EXACT TITLE
appearsapplyassociatedbenefitchildrenclassifiedcontroldifferentdiseaseessentialhealthincreaselowermajormeasurementsmedicalmonitoringpeoplephysicalpopulation
SHARED TOKENS (23): "appears", "apply", "associated", "benefit", "children", "classified", "control", "different", "disease", "essential", "health", "increase", "lower", "major", "measurements", "medical", "monitoring", "people", "physical", "population".... | EXACT TITLE in vision_optical: "Hypertension".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeadvancedagainstapplicationsassociatedbecomecharacteristicscomponentsdiseasesearlyembeddedessentialfieldshealthlatermaintainmedicinenodesphysicalphysicians
SHARED TOKENS (29): "active", "advanced", "against", "applications", "associated", "become", "characteristics", "components", "diseases", "early", "embedded", "essential", "fields", "health", "later", "maintain", "medicine", "nodes", "physical", "physicians".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityadvancedcenteredclinicalcomplexcovereddescribeddetaileddiscoverydiseasedrugsearlyfunctiongoverninghigherlaboratorymedicalmedicinemodelorganization
SHARED TOKENS (28): "activity", "advanced", "centered", "clinical", "complex", "covered", "described", "detailed", "discovery", "disease", "drugs", "early", "function", "governing", "higher", "laboratory", "medical", "medicine", "model", "organization".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
awaycommonlyconcentrationcontainsdesigneddevicefacilitiesinsidemaintainsmanufacturingmaterialmaterialspermitsproductionresearchroomsscientificsmallerspacework
SHARED TOKENS (20): "away", "commonly", "concentration", "contains", "designed", "device", "facilities", "inside", "maintains", "manufacturing", "material", "materials", "permits", "production", "research", "rooms", "scientific", "smaller", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.500
Virology ↗ Q7215 EXACT TITLE
appliedclassificationcomponentcoveringdifferentdiseasediseasesdistinctfunctionshealthlaboratorymedicalmedicineofficialresearchsciencescientificsignificantsourcestructure
SHARED TOKENS (25): "applied", "classification", "component", "covering", "different", "disease", "diseases", "distinct", "functions", "health", "laboratory", "medical", "medicine", "official", "research", "science", "scientific", "significant", "source", "structure".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
academicactivitiescareclassifiedclinicalcommunitiesdevelopeddevelopingearlyequipmentexperienceformformalfunctionhealthhealthcareindependentlynationalneedneeds
SHARED TOKENS (35): "academic", "activities", "care", "classified", "clinical", "communities", "developed", "developing", "early", "equipment", "experience", "form", "formal", "function", "health", "healthcare", "independently", "national", "need", "needs".... | EXACT TITLE in vision_optical: "Occupational therapy".
0.500
annualanotherbecomebusinesscapitalcompleteconductconsequentlycontroldecisionsdevelopmentearlyfacefinancingformfundinggrowthhistoryinformationinstitutional
SHARED TOKENS (42): "annual", "another", "become", "business", "capital", "complete", "conduct", "consequently", "control", "decisions", "development", "early", "face", "financing", "form", "funding", "growth", "history", "information", "institutional".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
analysisappliesapprovalbenefitsboardcareclinicalcodescommitteecommonlyconductdesignateddevicesdrugsfieldsformhealthhumanindependentinstitution
SHARED TOKENS (41): "analysis", "applies", "approval", "benefits", "board", "care", "clinical", "codes", "committee", "commonly", "conduct", "designated", "devices", "drugs", "fields", "form", "health", "human", "independent", "institution".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
amountapproximatelybuiltcommonlycomplexconcentrationcurrentdepartmentfacilitiesfacilityhistoryidahoknowledgelaboratorieslaboratorynationalorganizationspeopleresearchsite
SHARED TOKENS (21): "amount", "approximately", "built", "commonly", "complex", "concentration", "current", "department", "facilities", "facility", "history", "idaho", "knowledge", "laboratories", "laboratory", "national", "organizations", "people", "research", "site".... | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
benefitcategorycreatedevelopedhumanindividualinformationlawlegallowerownershippeopleproblemspurposesystemsthemtradetypes
SHARED TOKENS (18): "benefit", "category", "create", "developed", "human", "individual", "information", "law", "legal", "lower", "ownership", "people", "problems", "purpose", "systems", "them", "trade", "types". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
carecommonlydirectdiseasediseasesevaluationexternalfieldsfunctionhealthhistoryindividualmedicalnearotherwisepeopleroutine
SHARED TOKENS (17): "care", "commonly", "direct", "disease", "diseases", "evaluation", "external", "fields", "function", "health", "history", "individual", "medical", "near", "otherwise", "people", "routine". | EXACT TITLE in vision_optical: "Eye examination".
0.500
Toxicology ↗ Q7218 EXACT TITLE
academiccombiningdrugsinfluencemedicineoverlappingpracticepracticesrelationshipresearchroutescientificstudysubjecttreatingtreatment
SHARED TOKENS (16): "academic", "combining", "drugs", "influence", "medicine", "overlapping", "practice", "practices", "relationship", "research", "route", "scientific", "study", "subject", "treating", "treatment". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.500
Ophthalmology ↗ EXACT TITLE
academicbecomecarecompletedegreediagnosisdiseaseshistorymedicalmedicineparticipateperformphysicianprescribeprovideresearchschooltrainingtreatingtreatment
SHARED TOKENS (20): "academic", "become", "care", "complete", "degree", "diagnosis", "diseases", "history", "medical", "medicine", "participate", "perform", "physician", "prescribe", "provide", "research", "school", "training", "treating", "treatment". | EXACT TITLE in vision_optical: "Ophthalmology".
0.500
Microbiology ↗ Q7193 EXACT TITLE
classifiedclinicalcommoncomplexcurrentdesigndevelopedmaterialmeansmedicalpossessscientificsearchsmallstudythemtoolswork
SHARED TOKENS (18): "classified", "clinical", "common", "complex", "current", "design", "developed", "material", "means", "medical", "possess", "scientific", "search", "small", "study", "them", "tools", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomebenefitcareclassifiedclinicalcommoncommonlycommunitydirectdrugdrugshealthinformationinstitutionallinksmonitoringofficepatientpatientspharmaceutical
SHARED TOKENS (32): "become", "benefit", "care", "classified", "clinical", "common", "commonly", "community", "direct", "drug", "drugs", "health", "information", "institutional", "links", "monitoring", "office", "patient", "patients", "pharmaceutical".... | EXACT TITLE in biotech_life_sciences: "Pharmacy". | EXACT TITLE in vision_optical: "Pharmacy".
0.500
Human eye ↗ Q430024 EXACT TITLE
amountanotherapproximatelycomponentsconnectioncontrolsdevicefunctionshumanmaintainmakesoutsiderequiredsystemtypesvisible
SHARED TOKENS (16): "amount", "another", "approximately", "components", "connection", "controls", "device", "functions", "human", "maintain", "makes", "outside", "required", "system", "types", "visible". | EXACT TITLE in vision_optical: "Human eye".
0.500
administrationagenciesclassificationclassificationscontroldecisionsdistributiondrugdrugsenforcementestablishingfdafederalfoodinternationalisolatedlawlistingmedicalnational
SHARED TOKENS (27): "administration", "agencies", "classification", "classifications", "control", "decisions", "distribution", "drug", "drugs", "enforcement", "establishing", "fda", "federal", "food", "international", "isolated", "law", "listing", "medical", "national".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
activeamountanalysisapplicationscomponentscontroldesigndevelopmentexternalflowformmeansmixotherwiseprocesssamplescienceseparatesinglesmall
SHARED TOKENS (24): "active", "amount", "analysis", "applications", "components", "control", "design", "development", "external", "flow", "form", "means", "mix", "otherwise", "process", "sample", "science", "separate", "single", "small".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
addressappliedcontrolcreatedesigndevicesdiagnosticdiseaseeconomicallyequipmentgenerallyimagingknowledgematerialsmedicalprocessproductsresearchscienceseparation
SHARED TOKENS (26): "address", "applied", "control", "create", "design", "devices", "diagnostic", "disease", "economically", "equipment", "generally", "imaging", "knowledge", "materials", "medical", "process", "products", "research", "science", "separation".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Patent ↗ Q253623 EXACT TITLE
amongcapablefieldsinternationallawlegalnationalorganizationprivateprocedureprotectionpublicratherrequirementsscopesubjecttechnologytrade
SHARED TOKENS (18): "among", "capable", "fields", "international", "law", "legal", "national", "organization", "private", "procedure", "protection", "public", "rather", "requirements", "scope", "subject", "technology", "trade". | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessadultamendmentsannualassetsbecomebenefitscarechildrencovereddividedeligibilityestablishedfederalfundinggeneralgovernmenthealthhealthcareinsurance
SHARED TOKENS (41): "access", "adult", "amendments", "annual", "assets", "become", "benefits", "care", "children", "covered", "divided", "eligibility", "established", "federal", "funding", "general", "government", "health", "healthcare", "insurance".... | EXACT TITLE in biotech_life_sciences: "Medicaid". | EXACT TITLE in vision_optical: "Medicaid".
0.500
analysisbuildingcomplexdatadevelopmentdiseaseinformationlargenetworkspathwayspopulationsprocessprocessingregulationresultsrolesciencesinglesoftwarestatistics
SHARED TOKENS (23): "analysis", "building", "complex", "data", "development", "disease", "information", "large", "networks", "pathways", "populations", "process", "processing", "regulation", "results", "role", "science", "single", "software", "statistics".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anothercaredevelopmentdiagnosticdifferentexperiencedfunctiongrowthhistorylargematerialmaterialsmedicalmedicineproductspurposesciencestudysystemsystems
SHARED TOKENS (22): "another", "care", "development", "diagnostic", "different", "experienced", "function", "growth", "history", "large", "material", "materials", "medical", "medicine", "products", "purpose", "science", "study", "system", "systems".... | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
Glasses ↗ Q37501 EXACT TITLE
againstbridgeconditionsdirectlyequipmentevenforminformationmaterialspeopleprotectionspecializedsupportthemtypesvisible
SHARED TOKENS (16): "against", "bridge", "conditions", "directly", "equipment", "even", "form", "information", "materials", "people", "protection", "specialized", "support", "them", "types", "visible". | EXACT TITLE in vision_optical: "Glasses".
0.500
appliedcarecollegescompletedegreedemanddepartmentdutiesgeneralhealthknowledgemembersmoveneedneedsneurologyoperatingperformpossesspossible
SHARED TOKENS (36): "applied", "care", "colleges", "complete", "degree", "demand", "department", "duties", "general", "health", "knowledge", "members", "move", "need", "needs", "neurology", "operating", "perform", "possess", "possible".... | EXACT TITLE in vision_optical: "Surgical technologist".
0.500
accessibilityagenciesagencyblsbureauconditionscoordinationcurrentdatadepartmenteconomicsessentialfederalgovernmentlaborlocalmaintainmajormanagementneed
SHARED TOKENS (30): "accessibility", "agencies", "agency", "bls", "bureau", "conditions", "coordination", "current", "data", "department", "economics", "essential", "federal", "government", "labor", "local", "maintain", "major", "management", "need".... | EXACT TITLE in biotech_life_sciences: "Bureau of Labor Statistics". | EXACT TITLE in vision_optical: "Bureau of Labor Statistics".
0.500
administrationagencybureaucommunitydepartmentdistributiondrugdrugsenforcementestablishedfederalgovernmentlawnationaloperationsprotectionratheruses
SHARED TOKENS (18): "administration", "agency", "bureau", "community", "department", "distribution", "drug", "drugs", "enforcement", "established", "federal", "government", "law", "national", "operations", "protection", "rather", "uses". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
amonganatomyauthoritybasicclinicalcollegedegreedirectorydividededucationeducationalgeneralgovernmentgraduatehospitalsinstitutioninternalinternationalleadershiplegally
SHARED TOKENS (48): "among", "anatomy", "authority", "basic", "clinical", "college", "degree", "directory", "divided", "education", "educational", "general", "government", "graduate", "hospitals", "institution", "internal", "international", "leadership", "legally".... | EXACT TITLE in vision_optical: "Medical school".
0.500
activityapprovalapprovedauthoritybecomebenefitcentercentersclinicalcollectioncommitteecompleteconductdatadesigndesigneddevelopmentdevicesdrugdrugs
SHARED TOKENS (47): "activity", "approval", "approved", "authority", "become", "benefit", "center", "centers", "clinical", "collection", "committee", "complete", "conduct", "data", "design", "designed", "development", "devices", "drug", "drugs".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
absenceactivitiesagencyassetsboardcareclassificationcompletecontrolcurrentdatadevelopmentdiseasediseasesdutieseligibleestablishedfoodfunctionsgenerally
SHARED TOKENS (57): "absence", "activities", "agency", "assets", "board", "care", "classification", "complete", "control", "current", "data", "development", "disease", "diseases", "duties", "eligible", "established", "food", "functions", "generally".... | EXACT TITLE in vision_optical: "World Health Organization".
0.500
appliedcompositionconductdesigndevelopmentdirectlyearlyevaluationfoodmaterialsorganizedperformpracticesprocessingproductionproductssciencescientificscopestudy
SHARED TOKENS (22): "applied", "composition", "conduct", "design", "development", "directly", "early", "evaluation", "food", "materials", "organized", "perform", "practices", "processing", "production", "products", "science", "scientific", "scope", "study".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
becomecareclinicclinicalcoveringdutieshealthhealthcarelicensedmedicalmedicineoccupationalofficeperformphysicianphysicianspracticepractitionersproceduresprofessional
SHARED TOKENS (25): "become", "care", "clinic", "clinical", "covering", "duties", "health", "healthcare", "licensed", "medical", "medicine", "occupational", "office", "perform", "physician", "physicians", "practice", "practitioners", "procedures", "professional".... | EXACT TITLE in biotech_life_sciences: "Medical assistant". | EXACT TITLE in vision_optical: "Medical assistant".
0.500
Diabetes ↗ Q12206 EXACT TITLE
adultalreadybeyondcommoncommonlyconditionsdiseasediseasesdrugsearlyformglobalhealthhealthcarehumanincreasemajorpeoplepopulationproduction
SHARED TOKENS (24): "adult", "already", "beyond", "common", "commonly", "conditions", "disease", "diseases", "drugs", "early", "form", "global", "health", "healthcare", "human", "increase", "major", "people", "population", "production".... | EXACT TITLE in vision_optical: "Diabetes".
0.500
affectanalysisassociatedcomponentsdifferentestablishingformhigherlaboratorylatermaterialpresenceprocessproductionpurposeseparateseparationsitessmallersystem
SHARED TOKENS (22): "affect", "analysis", "associated", "components", "different", "establishing", "form", "higher", "laboratory", "later", "material", "presence", "process", "production", "purpose", "separate", "separation", "sites", "smaller", "system".... | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
academiccommondepartmentfundinghealthhumaninstitutionalinstitutionsoversightpublicresearchreviewrulesignificantstandardtitlewelfare
SHARED TOKENS (17): "academic", "common", "department", "funding", "health", "human", "institutional", "institutions", "oversight", "public", "research", "review", "rule", "significant", "standard", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongapplicationscareclinicalcommoncurrentdesigndevelopmentdevicesdiagnosisdiagnosticdrugsequipmentfieldsgrowthhealthhealthcarehospitalsimagingmanagement
SHARED TOKENS (35): "among", "applications", "care", "clinical", "common", "current", "design", "development", "devices", "diagnosis", "diagnostic", "drugs", "equipment", "fields", "growth", "health", "healthcare", "hospitals", "imaging", "management".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
developmentdiseasediseasesexperiencedhumaninterfacelowermajormedicalmedicinephysicalregulationrolesciencestructurework
SHARED TOKENS (16): "development", "disease", "diseases", "experienced", "human", "interface", "lower", "major", "medical", "medicine", "physical", "regulation", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
activityamongboisebusinessclassifiedcollegecollegesdivisiondoctoraleconomicseducationgraduatehealthidahoindependentinstitutionprogramprogramspublicreported
SHARED TOKENS (24): "activity", "among", "boise", "business", "classified", "college", "colleges", "division", "doctoral", "economics", "education", "graduate", "health", "idaho", "independent", "institution", "program", "programs", "public", "reported".... | EXACT TITLE in biotech_life_sciences: "Boise State University".
0.500
Concussion ↗ Q326921 EXACT TITLE
activitiesaffectamonganotherassociatedchildrenclassifiedcommoncommonlyconcentrationconcussionconditionsdefinitiondiagnosticdirectdiseaseelsewhereevaluationevidencegenerally
SHARED TOKENS (51): "activities", "affect", "among", "another", "associated", "children", "classified", "common", "commonly", "concentration", "concussion", "conditions", "definition", "diagnostic", "direct", "disease", "elsewhere", "evaluation", "evidence", "generally".... | EXACT TITLE in biotech_life_sciences: "Concussion". | EXACT TITLE in vision_optical: "Concussion".
0.500
administrationannualbenefitbenefitscarecenterscovereddifferentdiseasedivideddrugdrugsfederalgovernmenthealthhealthcarehospitalinsurancemedicaidmedicare
SHARED TOKENS (30): "administration", "annual", "benefit", "benefits", "care", "centers", "covered", "different", "disease", "divided", "drug", "drugs", "federal", "government", "health", "healthcare", "hospital", "insurance", "medicaid", "medicare".... | EXACT TITLE in biotech_life_sciences: "Medicare (United States)". | EXACT TITLE in vision_optical: "Medicare (United States)".
0.500
Neurology ↗ Q83042 EXACT TITLE
basiccategoriesclinicalconditionsdiagnosisdiseasemedicalmedicinemultipleneurologyphysicianpracticeresearchscientificstudysystemtrainedtreatment
SHARED TOKENS (18): "basic", "categories", "clinical", "conditions", "diagnosis", "disease", "medical", "medicine", "multiple", "neurology", "physician", "practice", "research", "scientific", "study", "system", "trained", "treatment". | EXACT TITLE in biotech_life_sciences: "Neurology". | EXACT TITLE in vision_optical: "Neurology".
0.500
Pathology ↗ Q7208 EXACT TITLE
addressesanalysisclinicalcommoncomponentsconditionsconsequencesdevelopmentdiagnosisdifferentdiseasediseasesdistinctfieldsgeneralhumanmajormedicalphysicalphysician
SHARED TOKENS (31): "addresses", "analysis", "clinical", "common", "components", "conditions", "consequences", "development", "diagnosis", "different", "disease", "diseases", "distinct", "fields", "general", "human", "major", "medical", "physical", "physician".... | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherapplicationsbridgecareclinicalconditionsdatadiagnosticeducationevenfacilitiesfeedfundinghealthhealthcarehigherinformationmanagement
SHARED TOKENS (44): "access", "administration", "another", "applications", "bridge", "care", "clinical", "conditions", "data", "diagnostic", "education", "even", "facilities", "feed", "funding", "health", "healthcare", "higher", "information", "management".... | EXACT TITLE in vision_optical: "Telehealth".
0.500
amongassociatedawaycannotchangechildrencommoncommonlydiagnosispeopleprovideresultsrisktypeswhose
SHARED TOKENS (15): "among", "associated", "away", "cannot", "change", "children", "common", "commonly", "diagnosis", "people", "provide", "results", "risk", "types", "whose". | EXACT TITLE in vision_optical: "Refractive error".
0.500
advancedanalysisanalyzersappliedautomatedbasicclinicalcommoncomponentsdevelopmentdiagnosticdifferentdiseasediseasesdivisiondrugevaluationformgenerallyhealth
SHARED TOKENS (48): "advanced", "analysis", "analyzers", "applied", "automated", "basic", "clinical", "common", "components", "development", "diagnostic", "different", "disease", "diseases", "division", "drug", "evaluation", "form", "generally", "health".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
academicactivitiesanalysisapplicationsautomatedclinicalcommercialcommonconductdatadegreedevelopmentdevicesdifferentgenerallygovernmentgraduateimagingincreaseinstrumentation
SHARED TOKENS (39): "academic", "activities", "analysis", "applications", "automated", "clinical", "commercial", "common", "conduct", "data", "degree", "development", "devices", "different", "generally", "government", "graduate", "imaging", "increase", "instrumentation".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
aloneanotherapproximatelycannotcentercommoncommonlycomplexconditionsdependsdescribesdevelopedearlyfunctionhealthinfluencemeansmeasurednearorientation
SHARED TOKENS (26): "alone", "another", "approximately", "cannot", "center", "common", "commonly", "complex", "conditions", "depends", "describes", "developed", "early", "function", "health", "influence", "means", "measured", "near", "orientation".... | EXACT TITLE in vision_optical: "Visual acuity".
0.500
activitiesbecomecapitalcaredevelopeddevelopingdevelopmentearlyequipmentformationhospitallocaloperationsprocedureproceduresresultsrisksmallstandardsufficient
SHARED TOKENS (21): "activities", "become", "capital", "care", "developed", "developing", "development", "early", "equipment", "formation", "hospital", "local", "operations", "procedure", "procedures", "results", "risk", "small", "standard", "sufficient".... | EXACT TITLE in vision_optical: "Cataract surgery".
0.500
Medicine ↗ Q11190 EXACT TITLE
absenceappliedappliesapplybasicbecomecarecommonlyconnectionsdevicesdiagnosisdiseaseexternalhealthknowledgelocalmaintainmedicalmedicineoutside
SHARED TOKENS (30): "absence", "applied", "applies", "apply", "basic", "become", "care", "commonly", "connections", "devices", "diagnosis", "disease", "external", "health", "knowledge", "local", "maintain", "medical", "medicine", "outside".... | EXACT TITLE in biotech_life_sciences: "Medicine". | EXACT TITLE in vision_optical: "Medicine".
0.500
Cataract ↗ Q127724 EXACT TITLE
affectapproximatelybecomecharacteristicschildrencommoncommonlydevelopeddevelopingdevelopmentdiagnosisdiseasediseasesearlyformationgenerallyglobalinsidepeopleproblems
SHARED TOKENS (28): "affect", "approximately", "become", "characteristics", "children", "common", "commonly", "developed", "developing", "development", "diagnosis", "disease", "diseases", "early", "formation", "generally", "global", "inside", "people", "problems".... | EXACT TITLE in vision_optical: "Cataract".
0.500
acquisitionapplicationsbeyondcarechangeclinicalcommercialdescribeddevelopingdevelopmentdiagnosisdiseaseseducationevaluationfacehigherimaginglawlicensedmanagement
SHARED TOKENS (42): "acquisition", "applications", "beyond", "care", "change", "clinical", "commercial", "described", "developing", "development", "diagnosis", "diseases", "education", "evaluation", "face", "higher", "imaging", "law", "licensed", "management".... | EXACT TITLE in vision_optical: "Optical coherence tomography".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
appliedassociatedbecomecontroldependsdevelopeddiagnosisdiseasediseasesdistinctdividedexplainingfieldsfunctionfunctionshealthmaintainmedicineperformprovide
SHARED TOKENS (29): "applied", "associated", "become", "control", "depends", "developed", "diagnosis", "disease", "diseases", "distinct", "divided", "explaining", "fields", "function", "functions", "health", "maintain", "medicine", "perform", "provide".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
appliedassociatedbenefitscapacitycapitaldirectlydivideddocumentearlyestablishingformgrowthinformationinstitutionallegalmarketpoolprivateprocessprovide
SHARED TOKENS (27): "applied", "associated", "benefits", "capacity", "capital", "directly", "divided", "document", "early", "establishing", "form", "growth", "information", "institutional", "legal", "market", "pool", "private", "process", "provide".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
annualcenterscompletecomplexdetaileddiagnosticdiseasediseasesessentialfieldshistoryinternationallargemedicalneurologypatientsphysicalpublishessignificantstudy
SHARED TOKENS (21): "annual", "centers", "complete", "complex", "detailed", "diagnostic", "disease", "diseases", "essential", "fields", "history", "international", "large", "medical", "neurology", "patients", "physical", "publishes", "significant", "study".... | EXACT TITLE in vision_optical: "Neuro-ophthalmology".
0.500
Strabismus ↗ Q179951 EXACT TITLE
anotherbenefitcenteredchildrenclassifieddependsdiagnosisdiseaseearlyfamilyhistorylargeproblemsrisktreatmenttypes
SHARED TOKENS (16): "another", "benefit", "centered", "children", "classified", "depends", "diagnosis", "disease", "early", "family", "history", "large", "problems", "risk", "treatment", "types". | EXACT TITLE in vision_optical: "Strabismus".
0.500
academiccentercertificationcollegesdoctoraleducationhigherinstitutionsknowledgemembersmissionprivateproductionpublicratherresearchscientificsitesstudentstudents
SHARED TOKENS (23): "academic", "center", "certification", "colleges", "doctoral", "education", "higher", "institutions", "knowledge", "members", "mission", "private", "production", "public", "rather", "research", "scientific", "sites", "student", "students".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.500
agencyauthoritybuildingbusinesscodecodifiedconsumerdepartmentdivisionenforcementestablishedfederalgovernmentheadquarteredindependentlawmembersmissionmonitoringoffice
SHARED TOKENS (34): "agency", "authority", "building", "business", "code", "codified", "consumer", "department", "division", "enforcement", "established", "federal", "government", "headquartered", "independent", "law", "members", "mission", "monitoring", "office".... | EXACT TITLE in vision_optical: "Federal Trade Commission".
0.490
clinicalgovgovernmenthealthmedicinenationalregistry
SHARED TOKENS (7): "clinical", "gov", "government", "health", "medicine", "national", "registry". | URL->A (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.480
anatomycombinesdescribeddifferentfunctionsimagingindividualmedicinesciencescientificscopestatisticsstudysystem
SHARED TOKENS (14): "anatomy", "combines", "described", "different", "functions", "imaging", "individual", "medicine", "science", "scientific", "scope", "statistics", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.480
anothercommonfacilitymunicipalprocesspurposeresultingreturnseparationtreatedtreatmenttypesuseswater
SHARED TOKENS (14): "another", "common", "facility", "municipal", "process", "purpose", "resulting", "return", "separation", "treated", "treatment", "types", "uses", "water". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.460
Nystagmus ↗ Q220989 EXACT TITLE
associatedcommonlyconditionsdiseasedrugsidentifiedlatermeanspeoplepharmaceuticalrelatedsystemtreatment
SHARED TOKENS (13): "associated", "commonly", "conditions", "disease", "drugs", "identified", "later", "means", "people", "pharmaceutical", "related", "system", "treatment". | EXACT TITLE in vision_optical: "Nystagmus".
0.460
activitiesdevelopmentdifferentdirectlydiseasesfunctionfunctionsgrowthmedicinerathersystemthereforetissue
SHARED TOKENS (13): "activities", "development", "different", "directly", "diseases", "function", "functions", "growth", "medicine", "rather", "system", "therefore", "tissue". | EXACT TITLE in vision_optical: "Endocrinology".
0.460
Biosensor ↗ Q669391 EXACT TITLE
anotherassociatedcombinescomponentconnectsdevicedifferentmaterialpossibleresultingresultsstudytissue
SHARED TOKENS (13): "another", "associated", "combines", "component", "connects", "device", "different", "material", "possible", "resulting", "results", "study", "tissue". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.460
capabledirectinternalmedicalmedicinepermittedphysicianphysicianspracticeprogramspecialisttrainedtraining
SHARED TOKENS (13): "capable", "direct", "internal", "medical", "medicine", "permitted", "physician", "physicians", "practice", "program", "specialist", "trained", "training". | EXACT TITLE in vision_optical: "Fellowship (medicine)".
0.450
Optician ↗ Q1996635 EXACT TITLE
individualmakesproductsspecialtieswork
SHARED TOKENS (5): "individual", "makes", "products", "specialties", "work". | URL->B (1): https://www.bls.gov/ooh/healthcare/opticians-dispensing.htm. | EXACT TITLE in vision_optical: "Optician".
0.440
Cell biology ↗ Q7141 EXACT TITLE
basiccomponentscompositiondiseasesessentialfieldsfunctionmedicalresearchstructurestudywork
SHARED TOKENS (12): "basic", "components", "composition", "diseases", "essential", "fields", "function", "medical", "research", "structure", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.440
alreadyappliesapplycontroldesigndevicesfoundmaterialsciencescientificsystemsthem
SHARED TOKENS (12): "already", "applies", "apply", "control", "design", "devices", "found", "material", "science", "scientific", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.440
activityamongclassifieddoctoralenrollmentidahomeridianprogramspublicresearchstudentsuniversity
SHARED TOKENS (12): "activity", "among", "classified", "doctoral", "enrollment", "idaho", "meridian", "programs", "public", "research", "students", "university". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
0.440
consentdifferentfacilityinformationlaboratorymaterialmaterialsmedicalpeopleresearchtissuetypes
SHARED TOKENS (12): "consent", "different", "facility", "information", "laboratory", "material", "materials", "medical", "people", "research", "tissue", "types". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.420
activitiescannotcenterfunctionindependentindividualmedicalperformphysicalprocessquality
SHARED TOKENS (11): "activities", "cannot", "center", "function", "independent", "individual", "medical", "perform", "physical", "process", "quality". | EXACT TITLE in vision_optical: "Vision rehabilitation".
0.420
Broadband ↗ Q194163 EXACT TITLE
accesscharacteristicsdatadifferentimplementationnetworkproviderequirementstechnologytransferuses
SHARED TOKENS (11): "access", "characteristics", "data", "different", "implementation", "network", "provide", "requirements", "technology", "transfer", "uses". | EXACT TITLE in vision_optical: "Broadband".
0.420
characteristicsdevelopeddifferentdiseasesgrowthpossessproductssciencescientifictissuetools
SHARED TOKENS (11): "characteristics", "developed", "different", "diseases", "growth", "possess", "products", "science", "scientific", "tissue", "tools". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.420
Lens ↗ Q768575 EXACT TITLE
commondevicedevicesformimagingmaterialmaterialsmeansrequiredsinglevisible
SHARED TOKENS (11): "common", "device", "devices", "form", "imaging", "material", "materials", "means", "required", "single", "visible". | EXACT TITLE in vision_optical: "Lens".
0.400
LASIK ↗ Q278846 EXACT TITLE
anothercannotcommonlycreatepeopleprocedureprocedurestreatedtreatmentuses
SHARED TOKENS (10): "another", "cannot", "commonly", "create", "people", "procedure", "procedures", "treated", "treatment", "uses". | EXACT TITLE in vision_optical: "LASIK".
0.400
agencyboisedepartmentfederalgovernmentidahomaintainedqualityregionalregulations
SHARED TOKENS (10): "agency", "boise", "department", "federal", "government", "idaho", "maintained", "quality", "regional", "regulations". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.400
amendmentsapplybasicclinicalfederallaboratoryregulatoryresearchstandardstesting
SHARED TOKENS (10): "amendments", "apply", "basic", "clinical", "federal", "laboratory", "regulatory", "research", "standards", "testing". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.400
agenciescertificationeducationgovernmentindividualorientationprivatespecialiststrainingwork
SHARED TOKENS (10): "agencies", "certification", "education", "government", "individual", "orientation", "private", "specialists", "training", "work". | EXACT TITLE in vision_optical: "Orientation and Mobility".
0.380
agencybenefitsdepartmentdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (9): "agency", "benefits", "department", "development", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor". | EXACT TITLE in vision_optical: "Idaho Department of Labor".
0.380
chaptercodecodifiedfederalhealthlawpublictitlewelfare
SHARED TOKENS (9): "chapter", "code", "codified", "federal", "health", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.380
Phlebotomy ↗ Q3595842 EXACT TITLE
adultmedicalprocedureprocesspurposetechnicianstherapeutictreatmentvolume
SHARED TOKENS (9): "adult", "medical", "procedure", "process", "purpose", "technicians", "therapeutic", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.380
developeddevelopingdiseaseevenhighermedicalmonitoringpeopletreatment
SHARED TOKENS (9): "developed", "developing", "disease", "even", "higher", "medical", "monitoring", "people", "treatment". | EXACT TITLE in vision_optical: "Diabetic retinopathy".
0.360
Hazardous waste ↗ EXACT TITLE
commonhealthhumaninternationallocalmaterialsnationalregulated
SHARED TOKENS (8): "common", "health", "human", "international", "local", "materials", "national", "regulated". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.360
Refraction ↗ Q72277 EXACT TITLE
anotherchangecommonlyexperiencehumanmaterialsphysicalwater
SHARED TOKENS (8): "another", "change", "commonly", "experience", "human", "materials", "physical", "water". | EXACT TITLE in vision_optical: "Refraction".
0.340
carechildrendevelopmentdiseasesmedicinepediatrictreating
SHARED TOKENS (7): "care", "children", "development", "diseases", "medicine", "pediatric", "treating". | EXACT TITLE in vision_optical: "Pediatric ophthalmology".
0.340
Histology ↗ Q7168 EXACT TITLE
anatomydividedmedicineplacesstudytissuevisible
SHARED TOKENS (7): "anatomy", "divided", "medicine", "places", "study", "tissue", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.340
affectconditionsdiseasediseasesmanagementscientificstudy
SHARED TOKENS (7): "affect", "conditions", "disease", "diseases", "management", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.320
analysisapplieddatarelationshipssciencesystems
SHARED TOKENS (6): "analysis", "applied", "data", "relationships", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.320
associationcentersorganizationrelatedresearchserves
SHARED TOKENS (6): "association", "centers", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.320
becomeemploymenthealthoccupationsprocesssupport
SHARED TOKENS (6): "become", "employment", "health", "occupations", "process", "support". | EXACT TITLE in vision_optical: "Vocational rehabilitation".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare". | EXACT TITLE in vision_optical: "Idaho Department of Health and Welfare".
0.320
evenfunctionoperatesstructurestudysystems
SHARED TOKENS (6): "even", "function", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.310
federalgovernmenthealthmedicalmedicinenationalrelatedtechnical
SHARED TOKENS (8): "federal", "government", "health", "medical", "medicine", "national", "related", "technical". | URL->A (1): http://clinicaltrials.gov/.
0.300
Serology ↗ Q502159 EXACT TITLE
againstdiseaseresponsescientificstudy
SHARED TOKENS (5): "against", "disease", "response", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.300
Binocular vision ↗ EXACT TITLE
applicationsinfluencemedicalplacementscience
SHARED TOKENS (5): "applications", "influence", "medical", "placement", "science". | EXACT TITLE in vision_optical: "Binocular vision".
0.300
administeradministrationapplieddirectlydiseasesdrugdrugsinsidemeanspossibleprocessriskroutesitestandard
SHARED TOKENS (15): "administer", "administration", "applied", "directly", "diseases", "drug", "drugs", "inside", "means", "possible", "process", "risk", "route", "site", "standard".
0.300
advancedapproximatelycarecategorycertificationclassificationclinicalconnectiondiagnosticdifferentdistincteducationfacilitiesfieldshealthhospitalsinternationallicensingmedicinemodel
SHARED TOKENS (46): "advanced", "approximately", "care", "category", "certification", "classification", "clinical", "connection", "diagnostic", "different", "distinct", "education", "facilities", "fields", "health", "hospitals", "international", "licensing", "medicine", "model"....
0.300
analysisappliedarchitecturebeyondclinicalcommercialcomponentcomponentsdatadefinitiondependentdevelopmentdifferentequipmentevenfacilitiesfunctionsgenerallyimplementationinformation
SHARED TOKENS (46): "analysis", "applied", "architecture", "beyond", "clinical", "commercial", "component", "components", "data", "definition", "dependent", "development", "different", "equipment", "even", "facilities", "functions", "generally", "implementation", "information"....
0.300
amountconsequencescontroldevelopeddirectearlyexpansiongeneralgenerallygrowthhealthhistoryincreaselargepipelineproductproductionrolescalesmall
SHARED TOKENS (23): "amount", "consequences", "control", "developed", "direct", "early", "expansion", "general", "generally", "growth", "health", "history", "increase", "large", "pipeline", "product", "production", "role", "scale", "small"....
0.300
appliedbusinesscapitalcenterscollegescorporatedevelopmenteducationalemploymentgovernmenthigherinstitutionslocalmixnetworksplacesprivatepublicrelatedresearch
SHARED TOKENS (24): "applied", "business", "capital", "centers", "colleges", "corporate", "development", "educational", "employment", "government", "higher", "institutions", "local", "mix", "networks", "places", "private", "public", "related", "research"....
0.300
administrationapplyapprovalapprovedbenefitsboardclinicalcommercialcompleteconsentcontroldatademonstratedesigndevicedevicesdistributiondrugevaluationfda
SHARED TOKENS (49): "administration", "apply", "approval", "approved", "benefits", "board", "clinical", "commercial", "complete", "consent", "control", "data", "demonstrate", "design", "device", "devices", "distribution", "drug", "evaluation", "fda"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysiscompositiondistinctfoodformationfunctionsgenerallylargerequirementsscalescopesinglespecificallystructurestudysystemtissue
SHARED TOKENS (18): "activity", "analysis", "composition", "distinct", "food", "formation", "functions", "generally", "large", "requirements", "scale", "scope", "single", "specifically", "structure", "study", "system", "tissue".
0.300
Anti-VEGF ↗ Q23808471 KW CROSS HIGH
benefitsbestclinicalconsequencesdrugsgrowthhumanlaterpatientsratherreviewshowsmalltherapeutictreatmentvascular
SHARED TOKENS (16): "benefits", "best", "clinical", "consequences", "drugs", "growth", "human", "later", "patients", "rather", "review", "show", "small", "therapeutic", "treatment", "vascular".
0.300
Optic neuritis ↗ Q972514 KW CROSS HIGH
absenceclinicalcommonlycompletediagnosisdiseasediseasesimaginginformationmedicalmultiplepathwayspatientspracticereportresultstreatment
SHARED TOKENS (17): "absence", "clinical", "commonly", "complete", "diagnosis", "disease", "diseases", "imaging", "information", "medical", "multiple", "pathways", "patients", "practice", "report", "results", "treatment".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
applicationscareclassifiedclinicalcompositiondesigndiscoverydistributiondrugdrugsfunctionfunctionshealthmedicalpracticeresearchrolesciencespecificallysystems
SHARED TOKENS (21): "applications", "care", "classified", "clinical", "composition", "design", "discovery", "distribution", "drug", "drugs", "function", "functions", "health", "medical", "practice", "research", "role", "science", "specifically", "systems"....
0.300
alreadyamonganalysiscareclinicalcomplexdatadevelopmentdiagnosisdiseasedrughealthhealthcarehumanjobsmedicalmonitoringpatientpatientsplanning
SHARED TOKENS (29): "already", "among", "analysis", "care", "clinical", "complex", "data", "development", "diagnosis", "disease", "drug", "health", "healthcare", "human", "jobs", "medical", "monitoring", "patient", "patients", "planning"....
0.300
careclassificationcomponentdiagnosisdiagnosticdiseaseexplainshealthcarehistoryinformationmajormedicalpatientpatternsphysicalpossibleprocedureproceduresprocessprofessional
SHARED TOKENS (24): "care", "classification", "component", "diagnosis", "diagnostic", "disease", "explains", "healthcare", "history", "information", "major", "medical", "patient", "patterns", "physical", "possible", "procedure", "procedures", "process", "professional"....
0.300
benefitcomplexconcentrationdominantdrugdrugsinfluencemodelpharmaceuticalplacesrelationshipsrepresentsresponsestudytools
SHARED TOKENS (15): "benefit", "complex", "concentration", "dominant", "drug", "drugs", "influence", "model", "pharmaceutical", "places", "relationships", "represents", "response", "study", "tools".
0.300
alreadyanotherapplicationsassociatedbecomechangeconcerningconditionscreatecurrentdevelopingdevelopmentfieldsfoundimagingmajormedicalphysicalproblemsrelated
SHARED TOKENS (27): "already", "another", "applications", "associated", "become", "change", "concerning", "conditions", "create", "current", "developing", "development", "fields", "found", "imaging", "major", "medical", "physical", "problems", "related"....
0.300
broadercategorychildrenclassifiedcommunitycompletecomplexconcussiondiagnosisemergencyemploymentexternalflowimaginglatermajormechanismoccupationalphysicalrequired
SHARED TOKENS (25): "broader", "category", "children", "classified", "community", "complete", "complex", "concussion", "diagnosis", "emergency", "employment", "external", "flow", "imaging", "later", "major", "mechanism", "occupational", "physical", "required"....
0.300
affectapplicationscareconditionscontrolcoveringdiagnosisdifferentdiseasefoodhealthhumanmaintainmanagementmedicalmedicinemonitoringphysicianprofessionalresearch
SHARED TOKENS (29): "affect", "applications", "care", "conditions", "control", "covering", "diagnosis", "different", "disease", "food", "health", "human", "maintain", "management", "medical", "medicine", "monitoring", "physician", "professional", "research"....
0.300
availabilityconsumergeneralhigherinformationmultipleneedsonlineoperatorprocessproductproductionproductsproviderssegmentsinglesitetypesusers
SHARED TOKENS (19): "availability", "consumer", "general", "higher", "information", "multiple", "needs", "online", "operator", "process", "product", "production", "products", "providers", "segment", "single", "site", "types", "users".
0.300
carechangeconcerningconsentcoveredfamilyfederalgenerallygovernsguidelineshealthhealthcareinformationinsurancejobslawmaintainedmedicalmembersnational
SHARED TOKENS (29): "care", "change", "concerning", "consent", "covered", "family", "federal", "generally", "governs", "guidelines", "health", "healthcare", "information", "insurance", "jobs", "law", "maintained", "medical", "members", "national"....
0.300
amongcommondegreedependsdiagnosisdiseasedistinctestablishedfaceincreasemakesmeansmedicalpeoplepopulationproductionrisksystemtreatment
SHARED TOKENS (19): "among", "common", "degree", "depends", "diagnosis", "disease", "distinct", "established", "face", "increase", "makes", "means", "medical", "people", "population", "production", "risk", "system", "treatment".
0.300
Orthoptics ↗ Q1241279 KW CROSS HIGH
adultcarecommonlyconditionsdiagnosisdiseasemanagementmonitoringmultiplepatientspracticeproblemstrainedtrainingtreatingtreatmentwork
SHARED TOKENS (17): "adult", "care", "commonly", "conditions", "diagnosis", "disease", "management", "monitoring", "multiple", "patients", "practice", "problems", "trained", "training", "treating", "treatment", "work".
0.300
Astigmatism ↗ Q177895 KW CROSS HIGH
affectapplychangecomponentsdiagnosisdifferentearlyevenhigherlatermechanismpeopleprovidereportedrequiressingletreatment
SHARED TOKENS (17): "affect", "apply", "change", "components", "diagnosis", "different", "early", "even", "higher", "later", "mechanism", "people", "provide", "reported", "requires", "single", "treatment".
0.300
anotherbecomecommoncompetitioncomplexconsolidationdescribeddifferentdirectlyinternationallargemanagementmarketneedownershipportionspositionproductproductsrather
SHARED TOKENS (23): "another", "become", "common", "competition", "complex", "consolidation", "described", "different", "directly", "international", "large", "management", "market", "need", "ownership", "portions", "position", "product", "products", "rather"....
0.300
amountanalysisanatomyannualanotherclinicaldatadesigneddevicesdiseaseequipmentestablishesfunctiongraphimaginginstrumentinstrumentationinternalmedicalpatient
SHARED TOKENS (26): "amount", "analysis", "anatomy", "annual", "another", "clinical", "data", "designed", "devices", "disease", "equipment", "establishes", "function", "graph", "imaging", "instrument", "instrumentation", "internal", "medical", "patient"....
0.300
affectalreadychangecommoncommonlycompletedetaileddiseasedividedearlyformgrowthincreasepeoplepopulationriskrolesmalltreatmenttypes
SHARED TOKENS (21): "affect", "already", "change", "common", "commonly", "complete", "detailed", "disease", "divided", "early", "form", "growth", "increase", "people", "population", "risk", "role", "small", "treatment", "types"....
0.300
amountcapacitycenterchangedistinctearlyformintendedlayerpatientplacementpositionprocedureproceduresrapidlyremainsmallspecificationssystemtissue
SHARED TOKENS (20): "amount", "capacity", "center", "change", "distinct", "early", "form", "intended", "layer", "patient", "placement", "position", "procedure", "procedures", "rapidly", "remain", "small", "specifications", "system", "tissue".
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
agenciesapplicationscenterscharacteristicscomplexconditionscreatedevelopingdevelopmentdifferentdiseasefoodgovernmenthigherinstitutionsinternationalknowledgeorganizationsprocessingproducts
SHARED TOKENS (26): "agencies", "applications", "centers", "characteristics", "complex", "conditions", "create", "developing", "development", "different", "disease", "food", "government", "higher", "institutions", "international", "knowledge", "organizations", "processing", "products"....
0.300
concerningconsentdepartmenteducationessentialfederalfundinggeneralgovernmentguidelineshealthhealthcarehumanmattersmedicalmissionprivatepublicseparatesystem
SHARED TOKENS (21): "concerning", "consent", "department", "education", "essential", "federal", "funding", "general", "government", "guidelines", "health", "healthcare", "human", "matters", "medical", "mission", "private", "public", "separate", "system"....
0.300
applicationsappliedassociateddifferentformationfunctionsmaintainmaterialsmedicalmedicineperformportionspracticepurposerequirescopesupportsystemtissuetypes
SHARED TOKENS (21): "applications", "applied", "associated", "different", "formation", "functions", "maintain", "materials", "medical", "medicine", "perform", "portions", "practice", "purpose", "require", "scope", "support", "system", "tissue", "types"....
0.300
accessactivitiesadministrationagencyannouncedassociationcapacitycenterscontroldepartmentdesigneddevelopingdiseasediseaseseducationalfederalfoodgovernmentheadquarteredhealth
SHARED TOKENS (41): "access", "activities", "administration", "agency", "announced", "association", "capacity", "centers", "control", "department", "designed", "developing", "disease", "diseases", "educational", "federal", "food", "government", "headquartered", "health"....
0.300
amongcareclinicalcollectioncombinescombiningconditionsdatadesigneddifferenthealthhealthcarehistoryinformationlaboratorylargemeansmedicalmultipleneed
SHARED TOKENS (41): "among", "care", "clinical", "collection", "combines", "combining", "conditions", "data", "designed", "different", "health", "healthcare", "history", "information", "laboratory", "large", "means", "medical", "multiple", "need"....
0.300
activitycomponentsconditionsdifferentedgemeasuredmedicalnearpatientpatternpositiveresponseresultingsmallstandardizedsystemtypes
SHARED TOKENS (17): "activity", "components", "conditions", "different", "edge", "measured", "medical", "near", "patient", "pattern", "positive", "response", "resulting", "small", "standardized", "system", "types".
0.300
automatedgenerallypatientphysicianspecified
SHARED TOKENS (5): "automated", "generally", "patient", "physician", "specified". | EXACT TITLE in vision_optical: "Eyeglass prescription".
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
commonlyconditionsdevelopmentessentialformgenerallygrowthhistoricalisolatedlaboratorymaintainedneedoutsidepopulationpracticeprocessregulatesrelatedrequiresingle
SHARED TOKENS (24): "commonly", "conditions", "development", "essential", "form", "generally", "growth", "historical", "isolated", "laboratory", "maintained", "need", "outside", "population", "practice", "process", "regulates", "related", "require", "single"....
0.300
amendmentsbenefitscannotcareconditionscoverededucationeligibilityemployer-basedessentialestimatesexpansionfederalfoundfundinghealthhealthcareincreaseindividualinsurance
SHARED TOKENS (48): "amendments", "benefits", "cannot", "care", "conditions", "covered", "education", "eligibility", "employer-based", "essential", "estimates", "expansion", "federal", "found", "funding", "health", "healthcare", "increase", "individual", "insurance"....
0.300
academicaccessagenciesannualapplicationsapproximatelycapitalcovereddevelopeddevelopmentdiscoverydiseasedistinctdocumenteddrugdrugseducationessentialevaluationexpansion
SHARED TOKENS (54): "academic", "access", "agencies", "annual", "applications", "approximately", "capital", "covered", "developed", "development", "discovery", "disease", "distinct", "documented", "drug", "drugs", "education", "essential", "evaluation", "expansion"....
0.300
Presbyopia ↗ Q319595 KW CROSS HIGH
associatedawaybecomecommondegreedevelopingdiagnosisdifferentexperiencematerialmedicalmovepeopleproblemsprocessratherresultsrisksmalltreatment
SHARED TOKENS (21): "associated", "away", "become", "common", "degree", "developing", "diagnosis", "different", "experience", "material", "medical", "move", "people", "problems", "process", "rather", "results", "risk", "small", "treatment"....
0.300
caredevelopmentdiseasefoundsupport
SHARED TOKENS (5): "care", "development", "disease", "found", "support". | EXACT TITLE in vision_optical: "Retinopathy of prematurity".
0.300
administrationannualapprovalcenterclinicalcompliancedrugevaluationfacilitiesfdafoodforminformationlegallicensemanufacturingproductproductsregulatedrequirements
SHARED TOKENS (24): "administration", "annual", "approval", "center", "clinical", "compliance", "drug", "evaluation", "facilities", "fda", "food", "form", "information", "legal", "license", "manufacturing", "product", "products", "regulated", "requirements"....
0.300
addresscarecategoriescommunitiescurrentdevelopedformhealthhealthcaremedicalpatientsproductproductspurchasingrequirementssectorsectorssharesystemteams
SHARED TOKENS (20): "address", "care", "categories", "communities", "current", "developed", "form", "health", "healthcare", "medical", "patients", "product", "products", "purchasing", "requirements", "sector", "sectors", "share", "system", "teams".
0.300
acquisitionacquisitionsactivityanotherassetsbusinesscapitalcompetitionconsolidationcontrolcorporatecreatedepartmentdescribeddirecteconomicallyfederalgovernmentinterestslaw
SHARED TOKENS (39): "acquisition", "acquisitions", "activity", "another", "assets", "business", "capital", "competition", "consolidation", "control", "corporate", "create", "department", "described", "direct", "economically", "federal", "government", "interests", "law"....
0.300
agencyapprovedassessmentcommitteedepartmenteducationenforcementestablishingfederalgovernmenthearingsindependentinformationlaboratorieslegallocalmattersmonitoringnationalprograms
SHARED TOKENS (28): "agency", "approved", "assessment", "committee", "department", "education", "enforcement", "establishing", "federal", "government", "hearings", "independent", "information", "laboratories", "legal", "local", "matters", "monitoring", "national", "programs"....
0.300
Water quality ↗ Q625376 KW CROSS HIGH
againstassessmentcharacteristicscommoncompliancegenerallyhealthhumanphysicalqualitysignificantstandardssupplytreatmentwater
SHARED TOKENS (15): "against", "assessment", "characteristics", "common", "compliance", "generally", "health", "human", "physical", "quality", "significant", "standards", "supply", "treatment", "water".
0.300
boardcentercenterscertificationchildrencompletedegreedepartmenteducationfederalformalfundinggovernmentgraduatehealthhospitalhospital-basedhospitalsindependentlylicensure
SHARED TOKENS (32): "board", "center", "centers", "certification", "children", "complete", "degree", "department", "education", "federal", "formal", "funding", "government", "graduate", "health", "hospital", "hospital-based", "hospitals", "independently", "licensure"....
0.300
activeagainstapprovalbasicbecomeclinicalcommercialcommoncomplexdevelopeddevelopmentdiscoverydrugdrugsexperiencefieldsfundinggrantshealthhuman
SHARED TOKENS (47): "active", "against", "approval", "basic", "become", "clinical", "commercial", "common", "complex", "developed", "development", "discovery", "drug", "drugs", "experience", "fields", "funding", "grants", "health", "human"....
0.300
activitiesappearsassociatedcapablecarecharacteristicsclinicalclinicscommondescribeddetaileddevicesdiagnosisdiseasesdistinctemergencyfacilitiesgeneralhealthhealthcare
SHARED TOKENS (39): "activities", "appears", "associated", "capable", "care", "characteristics", "clinical", "clinics", "common", "described", "detailed", "devices", "diagnosis", "diseases", "distinct", "emergency", "facilities", "general", "health", "healthcare"....
0.300
accesscenterscontroldiseaseequipmentestablishedfacilitiesfacilityhealthhigherlaboratorieslaboratorymultiplepersonnelpositiveproceduresprotectionpublicationrequiredrooms
SHARED TOKENS (23): "access", "centers", "control", "disease", "equipment", "established", "facilities", "facility", "health", "higher", "laboratories", "laboratory", "multiple", "personnel", "positive", "procedures", "protection", "publication", "required", "rooms"....
0.300
agencyappliedbuildingclassificationcommercialconnectionsconstructiondegreedesigndevelopmentfunctionsinstitutionalmultipleplanningpolicyprivateprojectsresidentialsinglesite
SHARED TOKENS (24): "agency", "applied", "building", "classification", "commercial", "connections", "construction", "degree", "design", "development", "functions", "institutional", "multiple", "planning", "policy", "private", "projects", "residential", "single", "site"....
0.300
changemaintainnearpositionprocess
SHARED TOKENS (5): "change", "maintain", "near", "position", "process". | EXACT TITLE in vision_optical: "Accommodation (vertebrate eye)".
0.300
Farsightedness ↗ Q177254 KW CROSS HIGH
absencebestchildrencommondiagnosisexperiencefamilyhistorymanagementnearpatientspeoplepositionproviderisktreatmenttypes
SHARED TOKENS (17): "absence", "best", "children", "common", "diagnosis", "experience", "family", "history", "management", "near", "patients", "people", "position", "provide", "risk", "treatment", "types".
0.300
accessibleappointmentcarecategorycentercentersclinicclinicscommunityconditionsevenfacilityhealthhealthcarehospitalsmedicalpatientpatientsphysicianspossible
SHARED TOKENS (23): "accessible", "appointment", "care", "category", "center", "centers", "clinic", "clinics", "community", "conditions", "even", "facility", "health", "healthcare", "hospitals", "medical", "patient", "patients", "physicians", "possible"....
0.300
administrationagenciesauthorizationcodifiedcoordinationdepartmenteducationemploymentestablishextendfederalgovernmentgrantshealthlawpracticesprincipalprogramsrequiresresearch
SHARED TOKENS (24): "administration", "agencies", "authorization", "codified", "coordination", "department", "education", "employment", "establish", "extend", "federal", "government", "grants", "health", "law", "practices", "principal", "programs", "requires", "research"....
0.300
accessibilityadaagainstbusinesscharacteristicscoveredidentityinterestslaterlawnationalorientationprotectionprovidepublicrequirementsrequires
SHARED TOKENS (17): "accessibility", "ada", "against", "business", "characteristics", "covered", "identity", "interests", "later", "law", "national", "orientation", "protection", "provide", "public", "requirements", "requires".
0.300
beyondbusinessdevelopingearlyexternalfacefundinggrowthinfluencelargemodelprivateprojectpublicsignificant
SHARED TOKENS (15): "beyond", "business", "developing", "early", "external", "face", "funding", "growth", "influence", "large", "model", "private", "project", "public", "significant".
0.300
commoncommonlydevicedirectlyface
SHARED TOKENS (5): "common", "commonly", "device", "directly", "face". | EXACT TITLE in vision_optical: "Corrective lens".
0.300
applicationsapplycodedesigndetaileddevelopingevenfieldsfoundfunctiongeneralknowledgemarketmedicineprocessproductproductionresearchstructure
SHARED TOKENS (19): "applications", "apply", "code", "design", "detailed", "developing", "even", "fields", "found", "function", "general", "knowledge", "market", "medicine", "process", "product", "production", "research", "structure".
0.300
administersagencyapproximatelycommercialcommunitiescomponentcurrentdepartmentdirectlyfederalfoodgovernmentnationalneedsproductionprogramprogramsresourcestrade
SHARED TOKENS (19): "administers", "agency", "approximately", "commercial", "communities", "component", "current", "department", "directly", "federal", "food", "government", "national", "needs", "production", "program", "programs", "resources", "trade".
0.300
basiccharacteristicsclinicalcomponentsdatadiagnosisflowfunctionhealthinstrumentphysicalpopulationpracticeprocessresearchsampleseparateuses
SHARED TOKENS (18): "basic", "characteristics", "clinical", "components", "data", "diagnosis", "flow", "function", "health", "instrument", "physical", "population", "practice", "process", "research", "sample", "separate", "uses".
0.300
analysisapplicationsbecomebuildingcommonconstructiondetaileddevelopeddiagnosisdifferentdiseasesessentialexposesisolatedlaboratorymedicalmonitoringproceduresprocessrapidly
SHARED TOKENS (29): "analysis", "applications", "become", "building", "common", "construction", "detailed", "developed", "diagnosis", "different", "diseases", "essential", "exposes", "isolated", "laboratory", "medical", "monitoring", "procedures", "process", "rapidly"....
0.300
deviceinstrumentresearchscientificstudy
SHARED TOKENS (5): "device", "instrument", "research", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.300
Visual system ↗ Q558363 KW CROSS HIGH
absenceassessmentassociatedcompletecomplexconcerningcoordinationdescribesdividedformationfunctionsguidancehigherhumanindependentinformationmodelpatternprocessprocessing
SHARED TOKENS (24): "absence", "assessment", "associated", "complete", "complex", "concerning", "coordination", "describes", "divided", "formation", "functions", "guidance", "higher", "human", "independent", "information", "model", "pattern", "process", "processing"....
0.300
administrationagencyconditionsdepartmenteducationemploymentestablishedfederalhealthlaborlawmissionoccupationalregulationsregulatorystandardstraining
SHARED TOKENS (17): "administration", "agency", "conditions", "department", "education", "employment", "established", "federal", "health", "labor", "law", "mission", "occupational", "regulations", "regulatory", "standards", "training".
0.300
Optical fiber ↗ Q162 KW CROSS HIGH
anotherapplicationsappliedcarefulcommoncomplexconnectionconnectionscoredatademanddesigndesignedgenerallyhigherimaginginternallinkslowermaterial
SHARED TOKENS (27): "another", "applications", "applied", "careful", "common", "complex", "connection", "connections", "core", "data", "demand", "design", "designed", "generally", "higher", "imaging", "internal", "links", "lower", "material"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherbusinesscapitalconditionscorporatedirectexpansionexplicitlygrowthindividuallargelegallicensingmarketmeansmodeloutletspracticeproceduresproducts
SHARED TOKENS (27): "another", "business", "capital", "conditions", "corporate", "direct", "expansion", "explicitly", "growth", "individual", "large", "legal", "licensing", "market", "means", "model", "outlets", "practice", "procedures", "products"....
0.300
anotherapplicableapplicationscannotcategoriesclinicalcombiningdiagnosisdiagnosticdiseasesdrawemergencygenerallyhospitalshumanimaginginformationmedicalpatientspositive
SHARED TOKENS (33): "another", "applicable", "applications", "cannot", "categories", "clinical", "combining", "diagnosis", "diagnostic", "diseases", "draw", "emergency", "generally", "hospitals", "human", "imaging", "information", "medical", "patients", "positive"....
0.300
anatomyanotherapplicationscommondiseasesfoodhealthhumaninformationmajormedicinepharmaceuticalphysicalqualityscalesciencescientificstandardstudy
SHARED TOKENS (19): "anatomy", "another", "applications", "common", "diseases", "food", "health", "human", "information", "major", "medicine", "pharmaceutical", "physical", "quality", "scale", "science", "scientific", "standard", "study".
0.300
activitiesassociateddesignedexperiencedformfunctioninsidelocalmaterialmaterialsneedotherwisepatientpatientsproblemsprocedureproceduresprovidesidesmall
SHARED TOKENS (22): "activities", "associated", "designed", "experienced", "form", "function", "inside", "local", "material", "materials", "need", "otherwise", "patient", "patients", "problems", "procedure", "procedures", "provide", "side", "small"....
0.300
activitiesadministrationcorporatecurrentgovernmentmedicinenationaloperateoperatingorganizationorganizationspolicypublicresearchscientificservesstatusunified
SHARED TOKENS (18): "activities", "administration", "corporate", "current", "government", "medicine", "national", "operate", "operating", "organization", "organizations", "policy", "public", "research", "scientific", "serves", "status", "unified".
0.300
Cold chain ↗ KW CROSS HIGH
activitiesassociatedchainscommondistributeddistributionequipmentfoodmaintainmanagementpharmaceuticalproductionproductsqualityrequiresstoragesupplyuses
SHARED TOKENS (18): "activities", "associated", "chains", "common", "distributed", "distribution", "equipment", "food", "maintain", "management", "pharmaceutical", "production", "products", "quality", "requires", "storage", "supply", "uses".
0.300
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidahosquarewestern
SHARED TOKENS (5): "approximately", "boise", "idaho", "square", "western". | EXACT TITLE in biotech_life_sciences: "Boise River".
0.300
activitiesamonganalysisanothercentercompletecomplexcomponentcomponentsconcerningconstructionconventionalcreatedatadescriptiondetaileddifferentdiseaseessentialexternal
SHARED TOKENS (50): "activities", "among", "analysis", "another", "center", "complete", "complex", "component", "components", "concerning", "construction", "conventional", "create", "data", "description", "detailed", "different", "disease", "essential", "external"....
0.300
Technology transfer ↗ KW CROSS HIGH
academicactivityanalysisanotherbenefitcapacitycommercialconnectingcontrolcoredefinitiondevelopmentestablishesfundingglobalgovernmentinfluenceinstitutionsinstrumentinterests
SHARED TOKENS (40): "academic", "activity", "analysis", "another", "benefit", "capacity", "commercial", "connecting", "control", "core", "definition", "development", "establishes", "funding", "global", "government", "influence", "institutions", "instrument", "interests"....
0.300
amongdecisionsdevelopmentdiagnosticdifferentdiseasehealthidentifiedindividualmedicalmedicinemodelnationalorganizationspatientpatientspeoplepracticesproductsprovide
SHARED TOKENS (26): "among", "decisions", "development", "diagnostic", "different", "disease", "health", "identified", "individual", "medical", "medicine", "model", "national", "organizations", "patient", "patients", "people", "practices", "products", "provide"....
🫐 BERRY44 edges
0.280
activitiesaffectcategoriesdesignateddiseaseestablishedhealthhumanmultipleproblemsqualityriskstandardstypes
SHARED TOKENS (14): "activities", "affect", "categories", "designated", "disease", "established", "health", "human", "multiple", "problems", "quality", "risk", "standards", "types".
0.280
Forage ↗ Q13377214 EXACT TITLE
annualdefinitiondirectlymaterial
SHARED TOKENS (4): "annual", "definition", "directly", "material". | EXACT TITLE in biotech_life_sciences: "Forage".
0.280
absenceaffectcommonconditionsdevicediagnosisformindividualmemberspeoplephysicalresearchtraintypes
SHARED TOKENS (14): "absence", "affect", "common", "conditions", "device", "diagnosis", "form", "individual", "members", "people", "physical", "research", "train", "types".
0.280
Nyctalopia ↗ Q7758678 KW CROSS HIGH
absenceanotherbestcommondescribeddiseasesfoundfunctionpatientsproductsrequireresultingresultswork
SHARED TOKENS (14): "absence", "another", "best", "common", "described", "diseases", "found", "function", "patients", "products", "require", "resulting", "results", "work".
0.280
amendmentsapplicationsclinicaldesigneddevelopeddiagnosticintendedinternallaboratorymedicalprogramregulatedresearchsingle
SHARED TOKENS (14): "amendments", "applications", "clinical", "designed", "developed", "diagnostic", "intended", "internal", "laboratory", "medical", "program", "regulated", "research", "single".
0.280
beyondclassifiedcomponentsexperienceformformationinformationprocessresearchresultingsciencesurroundingsystemvisible
SHARED TOKENS (14): "beyond", "classified", "components", "experience", "form", "formation", "information", "process", "research", "resulting", "science", "surrounding", "system", "visible".
0.280
conditionscoveringdevelopmentdiagnosishealthimagingmedicalplanningprocedurequalityresultsstructurethereforetreatment
SHARED TOKENS (14): "conditions", "covering", "development", "diagnosis", "health", "imaging", "medical", "planning", "procedure", "quality", "results", "structure", "therefore", "treatment".
0.280
Biomarker ↗ EXACT TITLE
fieldsmeasuredscientifictherapeutic
SHARED TOKENS (4): "fields", "measured", "scientific", "therapeutic". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.280
adjacentcorporateindependentinternational
SHARED TOKENS (4): "adjacent", "corporate", "independent", "international". | EXACT TITLE in vision_optical: "LensCrafters".
0.280
carecorporateforminternational
SHARED TOKENS (4): "care", "corporate", "form", "international". | EXACT TITLE in vision_optical: "Pearle Vision".
0.260
activityaffectanothercommondifferentfieldsinstrumentmaterialsorientationpossiblerelationshipssciencesingle
SHARED TOKENS (13): "activity", "affect", "another", "common", "different", "fields", "instrument", "materials", "orientation", "possible", "relationships", "science", "single".
0.260
centercentersdepartmentearlyenterfacilityhospitalhospitalslowerpatientsphysicianprocedurerequire
SHARED TOKENS (13): "center", "centers", "department", "early", "enter", "facility", "hospital", "hospitals", "lower", "patients", "physician", "procedure", "require".
0.260
childrenconditionsdevelopment
SHARED TOKENS (3): "children", "conditions", "development". | EXACT TITLE in vision_optical: "Ptosis (eyelid)".
0.260
federalgoverninglaw
SHARED TOKENS (3): "federal", "governing", "law". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.260
administrationapprovedclinicaldrugfoodhumaninternationalmeanspharmaceuticalproceduresprogramregulationsregulatory
SHARED TOKENS (13): "administration", "approved", "clinical", "drug", "food", "human", "international", "means", "pharmaceutical", "procedures", "program", "regulations", "regulatory".
0.260
administrationbenefitconcentrationdedicateddescribingdrugdrugsfoodinfluencepharmaceuticalplacesrelationshipstudy
SHARED TOKENS (13): "administration", "benefit", "concentration", "dedicated", "describing", "drug", "drugs", "food", "influence", "pharmaceutical", "places", "relationship", "study".
0.260
Biophysics ↗ Q7100 EXACT TITLE
appliessciencestudy
SHARED TOKENS (3): "applies", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.260
Stereopsis ↗ Q247932 KW CROSS HIGH
differentextendflowinformationoutsideprocessingrelationshipsresearchresultingrolesciencesinglespace
SHARED TOKENS (13): "different", "extend", "flow", "information", "outside", "processing", "relationships", "research", "resulting", "role", "science", "single", "space".
0.240
Keratoconus ↗ Q611984 KW CROSS HIGH
approvedcannotcommondiagnosisearlyestimatesfdamedicalpeoplepopulationsqualityrisk
SHARED TOKENS (12): "approved", "cannot", "common", "diagnosis", "early", "estimates", "fda", "medical", "people", "populations", "quality", "risk".
0.240
automatedconditionsdedicateddetaileddirectlydiseaseequipmentmedicalpatientplacessubjecttesting
SHARED TOKENS (12): "automated", "conditions", "dedicated", "detailed", "directly", "disease", "equipment", "medical", "patient", "places", "subject", "testing".
0.220
Medical test ↗ Q2671652 KW CROSS HIGH
analysisclinicaldiagnosticdiseasediseasesimagingmedicalphysicalproceduretestingtreatment
SHARED TOKENS (11): "analysis", "clinical", "diagnostic", "disease", "diseases", "imaging", "medical", "physical", "procedure", "testing", "treatment".
0.220
convergencesystem
SHARED TOKENS (2): "convergence", "system". | EXACT TITLE in vision_optical: "Convergence insufficiency".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
commonlyfamily
SHARED TOKENS (2): "commonly", "family". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.220
becomecapabilitydiagnosisdifferentdiseasesmedicinemultiplepossiblesitesspecificallytreatment
SHARED TOKENS (11): "become", "capability", "diagnosis", "different", "diseases", "medicine", "multiple", "possible", "sites", "specifically", "treatment".
0.220
adjacentassociatedcarecommoncommonlygeneralhigherpatientsproceduretissuetreatment
SHARED TOKENS (11): "adjacent", "associated", "care", "common", "commonly", "general", "higher", "patients", "procedure", "tissue", "treatment".
0.220
Seed testing ↗ Q7445654 KW CROSS HIGH
analysiscommondedicateddesignedlaboratoriesqualityresearchscientificstoragetestingtrained
SHARED TOKENS (11): "analysis", "common", "dedicated", "designed", "laboratories", "quality", "research", "scientific", "storage", "testing", "trained".
0.200
commonlygeneralgenerallyhospitalpatientpediatricpreparationprocedurereturntrained
SHARED TOKENS (10): "commonly", "general", "generally", "hospital", "patient", "pediatric", "preparation", "procedure", "return", "trained".
0.200
Sunglasses ↗ Q217541 KW CROSS HIGH
againstassociationdesignedearlyformfunctionproblemsproceduresprotectionvisible
SHARED TOKENS (10): "against", "association", "designed", "early", "form", "function", "problems", "procedures", "protection", "visible".
0.200
academicdegreeeducationgraduatehigherprofessionalqualificationsschoolstudentsundergraduate
SHARED TOKENS (10): "academic", "degree", "education", "graduate", "higher", "professional", "qualifications", "school", "students", "undergraduate".
0.180
Ophthalmoscopy ↗ Q837188 KW CROSS HIGH
carecommonhealthinsidelaterperformphysicalprofessionalroutine
SHARED TOKENS (9): "care", "common", "health", "inside", "later", "perform", "physical", "professional", "routine".
0.180
Diplopia ↗ Q775940 KW CROSS HIGH
cannotconditionsdiseasefunctionpathwaysproblemsprocessresultssingle
SHARED TOKENS (9): "cannot", "conditions", "disease", "function", "pathways", "problems", "process", "results", "single".
0.160
differentformpathwaysrelationshiprelationshipsstudythemtypes
SHARED TOKENS (8): "different", "form", "pathways", "relationship", "relationships", "study", "them", "types".
0.160
affectdiseaseshealthindividualmeansphysiciansproceduretissue
SHARED TOKENS (8): "affect", "diseases", "health", "individual", "means", "physicians", "procedure", "tissue".
0.140
agencycertificationeducationalperformprofessionalpublictrade
SHARED TOKENS (7): "agency", "certification", "educational", "perform", "professional", "public", "trade".
0.140
classifiedinformationmajornearpossiblesmallersystem
SHARED TOKENS (7): "classified", "information", "major", "near", "possible", "smaller", "system".
0.140
careevaluationinsidepatientsperformprocedurerisk
SHARED TOKENS (7): "care", "evaluation", "inside", "patients", "perform", "procedure", "risk".
0.120
Slit lamp ↗ Q965041 KW CROSS HIGH
conditionsdevicehumaninstrumentsegmentsource
SHARED TOKENS (6): "conditions", "device", "human", "instrument", "segment", "source".
0.120
absenceanothercommonlyconditionsreturnvisible
SHARED TOKENS (6): "absence", "another", "commonly", "conditions", "return", "visible".
0.120
Select agent ↗ KW CROSS HIGH
departmentdividedhealthhumanlawpublic
SHARED TOKENS (6): "department", "divided", "health", "human", "law", "public".
0.120
applicationscarehealthpatientriskspecialized
SHARED TOKENS (6): "applications", "care", "health", "patient", "risk", "specialized".
0.120
becomebenefitsdiseasesdrugsproceduretherapeutic
SHARED TOKENS (6): "become", "benefits", "diseases", "drugs", "procedure", "therapeutic".
0.100
adjacentawaycenterlargeoutside
SHARED TOKENS (5): "adjacent", "away", "center", "large", "outside".
0.100
becomediseaseformsourcesupply
SHARED TOKENS (5): "become", "disease", "form", "source", "supply".
0.100
dependsdesigngeneralhigherpatient
SHARED TOKENS (5): "depends", "design", "general", "higher", "patient".
◈ Frequently Asked Questions
Biotech Life Sciences × Vision Optical — Treasure Valley
HAIKU · HIGH GATE
How do medical device manufacturers in Ada County and Canyon County coordinate with biotech companies on regulatory compliance?
Both biotech life sciences firms and vision optical device makers in the Treasure Valley must navigate FDA approval pathways for products sold through Centers for Medicare & Medicaid Services networks. Trinity Health facilities across Boise, Nampa, and Caldwell serve as testing and implementation sites where these two sectors validate medical devices before market deployment.
What role does College of Western Idaho play for biotech and vision optical workforce development in the Boise metropolitan area?
College of Western Idaho delivers laboratory and technical training programs that supply skilled workers to both biotech life sciences companies and vision optical manufacturers operating in Ada County and Canyon County. The college's partnerships with these industries create direct pathways from classroom to employment in the Treasure Valley's growing medical device sector.
How do private equity investors view biotech life sciences and vision optical opportunities together in the Treasure Valley?
Private equity firms recognize that biotech life sciences innovation and vision optical medical device manufacturing both operate within the same regulatory and healthcare infrastructure across the Boise metropolitan area, particularly in Meridian and Nampa. Combined investment in these sectors allows capital to leverage shared FDA compliance expertise and Trinity Health's presence as both a buyer and validator of new products.
Why do biotech companies and vision optical firms locate near each other in the Treasure Valley?
The Boise, Idaho region offers both sectors access to the same FDA-regulated medical device supply chains, CMS reimbursement networks, and laboratory infrastructure centered in Ada County. Proximity to College of Western Idaho, Trinity Health operations, and the concentrated population of the Treasure Valley reduces operational costs for companies serving the western Idaho capital market.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Biotech Life Sciences × Vision Optical 15 QID bridges 253 edges 7,143 ext links 2026-07-17 19:48:12 UTC d5dd871f079ca9de
Biotech Life Sciences corridor ↗ Vision Optical corridor ↗ Vision Optical × Biotech Life Sciences ↗ boisestandard.org/standard ↗
Parent Corridors
Biotech Life Sciences × All Other Verticals