—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Biotech Life Sciences ↔ relates to ↔ Healthcare

18 Wikipedia bridge articles confirmed in both vertical ledgers. 347 deterministic cross-vertical edges. 9,947 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
347 Cross Edges
9,947 External Sources
390 Wikipedia Articles
19 🌲 Evergreen
232 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Biotech Life Sciences
× Healthcare
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
347
External Sources Harvested
9,947
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (18)
IdahoIdaho State UniversityUniversity of IdahoImmunologyPharmacyMedical deviceBoise State UniversityPathologyVaccineTreasure ValleyCenters for Medicare & Medicaid ServicesIdaho Department of Health and WelfareBoise, IdahoNampa, IdahoAda County, IdahoCaldwell, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationcapitalclassifiedpublicresearchuniversityhomenorthwestsignificantwesternmeridianprogramsstudysystemclinicalpracticesafetymajor
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:45:05 UTC
Content Hash
b197b9b29343b81b
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (19): "agriculture", "best", "boise", "capital", "early", "idaho", "land", "million", "national", "northwest", "organized", "pacific", "people", "population", "products", "significant", "small", "technology", "western". | EXACT TITLE in biotech_life_sciences: "Idaho". | EXACT TITLE in healthcare: "Idaho".
agriculturebestboisecapitalearlyidaholandmillionnationalnorthwestorganizedpacificpeoplepopulationproductssignificantsmalltechnologywestern
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
In 2025, the gross state product (state GDP) for Idaho was $135.5 billion and the state's per capita personal income was $64,846. Idaho had the 39th highest GDP per capita in the United States of America in 2025. In 2025, small businesses made up 99.2% and employed 56.0% of the state's work force. As of May 2025, the state's unemployment rate was 3.6%. Total employment in Idaho in 2024 was 965,824. Idaho is the top potato producing state in the United States and almost one-third of the nation's potatoes are grown in the Snake River Plain, a belt of low-lying land that extends across southern Idaho. Important industries in Idaho are food processing, lumber and wood products, machinery, chemical products, paper products, electronics manufacturing, silver and other mining, and tourism. The world's largest factory for barrel cheese, the raw product for processed cheese, is in Gooding, Idaho. It has a capacity of 120,000 metric tons per year of barrel cheese and belongs to the Glanbia group. As Idaho neared statehood, mining and other extractive industries played a significant role in its economy. Although the state's reliance on mining has diminished over time, Idaho remains renowned as "The Gem State" due to its production of seventy-two varieties of precious and semi-precious stones. Idaho is a leading national producer of potatoes, trout, Austrian winter peas, and lentils. The state's primary industries include manufacturing, agriculture, food processing, timber, and mining. Tourism is another way that Idaho capitalizes on its natural resources.
nd the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Idaho State University
Q1656608 EXACT TITLE 1.000
QID OVERLAP: Q1656608 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (15): "activity", "campus", "classified", "doctoral", "enrollment", "falls", "idaho", "main", "meridian", "programs", "public", "research", "students", "twin", "university". | EXACT TITLE in biotech_life_sciences: "Idaho State University". | EXACT TITLE in healthcare: "Idaho State University".
activitycampusclassifieddoctoralenrollmentfallsidahomainmeridianprogramspublicresearchstudentstwinuniversity
ho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (17): "boise", "campus", "classified", "division", "established", "falls", "idaho", "main", "moscow", "operates", "professional", "public", "research", "statewide", "students", "uidaho", "university". | EXACT TITLE in biotech_life_sciences: "University of Idaho". | EXACT TITLE in healthcare: "University of Idaho".
boisecampusclassifieddivisionestablishedfallsidahomainmoscowoperatesprofessionalpublicresearchstatewidestudentsuidahouniversity
legiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference. In addition to the main campus in Moscow, the U of I has branch campuses in Coeur d'Alene, Boise, and Idaho Falls; it also operates a research park in Post Falls, and dozens of extension offices statewide. History On January 30, 1889, Governor Edward Stevenson of the Idaho Territory signed the territorial legislature's Council Bill No. 20, which officially established the UI as the upcoming state's land-grant institution. Nearly four years later, the university opened for classes on October 3, 1892. The choice of location for the University of Idaho was an "Olive Branch of Peace" by Gov. Stevenson for his actions in styming the nearly successful effort to detach the north Idaho panhandle and join the state of Washington. Formed by the Idaho Territory legislature in 1889, the university opened its doors in 1892 with a class of 40 students.
Ridenbaugh Hall The Board of Regents authorized the construction of Ridenbaugh Hall as the first women's dormitory on campus. Completed in 1901 at a cost of $17,000, it is the oldest extant building on campus. It was designed by architect Willis A. Ritchie of Spokane, who also designed the Spokane County Courthouse. The building used stone quarried in Latah County for the exterior walls. It was also used as a space for domestic science classes until 1927 when it became a men's dormitory. The building was later used for music practice rooms and currently houses the Art and Architecture gallery. Ridenbaugh Hall was the first U of I campus structure to be named after a person. The hall was dedicated to "the young women of Idaho" in honor of Mary E. Ridenbaugh (1857–1926) of Boise, who was vice president of the U of I Board of Regents, and served as regent from 1901 to 1907.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes.
Immunology
Q101929 EXACT TITLE 1.000
QID OVERLAP: Q101929 in biotech_life_sciences (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (20): "active", "against", "become", "body", "cellular", "covers", "early", "important", "maintain", "medicine", "oncology", "physical", "physicians", "small", "studies", "study", "system", "systems", "unusual", "work". | EXACT TITLE in biotech_life_sciences: "Immunology".
activeagainstbecomebodycellularcoversearlyimportantmaintainmedicineoncologyphysicalphysicianssmallstudiesstudysystemsystemsunusualwork
bel Prize for his work in 1908 with Paul Ehrlich "in recognition of their work on immunity". He pinned small thorns into starfish larvae and noticed unusual cells surrounding the thorns. This was the active response of the body trying to maintain its integrity. It was Mechnikov who first observed the phenomenon of phagocytosis, in which the body defends itself against a foreign body. Ehrlich accustomed mice to the poisonous ricin and abrin. After feeding them with small but increasing dosages of ricin he ascertained that they had become "ricin-proof". Ehrlich interpreted this as immunization and observed that it was abruptly initiated after a few days and was still in existence after several months. Prior to the designation of immunity, from the etymological root immunis, which is Latin for 'exempt', early physicians characterized organs that would later be proven as essential components of the immune system. The important lymphoid organs of the immune system are the thymus, bone marrow, and chief lymphatic tissues such as spleen, tonsils, lymph vessels, lymph nodes, adenoids, and liver.
Theoretical immunology Immunology is strongly experimental in everyday practice but is also characterized by an ongoing theoretical attitude. Many theories have been suggested in immunology from the end of the nineteenth century up to the present time. The end of the 19th century and the beginning of the 20th century saw a battle between "cellular" and "humoral" theories of immunity. According to the cellular theory of immunity, represented in particular by Elie Metchnikoff, it was cells – more precisely, phagocytes – that were responsible for immune responses. In contrast, the humoral theory of immunity, held by Robert Koch and Emil von Behring, among others, stated that the active immune agents were soluble components (molecules) found in the organism's "humors" rather than its cells. In the mid-1950s, Macfarlane Burnet, inspired by a suggestion made by Niels Jerne, formulated the clonal selection theory (CST) of immunity. On the basis of CST, Burnet developed a theory of how an immune response is triggered according to the self/nonself distinction: "self" constituents (constituents of the body) do not trigger destructive immune responses, while "nonself" entities (e.g., pathogens, an allograft) trigger a destructive immune response. The theory was later modified to reflect new discoveries regarding histocompatibility or the complex "two-signal" activation of T cells. The self/nonself theory of immunity and the self/nonself vocabulary have been criticized, but remain very influential. More recently, several theoretical frameworks have been suggested in immunology, including "autopoietic" views, "cognitive immune" views, the "danger model" (or "danger theory"), and the "discontinuity" theory.
Developmental immunology The body's capability to react to antigens depends on a person's age, antigen type, maternal factors and the area where the antigen is presented. Neonates are said to be in a state of physiological immunodeficiency, because both their innate and adaptive immunological responses are greatly suppressed. Once born, a child's immune system responds favorably to protein antigens while not as well to glycoproteins and polysaccharides. In fact, many of the infections acquired by neonates are caused by low virulence organisms like Staphylococcus and Pseudomonas. In neonates, opsonic activity and the ability to activate the complement cascade is very limited. For example, the mean level of C3 in a newborn is approximately 65% of that found in the adult. Phagocytic activity is also greatly impaired in newborns. This is due to lower opsonic activity, as well as diminished up-regulation of integrin and selectin receptors, which limit the ability of neutrophils to interact with adhesion molecules in the endothelium. Their monocytes are slow and have a reduced ATP production, which also limits the newborn's phagocytic activity. Although, the number of total lymphocytes is significantly higher than in adults, the cellular and humoral immunity is also impaired. Antigen-presenting cells in newborns have a reduced capability to activate T cells. Also, T cells of a newborn proliferate poorly and produce very small amounts of cytokines like IL-2, IL-4, IL-5, IL-12, and IFN-g which limits their capacity to activate the humoral response as well as the phagocitic activity of macrophage. B cells develop early during gestation but are not fully active. Maternal factors also play a role in the body's immune response. At birth, most of the immunoglobulin present is maternal IgG. These antibodies are transferred from the placenta to the fetus using the FcRn (neonatal Fc receptor). Because IgM, IgD, IgE and IgA do not cross the placenta, they are almost undetectable at birth. Some IgA is provided by breast milk. These passively-acquired antibodies can protect the newborn for up to 18 months, but their response is usually short-lived and of low affinity. These antibodies can also produce a negative response. If a child is exposed to the antibody for a particular antigen before being exposed to the antigen itself then the child will produce a dampened response. Passively acquired maternal antibodies can suppress the antibody response to active immunization. Similarly, the response of T-cells to vaccination differs in children compared to adults, and vaccines that induce Th1 responses in adults do not readily elicit these same responses in neonates. Between six and nine months after birth, a child's immune system begins to respond more strongly to glycoproteins, but there is usually no marked improvement in their response to polysaccharides until they are at least one year old. This can be the reason for distinct time frames found in vaccination schedules. During adolescence, the human body undergoes various physical, physiological and immunological changes triggered and mediated by hormones, of which the most significant in females is 17-β-estradiol (an estrogen) and, in males, is testosterone. Estradiol usually begins to act around the age of 10 and testosterone some months later. There is evidence that these steroids not only act directly on the primary and secondary sexual characteristics but also have an effect on the development and regulation of the immune system, including an increased risk in developing pubescent and post-pubescent autoimmunity. There is also some evidence that cell surface receptors on B cells and macrophages may detect sex hormones in the system. The female sex hormone 17-β-estradiol has been shown to regulate the level of immunological response, while some male androgens such as testosterone seem to suppress the stress response to infection. Other androgens, however, such as DHEA, increase immune response.
Pharmacy
Q614304 EXACT TITLE 1.000
QID OVERLAP: Q614304 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (22): "become", "care", "classified", "clinical", "community", "compounding", "direct", "drug", "information", "links", "monitoring", "office", "patient", "patients", "pharmacy", "practice", "products", "professional", "related", "safety".... | EXACT TITLE in biotech_life_sciences: "Pharmacy". | EXACT TITLE in healthcare: "Pharmacy".
becomecareclassifiedclinicalcommunitycompoundingdirectdruginformationlinksmonitoringofficepatientpatientspharmacypracticeproductsprofessionalrelatedsafetysettingwork
ensure the safe, effective, and affordable use of medicines. It is a miscellaneous science as it links health sciences with pharmaceutical sciences and natural sciences. The professional practice has become more clinically oriented as most drugs are now manufactured by pharmaceutical industries. Based on the setting, pharmacy practice is either classified as community or institutional pharmacy. Providing direct patient care in the community of institutional pharmacies is considered clinical pharmacy. The scope of pharmacy practice includes more traditional roles such as compounding and dispensing of medications. It also includes more modern services related to health care including clinical services, reviewing medications for safety and efficacy, and providing drug information with patient counselling. Pharmacists, therefore, are experts on drug therapy and are the primary health professionals who optimize the use of medication for the benefit of the patients. In some jurisdictions, such as Canada and Australia, Pharmacists may be able to prescribe or adapt/manage prescriptions, as well as give injections and immunizations. An establishment in which pharmacy (in the first sense) is practiced is called a pharmacy (this term is more common in the United States) or chemists (which is more common in Great Britain, though pharmacy is also used).
Pharmacists provide direct patient care services that optimize the use of medication and promotes health, wellness, and disease prevention. Clinical pharmacists care for patients in all health care settings, but the clinical pharmacy movement initially began inside hospitals and clinics. Clinical pharmacists often collaborate with physicians and other healthcare professionals to improve pharmaceutical care. Clinical pharmacists are now an integral part of the interdisciplinary approach to patient care. They often participate in patient care rounds for drug product selection. In the UK clinical pharmacists can also prescribe some medications for patients on the National Health Services (NHS) or privately, after completing a non-medical prescribers course to become an Independent Prescriber. The clinical pharmacist's role involves creating a comprehensive drug therapy plan for patient-specific problems, identifying goals of therapy, and reviewing all prescribed medications prior to dispensing and administration to the patient. The review process often involves an evaluation of the appropriateness of drug therapy (e.g., drug choice, dose, route, frequency, and duration of therapy) and its efficacy. Research shows that pharmacist led strategies reduce errors related to medication use.
Environmental impacts In 2022 the Organisation for Economic Co-operation and Development (OECD) proposed that pharmaceutical companies should be required to collect and destroy unused or expired medicines that they have put on the market in order to reduce public health risks around the misuse of medicines obtained from waste bins, the development of antimicrobial resistant bacteria from the discharge of antibiotics into environmental systems and "economic losses" from wasted healthcare resources. Potentially harmful concentrations of pharmaceutical waste has been detected in more than a quarter of water samples taken from 258 rivers around the world. OECD recommend that medicines should be collected separately from household waste and that "marketplaces and redistribution platforms for unused close-to-expiry-date medicines" should be set up. Such extended producer responsibility schemes are already running in France, Spain and Portugal. The future of pharmacy In the coming decades, pharmacists are expected to become more integral within the health care system. Rather than simply dispensing medication, pharmacists are increasingly expected to be compensated for their patient care skills. In particular, Medication Therapy Management (MTM) includes the clinical services that pharmacists can provide for their patients. Such services include a thorough analysis of all medication (prescription, non-prescription, and herbals) currently being taken by an individual. The result is a reconciliation of medication and patient education resulting in increased patient health outcomes and decreased costs to the health care system. This shift has already commenced in some countries; for instance, pharmacists in Australia receive remuneration from the Australian Government for conducting comprehensive Home Medicines Reviews. In Canada, pharmacists in certain provinces have limited prescribing rights (as in Alberta and British Columbia) or are remunerated by their provincial government for expanded services such as medications reviews (Medschecks in Ontario). In the United Kingdom, pharmacists who undertake additional training are obtaining prescribing rights and this is because of pharmacy education. They are also being paid for by the government for medicine use reviews. In Scotland, the pharmacist can write prescriptions for Scottish registered patients of their regular medications, for the majority of drugs, except for controlled drugs, when the patient is unable to see their doctor, as could happen if they are away from home or the doctor is unavailable. In the United States, pharmaceutical care or clinical pharmacy has had an evolving influence on the practice of pharmacy. Moreover, the Doctor of Pharmacy (Pharm. D.) degree is now required before entering practice and some pharmacists now complete one or two years of residency or fellowship training following graduation. In addition, consultant pharmacists, who traditionally operated primarily in nursing homes, are now expanding into direct consultation with patients, under the banner of "senior care pharmacy". In addition to patient care, pharmacies will be a focal point for medical adherence initiatives. There is enough evidence to show that integrated pharmacy based initiatives significantly impact adherence for chronic patients.
Medical device
Q6554101 EXACT TITLE 1.000
QID OVERLAP: Q6554101 in biotech_life_sciences (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (17): "act", "back", "cosmetic", "drug", "established", "federal", "field", "food", "general", "major", "market", "patient", "risk", "safety", "significant", "standards", "study". | EXACT TITLE in biotech_life_sciences: "Medical device".
actbackcosmeticdrugestablishedfederalfieldfoodgeneralmajormarketpatientrisksafetysignificantstandardsstudy
medical literature also indicate that many types of medical devices were in widespread use during the time of ancient Rome. In the United States, it was not until the Federal Food, Drug, and Cosmetic Act (FD&C Act) in 1938 that medical devices were regulated at all. It was not until later in 1976 that the Medical Device Amendments to the FD&C Act established medical device regulation and oversight as we know it today in the United States. Medical device regulation in Europe as we know it today came into effect in 1993 by what is collectively known as the Medical Device Directive (MDD). On May 26, 2017, the Medical Device Regulation (MDR) replaced the MDD. Medical devices vary in both their intended use and indications for use. Examples range from simple, low-risk devices such as tongue depressors, medical thermometers, disposable gloves, and bedpans to complex, high-risk devices that are implanted and sustain life. Examples of high-risk devices include artificial hearts, pacemakers, joint replacements, and CT scans. The design of medical devices constitutes a major segment of the field of biomedical engineering. The global medical device market was estimated to be between $220 and US$250 billion in 2013. The United States controls ≈40% of the global market followed by Europe (25%), Japan (15%), and the rest of the world (20%). Although collectively Europe has a larger share, Japan has the second largest country market share. The largest market shares in Europe (in order of market share size) belong to Germany, Italy, France, and the United Kingdom.
it was not until the Federal Food, Drug, and Cosmetic Act (FD&C Act) in 1938 that medical devices were regulated at all. It was not until later in 1976 that the Medical Device Amendments to the FD&C Act established medical device regulation and oversight as we know it today in the United States. Medical device regulation in Europe as we know it today came into effect in 1993 by what is collectively known as the Medical Device Directive (MDD). On May 26, 2017, the Medical Device Regulation (MDR) replaced the MDD. Medical devices vary in both their intended use and indications for use. Examples range from simple, low-risk devices such as tongue depressors, medical thermometers, disposable gloves, and bedpans to complex, high-risk devices that are implanted and sustain life. Examples of high-risk devices include artificial hearts, pacemakers, joint replacements, and CT scans. The design of medical devices constitutes a major segment of the field of biomedical engineering. The global medical device market was estimated to be between $220 and US$250 billion in 2013. The United States controls ≈40% of the global market followed by Europe (25%), Japan (15%), and the rest of the world (20%). Although collectively Europe has a larger share, Japan has the second largest country market share. The largest market shares in Europe (in order of market share size) belong to Germany, Italy, France, and the United Kingdom.
A global definition for medical device is difficult to establish because there are numerous regulatory bodies worldwide overseeing the marketing of medical devices. Although these bodies often collaborate and discuss the definition in general, there are subtle differences in wording that prevent a global harmonization of the definition of a medical device, thus the appropriate definition of a medical device depends on the region. Often a portion of the definition of a medical device is intended to differentiate between medical devices and drugs, as the regulatory requirements of the two are different. Definitions also often recognize In vitro diagnostics as a subclass of medical devices and establish accessories as medical devices. Definitions by region United States (Food and Drug Administration) Section 201(h) of the Federal Food Drug & Cosmetic (FD&C) Act defines a device as an "instrument, apparatus, implement, machine, contrivance, implant, in vitro reagent, or other similar or related article, including a component part, or accessory which is: recognized in the official National Formulary, or the United States Pharmacopoeia, or any supplement to them Intended for use in the diagnosis of disease or other conditions, or in the cure, mitigation, treatment, or prevention of disease, in man or other animals, or Intended to affect the structure or any function of the body of man or other animals, and which does not achieve its primary intended purposes through chemical action within or on the body of man or other animals and which is not dependent upon being metabolized for the achievement of its primary intended purposes.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (18): "activity", "boise", "business", "classified", "college", "division", "doctoral", "education", "idaho", "independent", "million", "program", "programs", "public", "reported", "research", "school", "university". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityboisebusinessclassifiedcollegedivisiondoctoraleducationidahoindependentmillionprogramprogramspublicreportedresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
CAA Division I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
Pathology
Q7208 EXACT TITLE 1.000
QID OVERLAP: Q7208 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (20): "analysis", "cancer", "cell", "clinical", "conditions", "diagnosis", "disease", "field", "general", "major", "pathology", "physical", "physician", "practice", "research", "significant", "specialties", "study", "systems", "treatment". | EXACT TITLE in biotech_life_sciences: "Pathology". | EXACT TITLE in healthcare: "Pathology".
analysiscancercellclinicalconditionsdiagnosisdiseasefieldgeneralmajorpathologyphysicalphysicianpracticeresearchsignificantspecialtiesstudysystemstreatment
nd tests that fall within the contemporary medical field of "general pathology", an area that includes a number of distinct but inter-related medical specialties that diagnose disease, mostly through analysis of tissue and human cell samples. Pathology is a significant field in modern medical diagnosis and medical research. A physician practicing pathology is called a pathologist. As a field of general inquiry and research, pathology addresses components of disease: cause, mechanisms of development (pathogenesis), structural alterations of cells (morphologic changes), and the consequences of changes (clinical manifestations). In common medical practice, general pathology is mostly concerned with analyzing known clinical abnormalities that are markers or precursors for both infectious and non-infectious disease, and is conducted by experts in one of two major specialties, anatomical pathology and clinical pathology. Further divisions in specialty exist on the basis of the involved sample types (comparing, for example, cytopathology, hematopathology, and histopathology), organs (as in renal pathology), and physiological systems (oral pathology), as well as on the basis of the focus of the examination (as with forensic pathology). Idiomatically, "a pathology" may also refer to the predicted or actual progression of particular diseases (as in the statement "the many different forms of cancer have diverse pathologies" in which case a more precise choice of word would be "pathophysiologies").
Anatomical pathology (Commonwealth) or anatomic pathology (United States) is a medical specialty that is concerned with the diagnosis of disease based on the gross, microscopic, chemical, immunologic and molecular examination of organs, tissues, and whole bodies (as in a general examination or an autopsy). Anatomical pathology is itself divided into subfields, the main divisions being surgical pathology, cytopathology, and forensic pathology. Anatomical pathology is one of two main divisions of the medical practice of pathology, the other being clinical pathology, the diagnosis of disease through the laboratory analysis of bodily fluids and tissues. Sometimes, pathologists practice both anatomical and clinical pathology, a combination known as general pathology. Cytopathology Cytopathology (sometimes referred to as "cytology") is a branch of pathology that studies and diagnoses diseases on the cellular level. It is usually used to aid in the diagnosis of cancer, but also helps in the diagnosis of certain infectious diseases and other inflammatory conditions as well as thyroid lesions, diseases involving sterile body cavities (peritoneal, pleural, and cerebrospinal), and a wide range of other body sites. Cytopathology is generally used on samples of free cells or tissue fragments (in contrast to histopathology, which studies whole tissues) and cytopathologic tests are sometimes called smear tests because the samples may be smeared across a glass microscope slide for subsequent staining and microscopic examination.
Dermatopathology is a subspecialty of anatomic pathology that focuses on the skin and the rest of the integumentary system as an organ. It is unique, in that there are two paths a physician can take to obtain the specialization. All general pathologists and general dermatologists train in the pathology of the skin, so the term dermatopathologist denotes either of these who has reached a certain level of accreditation and experience; in the US, either a general pathologist or a dermatologist can undergo a 1 to 2 year fellowship in the field of dermatopathology. The completion of this fellowship allows one to take a subspecialty board examination, and becomes a board certified dermatopathologist. Dermatologists are able to recognize most skin diseases based on their appearances, anatomic distributions, and behavior. Sometimes, however, those criteria do not lead to a conclusive diagnosis, and a skin biopsy is taken to be examined under the microscope using usual histological tests. In some cases, additional specialized testing needs to be performed on biopsies, including immunofluorescence, immunohistochemistry, electron microscopy, flow cytometry, and molecular-pathologic analysis. One of the greatest challenges of dermatopathology is its scope. More than 1500 different disorders of the skin exist, including cutaneous eruptions ("rashes") and neoplasms.
Vaccine
Q134808 EXACT TITLE 0.960
QID OVERLAP: Q134808 in biotech_life_sciences (tier:evergreen) and healthcare (tier:berry). | SHARED TOKENS (13): "active", "against", "already", "cancer", "described", "disease", "licensed", "organization", "practice", "safety", "system", "therapeutic", "title". | EXACT TITLE in biotech_life_sciences: "Vaccine".
activeagainstalreadycancerdescribeddiseaselicensedorganizationpracticesafetysystemtherapeutictitle
A vaccine is a biological preparation that provides active acquired immunity to a particular infectious or malignant disease. The safety and effectiveness of vaccines has been widely studied and verified. A vaccine typically contains an agent that resembles a disease-causing microorganism and is often made from weakened or killed forms of the microbe, its toxins, or one of its surface proteins. The agent stimulates the immune system to recognize the agent as a threat, destroy it, and recognize further and destroy any of the microorganisms associated with that agent that it may encounter in the future. Vaccines can be prophylactic (to prevent or alleviate the effects of a future infection by a natural or "wild" pathogen), or therapeutic (to fight a disease that has already occurred, such as cancer). Some vaccines offer full sterilizing immunity, in which infection is prevented. The administration of vaccines is called vaccination. Vaccination is the most effective method of preventing infectious diseases; widespread immunity due to vaccination is largely responsible for the worldwide eradication of smallpox and the restriction of diseases such as polio, measles, and tetanus from much of the world. The World Health Organization (WHO) reports that licensed vaccines are available for twenty-five different preventable infections. The first recorded use of inoculation to prevent smallpox (see variolation) occurred in the 16th century in China, with the earliest hints of the practice in China coming during the 10th century. It was also the first disease for which a vaccine was produced. The folk practice of inoculation against smallpox was brought from Turkey to Britain in 1721 by Lady Mary Wortley Montagu. The terms vaccine and vaccination are derived from Variolae vaccinae (smallpox of the cow), the term devised by Edward Jenner (who both developed the concept of vaccines and created the first vaccine) to denote cowpox. He used the phrase in 1798 for the long title of his Inquiry into the Variolae vaccinae Known as the Cow Pox, in which he described the protective effect of cowpox against smallpox. In 1881, to honor Jenner, Louis Pasteur proposed that the terms should be extended to cover the new protective inoculations then being developed.
Vaccines typically contain attenuated, inactivated or dead organisms or purified products derived from them. There are several types of vaccines in use. These represent different strategies used to try to reduce the risk of illness while retaining the ability to induce a beneficial immune response. Attenuated Some vaccines contain live, attenuated microorganisms. Many of these are active viruses that have been cultivated under conditions that disable their virulent properties, or that use closely related but less dangerous organisms to produce a broad immune response. Although most attenuated vaccines are viral, some are bacterial in nature. Examples include the viral diseases yellow fever, measles, mumps, and rubella, and the bacterial disease typhoid. The live Mycobacterium tuberculosis vaccine developed by Calmette and Guérin is not made of a contagious strain but contains a virulently modified strain called "BCG" used to elicit an immune response to the vaccine. The live attenuated vaccine containing strain Yersinia pestis EV is used for plague immunization. Attenuated vaccines have some advantages and disadvantages. Attenuated, or live, weakened, vaccines typically provoke more durable immunological responses. Attenuated vaccines also elicit a cellular and humoral response.
Preservatives Vaccines may also contain preservatives to prevent contamination with bacteria or fungi. Until recent years, the preservative thiomersal (a.k.a. Thimerosal in the US and Japan) was used in many vaccines that did not contain live viruses. s of 2005, the only childhood vaccine in the US that contained thiomersal in greater than trace amounts was the influenza vaccine, which is currently recommended only for children with certain risk factors. Single-dose influenza vaccines supplied in the UK do not list thiomersal in the ingredients. Preservatives may be used at various stages of the production of vaccines, and the most sophisticated methods of measurement might detect traces of them in the finished product, as they may in the environment and population as a whole. Many vaccines need preservatives to prevent serious adverse effects such as Staphylococcus infection, which in one 1928 incident killed 12 of 21 children inoculated with a diphtheria vaccine that lacked a preservative. Several preservatives are available, including thiomersal, phenoxyethanol, and formaldehyde. Thiomersal is more effective against bacteria, has a better shelf-life, and improves vaccine stability, potency, and safety; however, in the US, the European Union, and a few other affluent countries, it is no longer used as a preservative in childhood vaccines, as a precautionary measure due to its mercury content. Although controversial claims have been made that thiomersal contributes to autism, no convincing scientific evidence supports these claims. Furthermore, a 10–11-year study of 657,461 children found that the MMR vaccine does not cause autism and actually reduced the risk of autism by seven percent. Excipients Beside the active vaccine itself, the following excipients and residual manufacturing compounds are present or may be present in vaccine preparations: Aluminum salts or gels are added as adjuvants. Adjuvants are added to promote an earlier, more potent response, and more persistent immune response to the vaccine; they allow for a lower vaccine dosage. Antibiotics are added to some vaccines to prevent the growth of bacteria during production and storage of the vaccine. Egg protein is present in the influenza vaccine and yellow fever vaccine as they are prepared using chicken eggs. Other proteins may be present. Formaldehyde is used to inactivate bacterial products for toxoid vaccines. Formaldehyde is also used to inactivate unwanted viruses and kill bacteria that might contaminate the vaccine during production. Monosodium glutamate (MSG) and 2-phenoxyethanol are used as stabilizers in a few vaccines to help the vaccine remain unchanged when the vaccine is exposed to heat, light, acidity, or humidity. Thiomersal is a mercury-containing antimicrobial that is added to vials of vaccines that contain more than one dose to prevent contamination and growth of potentially harmful bacteria.
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (10): "association", "boise", "idaho", "land", "local", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in biotech_life_sciences: "Treasure Valley". | EXACT TITLE in healthcare: "Treasure Valley".
associationboiseidaholandlocalregionresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Centers for Medicare & Medicaid Services
Q5060058 QID OVERLAP 0.800
QID OVERLAP: Q5060058 in biotech_life_sciences (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (21): "act", "administers", "care", "centers", "children", "clinical", "cms", "department", "federal", "gov", "healthcare", "home", "insurance", "medicaid", "medicare", "nursing", "program", "programs", "standards", "system"....
actadministerscarecenterschildrenclinicalcmsdepartmentfederalgovhealthcarehomeinsurancemedicaidmedicarenursingprogramprogramsstandardssystemworks
ce portability standards. In addition to these programs, CMS has other responsibilities, including the administrative simplification standards from the Health Insurance Portability and Accountability Act of 1996 (HIPAA), quality standards in long-term care facilities (more commonly referred to as nursing homes) through its survey and certification process, clinical laboratory quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States.
ry quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States. This includes maintaining the 5-Star Quality Rating System. Organization The agency carries out its responsibilities from its national headquarters located in Woodlawn, Maryland, and its 10 regional offices. It is organized around six centers to support its key functions.
Workforce CMS employs over 6,000 people, of whom about 4,000 are located at its headquarters in Woodlawn, Maryland. The remaining employees are located in the Hubert H. Humphrey Building in Washington, D.C., the 10 regional offices listed below, and in various field offices located throughout the United States. The head of CMS is the administrator of the Centers for Medicare & Medicaid Services. The position is appointed by the president and confirmed by the Senate. On May 27, 2021, Chiquita Brooks-LaSure was sworn in as administrator, the first black woman to serve in the role. History Originally, the name "Medicare" in the United States referred to a program providing medical care for families of people serving in the military as part of the Dependents' Medical Care Act, which was passed in 1956. President Dwight D. Eisenhower held the first White House Conference on Aging in January 1961, in which creating a health care program for social security beneficiaries was proposed. President Lyndon B. Johnson signed the Social Security Amendments on July 30, 1965, establishing both Medicare and Medicaid. Arthur E. Hess, a deputy commissioner of the Social Security Administration, was named as first director of the Bureau of Health Insurance in 1965, placing him as the first executive in charge of the Medicare program. At the time, the program provided health insurance to 19 million Americans. The Social Security Administration (SSA) became responsible for the administration of Medicare and the Social and Rehabilitation Service (SRS) became responsible for the administration of Medicaid. Both agencies were organized under what was then known as the Department of Health, Education, and Welfare (HEW), in 1965. Since then, HEW, has been reorganized as the Department of Health and Human Services (HHS) in 1980. This consequently brought Medicare and Medicaid under the jurisdiction of the HHS. In March 1977, the Health Care Financing Administration (HCFA) was established under HEW. HCFA became responsible for the coordination of Medicare and Medicaid. The responsibility for enrolling beneficiaries into Medicare and processing premium payments remained with SSA. HCFA was renamed the Centers for Medicare & Medicaid Services on July 1, 2001. This was later codified in law by the Medicare Prescription Drug, Improvement, and Modernization Act of 2003. In 2013, a report by the inspector general found that CMS had paid $23 million in benefits to deceased beneficiaries in 2011. In April 2014, CMS released raw claims data from 2012 that gave a look into what types of doctors billed Medicare the most. In January 2018, CMS released guidelines for states to use to require Medicaid beneficiaries to continue receiving coverage. These guidelines came in response to then-President Trump's announcement that he would allow states to impose work requirements in Medicaid. In October, CMS reported a data breach of 75,000 people's personal data due to a hack. In February 2018, CMS removed a notice from its website that informed insurance companies they were not allowed to charge physicians a fee when the companies paid the doctors for their work. This has resulted in doctors being charged up to a 5% fee on their compensation, adding up to billions of dollars annually. In January 2021, CMS passed a rule that would cover "breakthrough technology" for four years after they received FDA approval. In September 2021, CMS submitted a proposal to repeal the rule based on safety concerns. On September 19, 2023, the Subcommittee on Health held a hearing titled "Examining Policies to Improve Seniors’ Access to Innovative Drugs, Medical Devices, and Technology." Dora Hughes, the acting director of the Center for Clinical Standards and Quality at the U.S. Centers for Medicare and Medicaid Services (CMS), defended the proposed Transitional Coverage for Emerging Technologies (TCET) pathway, which aims to restrict coverage for breakthrough medical devices to five reviews a year. Some lawmakers and medtech trade groups called for expanding the pathway to include diagnostics.
I
Q30253346 EXACT TITLE 0.780
QID OVERLAP: Q30253346 in biotech_life_sciences (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (4): "department", "idaho", "public", "welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
departmentidahopublicwelfare
Idaho Department of Health and Welfare is a public health agency in the state of Idaho. History The department was founded in 1972. Functions The department provides healthcare services, records management, children and family services, food assistance programs, and healthcare services.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in biotech_life_sciences (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (13): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "locally", "major", "population", "technology", "treasure", "valley".
adaannualboisecapitalemployershomeidaholocallymajorpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in biotech_life_sciences (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "northwest", "population", "university", "western".
boisecanyoncollegehomeidahomeridiannampanorthwestpopulationuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in biotech_life_sciences (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (10): "ada", "boise", "capital", "home", "idaho", "local", "northwest", "pacific", "population", "private".
adaboisecapitalhomeidaholocalnorthwestpacificpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in biotech_life_sciences (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
boisecaldwellcanyoncollegeidaholocallypopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in biotech_life_sciences (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (6): "ada", "boise", "capital", "idaho", "meridian", "population".
adaboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in biotech_life_sciences (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "nampa", "population".
boisecaldwellcanyonidahonampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
329 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP329 edges
🌲 EVERGREEN1 edges
0.650
adaboisecanyoncurrentlydesignatedhomeidahomainmeridianmetronampanorthwestpacificpopulationtreasurevalley
SHARED TOKENS (16): "ada", "boise", "canyon", "currently", "designated", "home", "idaho", "main", "meridian", "metro", "nampa", "northwest", "pacific", "population", "treasure", "valley". | URL->B (2): https://www.stlukesonline.org/, https://saintalphonsus.org/. | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
🌿 BRANCH232 edges
0.500
Biotechnology ↗ Q7108 EXACT TITLE
agriculturebackcelldefinitionsdirectlyfieldimportantinitiallabmedicinenationalpeopleproceduresproductsprogramsrelatedresearchreturnsafetysignificant
SHARED TOKENS (25): "agriculture", "back", "cell", "definitions", "directly", "field", "important", "initial", "lab", "medicine", "national", "people", "procedures", "products", "programs", "related", "research", "return", "safety", "significant".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
accessadditionalassociationbettercarechildrencollegedeliverydescribedestablishedfamilyhomeinformationmanagementmodelpatientpatientsphysiciansproviderresources
SHARED TOKENS (22): "access", "additional", "association", "better", "care", "children", "college", "delivery", "described", "established", "family", "home", "information", "management", "model", "patient", "patients", "physicians", "provider", "resources".... | EXACT TITLE in healthcare: "Medical home".
0.500
becomebodycarecommunitydiseasefamilyfieldgeneralindividualmedicineorganizationpatientphysicianpracticeschoolspecialist
SHARED TOKENS (16): "become", "body", "care", "community", "disease", "family", "field", "general", "individual", "medicine", "organization", "patient", "physician", "practice", "school", "specialist". | EXACT TITLE in healthcare: "Family medicine".
0.500
cancercareclassifiedclinicalclinicscommunitiescommunitydepartmentdiseaseeconomiceducationenvironmentfamilyfieldhealthcarehospitalhospitalsmajormanagementmembers
SHARED TOKENS (40): "cancer", "care", "classified", "clinical", "clinics", "communities", "community", "department", "disease", "economic", "education", "environment", "family", "field", "healthcare", "hospital", "hospitals", "major", "management", "members".... | EXACT TITLE in biotech_life_sciences: "Community health". | EXACT TITLE in healthcare: "Community health".
0.500
clinicaldrugexperiencehouselargemaintainmanagementneednihorganizationrealresearchseekingsmallspecificallystaffsupporttherapeuticworkworking
SHARED TOKENS (20): "clinical", "drug", "experience", "house", "large", "maintain", "management", "need", "nih", "organization", "real", "research", "seeking", "small", "specifically", "staff", "support", "therapeutic", "work", "working". | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
agenciesbloodbuildingcellcellularconditionsdirectlydruggeneralmarketmedicineperformanceproductsregulatoryresearchsmallspecificallystudiestechnologytherapeutic
SHARED TOKENS (22): "agencies", "blood", "building", "cell", "cellular", "conditions", "directly", "drug", "general", "market", "medicine", "performance", "products", "regulatory", "research", "small", "specifically", "studies", "technology", "therapeutic".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
clinicclinicaldirecteducationexperiencehospitalhouseindividualmedicinepharmacyphysicalphysicianphysicianspracticequalifiedrequirementschool
SHARED TOKENS (17): "clinic", "clinical", "direct", "education", "experience", "hospital", "house", "individual", "medicine", "pharmacy", "physical", "physician", "physicians", "practice", "qualified", "requirement", "school". | EXACT TITLE in healthcare: "Residency (medicine)".
0.500
annualbecomebusinesscapitalearlyemployeesfundinghistoryinformationinitialmarketmodeloperatingpointprivatepublicreportedresearchreturnrisk
SHARED TOKENS (28): "annual", "become", "business", "capital", "early", "employees", "funding", "history", "information", "initial", "market", "model", "operating", "point", "private", "public", "reported", "research", "return", "risk".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
caredeliverydirectdirectlyemployersfamilyhealthcareinsurancemodelnetworkspatientsphysiciansproviderprovidersrelationshipsstandardsystemstype
SHARED TOKENS (18): "care", "delivery", "direct", "directly", "employers", "family", "healthcare", "insurance", "model", "networks", "patients", "physicians", "provider", "providers", "relationships", "standard", "systems", "type". | EXACT TITLE in healthcare: "Direct primary care".
0.500
Health care ↗ Q31207 EXACT TITLE
accessadditionalbestcarecommunitiesconditionsdiagnosisdiseaseeconomicestablishedgeneralhealthcarehistoryimportantinformationinsurancemedicineneedsnursingoccupational
SHARED TOKENS (32): "access", "additional", "best", "care", "communities", "conditions", "diagnosis", "disease", "economic", "established", "general", "healthcare", "history", "important", "information", "insurance", "medicine", "needs", "nursing", "occupational".... | EXACT TITLE in healthcare: "Health care".
0.500
behaviorbuiltconcentrationcurrentdepartmentfacilityfallshistoryidahoinstitutelabnationalpeopleresearchsitewestern
SHARED TOKENS (16): "behavior", "built", "concentration", "current", "department", "facility", "falls", "history", "idaho", "institute", "lab", "national", "people", "research", "site", "western". | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
actagenciescurrentlydistributiondrugenforcementfederalfoodinitiallawlistingnationalpolicytitletreatment
SHARED TOKENS (15): "act", "agencies", "currently", "distribution", "drug", "enforcement", "federal", "food", "initial", "law", "listing", "national", "policy", "title", "treatment". | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
Assisted living ↗ EXACT TITLE
adultboardbusinesscarecommunitydefinitionsearlyenvironmentexpansionfacilityfederalgovernmenthomeindustryinformationmodelmonitoringnursingpeoplepopulation
SHARED TOKENS (31): "adult", "board", "business", "care", "community", "definitions", "early", "environment", "expansion", "facility", "federal", "government", "home", "industry", "information", "model", "monitoring", "nursing", "people", "population".... | EXACT TITLE in healthcare: "Assisted living".
0.500
Dentistry ↗ Q12128 EXACT TITLE
bloodcancercardiologycareconditionsdiagnosisdiseasefocusedhistoryhospitalsmanagementmedicinepatientsprivaterequireresearchspecialtiesstudytreatmentwork
SHARED TOKENS (20): "blood", "cancer", "cardiology", "care", "conditions", "diagnosis", "disease", "focused", "history", "hospitals", "management", "medicine", "patients", "private", "require", "research", "specialties", "study", "treatment", "work". | EXACT TITLE in healthcare: "Dentistry".
0.500
additionalcareclinicalcoordinatesfamilygeneralhealthcaremedicinepatientpatientsphysicalphysicianpointprofessionalproviderrequiresystem
SHARED TOKENS (17): "additional", "care", "clinical", "coordinates", "family", "general", "healthcare", "medicine", "patient", "patients", "physical", "physician", "point", "professional", "provider", "require", "system". | EXACT TITLE in healthcare: "Primary care".
0.500
againstagentsbloodbodycancercelldivisionfindlargelocalmajormultipleoncologyspecificallystandardsystemtherapiestreatmenttypework
SHARED TOKENS (20): "against", "agents", "blood", "body", "cancer", "cell", "division", "find", "large", "local", "major", "multiple", "oncology", "specifically", "standard", "system", "therapies", "treatment", "type", "work". | EXACT TITLE in biotech_life_sciences: "Chemotherapy".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accesscareclinicalconditionsdatadiagnosticeducationfollowingfundinghealthcarehomeinformationmanagementmedicinemonitoringpatientpatientsphysicalphysicianpractice
SHARED TOKENS (32): "access", "care", "clinical", "conditions", "data", "diagnostic", "education", "following", "funding", "healthcare", "home", "information", "management", "medicine", "monitoring", "patient", "patients", "physical", "physician", "practice".... | EXACT TITLE in healthcare: "Telehealth".
0.500
Oncology ↗ Q162555 EXACT TITLE
cancercareclinicaldescribeddiagnosisfocusedmedicinemonitoringoncologypediatricpeopleprofessionalresearchstudytreatment
SHARED TOKENS (15): "cancer", "care", "clinical", "described", "diagnosis", "focused", "medicine", "monitoring", "oncology", "pediatric", "people", "professional", "research", "study", "treatment". | EXACT TITLE in biotech_life_sciences: "Oncology". | EXACT TITLE in healthcare: "Oncology".
0.500
bloodbodycarecentersclinicalclinicsdiagnosisdiseasehospitalsindependentinformationmanagementnursingpatientresearchtreatment
SHARED TOKENS (16): "blood", "body", "care", "centers", "clinical", "clinics", "diagnosis", "disease", "hospitals", "independent", "information", "management", "nursing", "patient", "research", "treatment". | EXACT TITLE in biotech_life_sciences: "Medical laboratory".
0.500
analysisbloodclinicaldiagnosticdiseasedivisiondrugfieldhealthcareidentifyimportantmainmedicinemonitoringpathologypatientphysicianspracticeprovidersrequire
SHARED TOKENS (24): "analysis", "blood", "clinical", "diagnostic", "disease", "division", "drug", "field", "healthcare", "identify", "important", "main", "medicine", "monitoring", "pathology", "patient", "physicians", "practice", "providers", "require".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
accessactagenciesboardcarecentercentersclinicclinicalclinicscommunitiescommunityconsumerfederallygrantsinsurancelocalmedicaidmedicaremembers
SHARED TOKENS (33): "access", "act", "agencies", "board", "care", "center", "centers", "clinic", "clinical", "clinics", "communities", "community", "consumer", "federally", "grants", "insurance", "local", "medicaid", "medicare", "members".... | EXACT TITLE in healthcare: "Federally Qualified Health Center".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcareclinicaldemandeducationhealthcaremembersnursingoptimizationpatientsphysicianphysiciansplanpracticepractitionersproblemsproviderspublicqualifiedspecialists
SHARED TOKENS (25): "act", "care", "clinical", "demand", "education", "healthcare", "members", "nursing", "optimization", "patients", "physician", "physicians", "plan", "practice", "practitioners", "problems", "providers", "public", "qualified", "specialists".... | EXACT TITLE in biotech_life_sciences: "Nursing". | EXACT TITLE in healthcare: "Nursing".
0.500
Paramedic ↗ Q330204 EXACT TITLE
additionalcareemergencyhealthcarehospitalhospitalsmainmedicinemodelpatientspracticeprofessionalremoteworkworking
SHARED TOKENS (15): "additional", "care", "emergency", "healthcare", "hospital", "hospitals", "main", "medicine", "model", "patients", "practice", "professional", "remote", "work", "working". | EXACT TITLE in biotech_life_sciences: "Paramedic".
0.500
alternativeassociationbackcareclinicaldatademanddepartmentdiagnosisearlyestablishedfieldgeneralhistorylocalmainmedicinephysicalphysiciansprofessional
SHARED TOKENS (31): "alternative", "association", "back", "care", "clinical", "data", "demand", "department", "diagnosis", "early", "established", "field", "general", "history", "local", "main", "medicine", "physical", "physicians", "professional".... | EXACT TITLE in healthcare: "Chiropractic".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agriculturebecomecelldiagnosisdiseaseenvironmentfunctionmaintainmedicinerelatedresearchsmallstudiesstudysystemstools
SHARED TOKENS (16): "agriculture", "become", "cell", "diagnosis", "disease", "environment", "function", "maintain", "medicine", "related", "research", "small", "studies", "study", "systems", "tools". | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
behaviorclinicalconditionsdescribeddrugpatientspeoplepracticepractitionersproblemspublicresearchstandardstudytreatmentuniversaluniversitywork
SHARED TOKENS (18): "behavior", "clinical", "conditions", "described", "drug", "patients", "people", "practice", "practitioners", "problems", "public", "research", "standard", "study", "treatment", "universal", "university", "work". | EXACT TITLE in healthcare: "Dialectical behavior therapy".
0.500
alternativecapacitycapitaldetailsdirectlyearlyimportantinformationinitiallegallistedmarketprivatepublicrequirementsignificantsoldtypeworking
SHARED TOKENS (19): "alternative", "capacity", "capital", "details", "directly", "early", "important", "information", "initial", "legal", "listed", "market", "private", "public", "requirement", "significant", "sold", "type", "working". | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
careclinicshealthcarehomehospitalhospitalsidahonetworkoperatesoperatingoutpatientpatientspeoplephysicianssupportsystem
SHARED TOKENS (16): "care", "clinics", "healthcare", "home", "hospital", "hospitals", "idaho", "network", "operates", "operating", "outpatient", "patients", "people", "physicians", "support", "system". | EXACT TITLE in healthcare: "Trinity Health".
0.500
accessbettercarecentercenterscollegedepartmentdesignateddiagnosticemergencyequipmentestablishedfallshospitalhospitalsindividualinitiallawmaintainmajor
SHARED TOKENS (34): "access", "better", "care", "center", "centers", "college", "department", "designated", "diagnostic", "emergency", "equipment", "established", "falls", "hospital", "hospitals", "individual", "initial", "law", "maintain", "major".... | EXACT TITLE in healthcare: "Trauma center".
0.500
Antibody ↗ Q79460 EXACT TITLE
becomebodycapacitycellchainsdeliverydirectlydiseasedistributionfunctiongeneralidentifyindividuallargemajormultiplerecognizedsitespacespecifically
SHARED TOKENS (22): "become", "body", "capacity", "cell", "chains", "delivery", "directly", "disease", "distribution", "function", "general", "identify", "individual", "large", "major", "multiple", "recognized", "site", "space", "specifically".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Radiology ↗ Q77604 EXACT TITLE
cancercarediagnosiseducationhealthcareimagingmedicinemonitoringpatientsperformancephysicianspracticeproceduresprofessionaltreatment
SHARED TOKENS (15): "cancer", "care", "diagnosis", "education", "healthcare", "imaging", "medicine", "monitoring", "patients", "performance", "physicians", "practice", "procedures", "professional", "treatment". | EXACT TITLE in healthcare: "Radiology".
0.500
adultcareclinicaldiagnosisdiseasefamilyfocusedgeneralinternalmedicineoutpatientpatientspeoplepharmacyphysicianspracticepractitionersqualifiedrecognizedrequire
SHARED TOKENS (23): "adult", "care", "clinical", "diagnosis", "disease", "family", "focused", "general", "internal", "medicine", "outpatient", "patients", "people", "pharmacy", "physicians", "practice", "practitioners", "qualified", "recognized", "require".... | EXACT TITLE in healthcare: "Internal medicine".
0.500
careclinicaldiseaseeducationfunctionhealthcaremanagementmedicinepatientphysicalpracticeprivatepublicresearchspecialtieswomen
SHARED TOKENS (16): "care", "clinical", "disease", "education", "function", "healthcare", "management", "medicine", "patient", "physical", "practice", "private", "public", "research", "specialties", "women". | EXACT TITLE in healthcare: "Physical therapy".
0.500
Cancer ↗ Q12078 EXACT TITLE
actagainstagentsannualbodycancercarecellchildrendetectiondiagnosisdirectdirectlydiseaseearlyeconomicfieldimagingimportantmanagement
SHARED TOKENS (28): "act", "against", "agents", "annual", "body", "cancer", "care", "cell", "children", "detection", "diagnosis", "direct", "directly", "disease", "early", "economic", "field", "imaging", "important", "management".... | EXACT TITLE in biotech_life_sciences: "Cancer". | EXACT TITLE in healthcare: "Cancer".
0.500
analysisbetterbloodcancerchangeclinicalcollectionconditionsdatadiseasedistributionfunctiongeneralhealthcaremajoroccupationalpeoplephysicianpolicypopulation
SHARED TOKENS (29): "analysis", "better", "blood", "cancer", "change", "clinical", "collection", "conditions", "data", "disease", "distribution", "function", "general", "healthcare", "major", "occupational", "people", "physician", "policy", "population".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
activitybehaviorbettercellclinicalcouncilcovereddescribeddiseaseearlyfieldfocusedfunctionmedicinemodelorganizationphysicalresearchstudiesstudy
SHARED TOKENS (23): "activity", "behavior", "better", "cell", "clinical", "council", "covered", "described", "disease", "early", "field", "focused", "function", "medicine", "model", "organization", "physical", "research", "studies", "study".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
accesscarecommunitiescommunitydeliverydiseasedistributioneducationentirefieldfocusedhealthcareimportantlargemajormanagementoccupationalorganizedpeoplephysical
SHARED TOKENS (32): "access", "care", "communities", "community", "delivery", "disease", "distribution", "education", "entire", "field", "focused", "healthcare", "important", "large", "major", "management", "occupational", "organized", "people", "physical".... | EXACT TITLE in biotech_life_sciences: "Public health".
0.500
bettercareclassifiedclinicalcommunitiescouncilearlyenvironmentequipmentexperiencefunctionhealthcareimportantnationalneedneedsoccupationalpeoplephysicalschool
SHARED TOKENS (27): "better", "care", "classified", "clinical", "communities", "council", "early", "environment", "equipment", "experience", "function", "healthcare", "important", "national", "need", "needs", "occupational", "people", "physical", "school".... | EXACT TITLE in healthcare: "Occupational therapy".
0.500
Hospice ↗ Q608152 EXACT TITLE
accessalternativebuildingscarediseasefacilityfocusedhomehospitalinsurancemedicareneedspatientpatientspeoplephysiciansproviderssettingsupportsystem
SHARED TOKENS (23): "access", "alternative", "buildings", "care", "disease", "facility", "focused", "home", "hospital", "insurance", "medicare", "needs", "patient", "patients", "people", "physicians", "providers", "setting", "support", "system".... | EXACT TITLE in healthcare: "Hospice".
0.500
analysisbehaviorboardcareclinicalcodesdesignatedindependentmainnationalpeoplephysicalprivaterelatedresearchreviewsafetystudiesstudytype
SHARED TOKENS (21): "analysis", "behavior", "board", "care", "clinical", "codes", "designated", "independent", "main", "national", "people", "physical", "private", "related", "research", "review", "safety", "studies", "study", "type".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
additionalbecomebodycarediagnosisfieldfollowinghistoryinnovationmedicinephysicianpointresearchschooltreatment
SHARED TOKENS (15): "additional", "become", "body", "care", "diagnosis", "field", "following", "history", "innovation", "medicine", "physician", "point", "research", "school", "treatment". | EXACT TITLE in healthcare: "Ophthalmology".
0.500
accesscarecentercentersclinicclinicscommunitycoveredexpandedfamilygeneralhealthcareinternallocalmedicinenetworkpediatricpeoplepharmacypractice
SHARED TOKENS (23): "access", "care", "center", "centers", "clinic", "clinics", "community", "covered", "expanded", "family", "general", "healthcare", "internal", "local", "medicine", "network", "pediatric", "people", "pharmacy", "practice".... | EXACT TITLE in healthcare: "Community health center".
0.500
bodycarecouncileducationfieldhealthcarelicensedlicensingmaintainnursingpracticeprofessionalprogramrecognizedrequirerequirementschoolworkers
SHARED TOKENS (18): "body", "care", "council", "education", "field", "healthcare", "licensed", "licensing", "maintain", "nursing", "practice", "professional", "program", "recognized", "require", "requirement", "school", "workers". | EXACT TITLE in biotech_life_sciences: "Registered nurse".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultannualbecomecarechildrencoveredcoverseconomiceligibilityestablishedexpandedfederalfundinggeneralgovernmenthealthcarehomeinsurance
SHARED TOKENS (39): "access", "act", "adult", "annual", "become", "care", "children", "covered", "covers", "economic", "eligibility", "established", "expanded", "federal", "funding", "general", "government", "healthcare", "home", "insurance".... | EXACT TITLE in biotech_life_sciences: "Medicaid". | EXACT TITLE in healthcare: "Medicaid".
0.500
additionalclinicalcollegedirectoryeducationgeneralgovernmentgraduateshospitalsinternallicensedlicensinglocalmedicinemodelpathologyphysicianphysiciansplacespoint
SHARED TOKENS (31): "additional", "clinical", "college", "directory", "education", "general", "government", "graduates", "hospitals", "internal", "licensed", "licensing", "local", "medicine", "model", "pathology", "physician", "physicians", "places", "point".... | EXACT TITLE in healthcare: "Medical school".
0.500
activitybecomecentercentersclinicalcollectiondatadruglabmedicinemonitoringmultipleorganizationpatientsphaserequireresearchrisksafetyscale
SHARED TOKENS (26): "activity", "become", "center", "centers", "clinical", "collection", "data", "drug", "lab", "medicine", "monitoring", "multiple", "organization", "patients", "phase", "require", "research", "risk", "safety", "scale".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
accreditationassociationbetterbloodboardcarecentercentersdepartmentdesignateddiagnosisdirectlydivisionearlyemergencyfacilityhealthcarehistoryhospitalmanagement
SHARED TOKENS (33): "accreditation", "association", "better", "blood", "board", "care", "center", "centers", "department", "designated", "diagnosis", "directly", "division", "early", "emergency", "facility", "healthcare", "history", "hospital", "management".... | EXACT TITLE in healthcare: "Stroke center".
0.500
beyondbodycancerchangechildrenclinicaldiagnosisdiseaseearlyfamilyhistorylargemillionorganizationphysicalreviewrisksupplytimestype
SHARED TOKENS (22): "beyond", "body", "cancer", "change", "children", "clinical", "diagnosis", "disease", "early", "family", "history", "large", "million", "organization", "physical", "review", "risk", "supply", "times", "type".... | EXACT TITLE in healthcare: "Breast cancer".
0.500
actadditionalanchorassociationestablishedfederalfunctionlablawpracticeprocedurespublicrelatedsignificantspecialiststudiesstudysupporttreatment
SHARED TOKENS (19): "act", "additional", "anchor", "association", "established", "federal", "function", "lab", "law", "practice", "procedures", "public", "related", "significant", "specialist", "studies", "study", "support", "treatment". | EXACT TITLE in healthcare: "Dental implant".
0.500
Psychology ↗ Q9418 EXACT TITLE
activitybehaviorclassifiedclinicaleducationfamilyfieldhospitalsindividualproblemsprofessionalrelatedrelationshipsresearchschoolstudytherapeutictreatmentworkworks
SHARED TOKENS (20): "activity", "behavior", "classified", "clinical", "education", "family", "field", "hospitals", "individual", "problems", "professional", "related", "relationships", "research", "school", "study", "therapeutic", "treatment", "work", "works". | EXACT TITLE in healthcare: "Psychology".
0.500
careclinicalcurrentdiagnosisdiagnosticequipmentfieldhealthcarehospitalsimagingindustrymanagementmedicinemonitoringresearchstandardstherapeutictreatmentwork
SHARED TOKENS (19): "care", "clinical", "current", "diagnosis", "diagnostic", "equipment", "field", "healthcare", "hospitals", "imaging", "industry", "management", "medicine", "monitoring", "research", "standards", "therapeutic", "treatment", "work". | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
Urology ↗ Q105650 EXACT TITLE
additionalcancerclinicalconditionsemploymentequipmentfieldfocusedgeneralgraduatesmajormanagementmedicinemultipleoncologypediatricphysicianspractitionersproceduresprogram
SHARED TOKENS (26): "additional", "cancer", "clinical", "conditions", "employment", "equipment", "field", "focused", "general", "graduates", "major", "management", "medicine", "multiple", "oncology", "pediatric", "physicians", "practitioners", "procedures", "program".... | EXACT TITLE in biotech_life_sciences: "Urology". | EXACT TITLE in healthcare: "Urology".
0.500
accesscancercarecommunitiesdeliverydiseaseeducationexperiencefundinghealthcareidentifyinsurancemedicineneedsnursingpeoplepolicypopulationremoteresearch
SHARED TOKENS (24): "access", "cancer", "care", "communities", "delivery", "disease", "education", "experience", "funding", "healthcare", "identify", "insurance", "medicine", "needs", "nursing", "people", "policy", "population", "remote", "research".... | EXACT TITLE in healthcare: "Rural health".
0.500
Concussion ↗ Q326921 EXACT TITLE
bloodbodychildrenclassifiedconcentrationconcussionconditionsdiagnosticdirectdiseasefallsfollowinghistoryimaginginformationorganizedpeoplephysicalphysicianpractice
SHARED TOKENS (37): "blood", "body", "children", "classified", "concentration", "concussion", "conditions", "diagnostic", "direct", "disease", "falls", "following", "history", "imaging", "information", "organized", "people", "physical", "physician", "practice".... | EXACT TITLE in biotech_life_sciences: "Concussion". | EXACT TITLE in healthcare: "Concussion".
0.500
additionalalternativeannualcarecenterscmscoveredcoversdiseasedrugfederalgovernmenthealthcarehospitalinsurancemedicaidmedicaremillionnursingoutpatient
SHARED TOKENS (26): "additional", "alternative", "annual", "care", "centers", "cms", "covered", "covers", "disease", "drug", "federal", "government", "healthcare", "hospital", "insurance", "medicaid", "medicare", "million", "nursing", "outpatient".... | EXACT TITLE in biotech_life_sciences: "Medicare (United States)". | EXACT TITLE in healthcare: "Medicare (United States)".
0.500
associationcarecoveredemergencyfacilityfollowinghomehospitalinsurancemedicareneedneedsnursingoccupationalpatientspeoplephysicalprivatepublicrequire
SHARED TOKENS (25): "association", "care", "covered", "emergency", "facility", "following", "home", "hospital", "insurance", "medicare", "need", "needs", "nursing", "occupational", "patients", "people", "physical", "private", "public", "require".... | EXACT TITLE in healthcare: "Nursing home".
0.500
analysisclinicaldataentirefieldgovernmentimaginginstitutelabproceduresprogramprogramsresearchsoftwaretechnologytimestoolsuniversity
SHARED TOKENS (18): "analysis", "clinical", "data", "entire", "field", "government", "imaging", "institute", "lab", "procedures", "program", "programs", "research", "software", "technology", "times", "tools", "university". | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
additionaldiagnosisdiagnosticdirectdirectlydrugindividualmillionoperatingpeoplephysicalproblemsqualifiedrelatedwomen
SHARED TOKENS (15): "additional", "diagnosis", "diagnostic", "direct", "directly", "drug", "individual", "million", "operating", "people", "physical", "problems", "qualified", "related", "women". | EXACT TITLE in healthcare: "Substance use disorder".
0.500
adaadultboardboisecampuscanyoncollegecommunityeducationgovernedidaholargenampapopulationprogramspublicreportedresidentsstudentstreasure
SHARED TOKENS (23): "ada", "adult", "board", "boise", "campus", "canyon", "college", "community", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents", "students", "treasure".... | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
0.500
actbloodcellularcosmeticcurrentdepartmentdirectlydrugemployeesfederalfieldfoodproductspublicrelatedsafetywork
SHARED TOKENS (17): "act", "blood", "cellular", "cosmetic", "current", "department", "directly", "drug", "employees", "federal", "field", "food", "products", "public", "related", "safety", "work". | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
Hospital ↗ Q16917 EXACT TITLE
additionalcampuscardiologycarecentercenterschildrenclassifiedcliniccurrentlydepartmentdepartmentsdirectemergencyequipmentestablishedfacilityfundinggeneralgovernment
SHARED TOKENS (61): "additional", "campus", "cardiology", "care", "center", "centers", "children", "classified", "clinic", "currently", "department", "departments", "direct", "emergency", "equipment", "established", "facility", "funding", "general", "government".... | EXACT TITLE in biotech_life_sciences: "Hospital". | EXACT TITLE in healthcare: "Hospital".
0.480
analysisbetterbuildingdatadiseasefieldimportantinformationlargenetworksprogrammingsoftwaresystemstools
SHARED TOKENS (14): "analysis", "better", "building", "data", "disease", "field", "important", "information", "large", "networks", "programming", "software", "systems", "tools". | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.480
Neurology ↗ Q83042 EXACT TITLE
clinicalconditionsdiagnosisdiseasefieldmedicinemultiplephysicianpracticeresearchspinalstudysystemtreatment
SHARED TOKENS (14): "clinical", "conditions", "diagnosis", "disease", "field", "medicine", "multiple", "physician", "practice", "research", "spinal", "study", "system", "treatment". | EXACT TITLE in biotech_life_sciences: "Neurology".
0.480
bestcareeducationidahomedicinenetworknewspublicregionresearchresidentsschoolstudentsuniversity
SHARED TOKENS (14): "best", "care", "education", "idaho", "medicine", "network", "news", "public", "region", "research", "residents", "school", "students", "university". | EXACT TITLE in healthcare: "University of Washington School of Medicine".
0.480
carefieldmedicinephysicalphysicianphysicianspractitionersrecognizedrelatedspecialistsspecialtiesstandardstreatmentwork
SHARED TOKENS (14): "care", "field", "medicine", "physical", "physician", "physicians", "practitioners", "recognized", "related", "specialists", "specialties", "standards", "treatment", "work". | EXACT TITLE in healthcare: "Sports medicine".
0.460
actcosmeticdrugfederalfoodlawmembersnationalpatientsprovisionssafetystudytimes
SHARED TOKENS (13): "act", "cosmetic", "drug", "federal", "food", "law", "members", "national", "patients", "provisions", "safety", "study", "times". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.460
Biomaterial ↗ Q865663 EXACT TITLE
bodycarediagnosticfieldfunctionhistorylargemedicineproductsstudysystemsystemstherapeutic
SHARED TOKENS (13): "body", "care", "diagnostic", "field", "function", "history", "large", "medicine", "products", "study", "system", "systems", "therapeutic". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.450
clinicalgovgovernmentmedicinenational
SHARED TOKENS (5): "clinical", "gov", "government", "medicine", "national". | URL->A (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
economicindividualinformationinnovationlandlawlegalmainoriginalpeopleproblemssystems
SHARED TOKENS (12): "economic", "individual", "information", "innovation", "land", "law", "legal", "main", "original", "people", "problems", "systems". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.440
actbureaucommunitydepartmentdistributiondrugenforcementestablishedfederalgovernmentlawnational
SHARED TOKENS (12): "act", "bureau", "community", "department", "distribution", "drug", "enforcement", "established", "federal", "government", "law", "national". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.440
Cardiology ↗ Q10379 EXACT TITLE
cardiologydiagnosisdiseasefieldgeneralinternalmedicinepediatricphysiciansstudysystemtreatment
SHARED TOKENS (12): "cardiology", "diagnosis", "disease", "field", "general", "internal", "medicine", "pediatric", "physicians", "study", "system", "treatment". | EXACT TITLE in biotech_life_sciences: "Cardiology". | EXACT TITLE in healthcare: "Cardiology".
0.440
bodycancerconditionsdiseasefocusedlargemedicinephysiciansproblemssmallstudysystem
SHARED TOKENS (12): "body", "cancer", "conditions", "disease", "focused", "large", "medicine", "physicians", "problems", "small", "study", "system". | EXACT TITLE in healthcare: "Gastroenterology".
0.440
carecommunityconditionsfocusedhomemultipleneedneedsnursingpatientspeoplepractitioners
SHARED TOKENS (12): "care", "community", "conditions", "focused", "home", "multiple", "need", "needs", "nursing", "patients", "people", "practitioners". | EXACT TITLE in healthcare: "Long-term care".
0.440
Farmworker ↗ Q5060555 EXACT TITLE
adoptionagricultureconditionseconomiclaborlaworganizedrelatedtechnologyvalleyworkworking
SHARED TOKENS (12): "adoption", "agriculture", "conditions", "economic", "labor", "law", "organized", "related", "technology", "valley", "work", "working". | EXACT TITLE in healthcare: "Farmworker".
0.440
actcosmeticcurrentlydrugfederalfoodlawprivatepublicstandardssystemsystems
SHARED TOKENS (12): "act", "cosmetic", "currently", "drug", "federal", "food", "law", "private", "public", "standards", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.440
diagnosticdiseaseequipmentimagingproductsresearchspacestandardssystemstechnologytoolsworking
SHARED TOKENS (12): "diagnostic", "disease", "equipment", "imaging", "products", "research", "space", "standards", "systems", "technology", "tools", "working". | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.440
centerdoctoraleducationemployersfacultymembersprivatepublicresearchsitesstudentsuniversity
SHARED TOKENS (12): "center", "doctoral", "education", "employers", "faculty", "members", "private", "public", "research", "sites", "students", "university". | EXACT TITLE in biotech_life_sciences: "Research university".
0.420
behaviorcellulardescribedexpandedimagingindividualmedicinespinalstudiesstudysystem
SHARED TOKENS (11): "behavior", "cellular", "described", "expanded", "imaging", "individual", "medicine", "spinal", "studies", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.420
Virology ↗ Q7215 EXACT TITLE
agriculturecoveringdetectiondiseasefieldmedicinepathologyresearchsignificantstudywelfare
SHARED TOKENS (11): "agriculture", "covering", "detection", "disease", "field", "medicine", "pathology", "research", "significant", "study", "welfare". | EXACT TITLE in biotech_life_sciences: "Virology".
0.420
departmentfundinggovernedpublicregardlessresearchreviewsignificantstandardtitlewelfare
SHARED TOKENS (11): "department", "funding", "governed", "public", "regardless", "research", "review", "significant", "standard", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.420
boardcarecentersclinicsemergencyfederalhealthcarehospitalhospitalsphysiciansites
SHARED TOKENS (11): "board", "care", "centers", "clinics", "emergency", "federal", "healthcare", "hospital", "hospitals", "physician", "sites". | EXACT TITLE in healthcare: "HCA Healthcare".
0.400
communitycompoundingdemanddrugfieldhospitalhospitalsneedsoutpatientpharmacy
SHARED TOKENS (10): "community", "compounding", "demand", "drug", "field", "hospital", "hospitals", "needs", "outpatient", "pharmacy". | EXACT TITLE in biotech_life_sciences: "Compounding". | EXACT TITLE in healthcare: "Compounding".
0.400
activityconditionsdirectlydiseasefoodmaintainmajorpeoplephysicalwork
SHARED TOKENS (10): "activity", "conditions", "directly", "disease", "food", "maintain", "major", "people", "physical", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.400
carecoversdiagnosticdiseaseneedspatientpracticeprovidertreatmenttype
SHARED TOKENS (10): "care", "covers", "diagnostic", "disease", "needs", "patient", "practice", "provider", "treatment", "type". | EXACT TITLE in healthcare: "Nurse practitioner".
0.400
activeanalysisfieldlabsmallsupplysystemsystemstechnologyworking
SHARED TOKENS (10): "active", "analysis", "field", "lab", "small", "supply", "system", "systems", "technology", "working". | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.400
directlyearlyfieldfoodorganizedproductssafetystudiesstudytechnology
SHARED TOKENS (10): "directly", "early", "field", "food", "organized", "products", "safety", "studies", "study", "technology". | EXACT TITLE in biotech_life_sciences: "Food science".
0.400
backbloodcancercelldiseasefieldmajormedicinephysicalwork
SHARED TOKENS (10): "back", "blood", "cancer", "cell", "disease", "field", "major", "medicine", "physical", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.380
behaviorcommunitycompetingindividualorganizationpeopleprofessionalrelationshipswork
SHARED TOKENS (9): "behavior", "community", "competing", "individual", "organization", "people", "professional", "relationships", "work". | EXACT TITLE in biotech_life_sciences: "Mental health". | EXACT TITLE in healthcare: "Mental health".
0.380
Naloxone ↗ Q282902 EXACT TITLE
begindatadiseaseorganizationproblemssafetysmallsoldsystem
SHARED TOKENS (9): "begin", "data", "disease", "organization", "problems", "safety", "small", "sold", "system". | EXACT TITLE in healthcare: "Naloxone".
0.380
Cell biology ↗ Q7141 EXACT TITLE
behaviorcancercellcellularfunctionresearchstudiesstudywork
SHARED TOKENS (9): "behavior", "cancer", "cell", "cellular", "function", "research", "studies", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.380
bodyenvironmentfacilityindustrymainphasereturntreatmenttype
SHARED TOKENS (9): "body", "environment", "facility", "industry", "main", "phase", "return", "treatment", "type". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.380
Microbiology ↗ Q7193 EXACT TITLE
classifiedclinicalcurrentcurrentlysearchsmallstudytoolswork
SHARED TOKENS (9): "classified", "clinical", "current", "currently", "search", "small", "study", "tools", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.380
diseaseeducationfamilyfieldmanagementmedicineresourcesrisksupport
SHARED TOKENS (9): "disease", "education", "family", "field", "management", "medicine", "resources", "risk", "support". | EXACT TITLE in healthcare: "Genetic counseling".
0.380
Toxicology ↗ Q7218 EXACT TITLE
cancercurrentlyenvironmentfieldmedicinepracticeresearchstudytreatment
SHARED TOKENS (9): "cancer", "currently", "environment", "field", "medicine", "practice", "research", "study", "treatment". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.370
boisecenterclinicsemployeeshealthcarehospitalhospitalsidaholukeregionalsystem
SHARED TOKENS (11): "boise", "center", "clinics", "employees", "healthcare", "hospital", "hospitals", "idaho", "luke", "regional", "system". | URL->B (1): https://www.stlukesonline.org/.
0.360
associationcentersindustryinnovationorganizationrelatedresearchserves
SHARED TOKENS (8): "association", "centers", "industry", "innovation", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.360
adultchildrenhospitalhospitalsinternalmedicinepediatricspecialties
SHARED TOKENS (8): "adult", "children", "hospital", "hospitals", "internal", "medicine", "pediatric", "specialties". | EXACT TITLE in healthcare: "Children's hospital".
0.360
accreditationassociationcarelicensuremedicaidmedicareorganizationprograms
SHARED TOKENS (8): "accreditation", "association", "care", "licensure", "medicaid", "medicare", "organization", "programs". | EXACT TITLE in healthcare: "Joint Commission".
0.360
Patent ↗ Q253623 EXACT TITLE
lawlegalnationalorganizationprivatepublictechnologytype
SHARED TOKENS (8): "law", "legal", "national", "organization", "private", "public", "technology", "type". | EXACT TITLE in biotech_life_sciences: "Patent".
0.360
activityagainstcurrentfieldlargemajorpatientstreatment
SHARED TOKENS (8): "activity", "against", "current", "field", "large", "major", "patients", "treatment". | EXACT TITLE in healthcare: "Transcranial magnetic stimulation".
0.360
Microscopy ↗ Q1074953 EXACT TITLE
collectionfieldimaginginsidephysicalsmallstandardstudies
SHARED TOKENS (8): "collection", "field", "imaging", "inside", "physical", "small", "standard", "studies". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.360
clinicshealthcarehospitalsidahoorganizationpeoplesystemwestern
SHARED TOKENS (8): "clinics", "healthcare", "hospitals", "idaho", "organization", "people", "system", "western". | EXACT TITLE in healthcare: "Intermountain Health".
0.360
Hematology ↗ Q103824 EXACT TITLE
analysisbloodcellmedicinemultiplerelatedstudytreatment
SHARED TOKENS (8): "analysis", "blood", "cell", "medicine", "multiple", "related", "study", "treatment". | EXACT TITLE in biotech_life_sciences: "Hematology".
0.340
additionalbloodconditionsdiseasepatientspinalsystems
SHARED TOKENS (7): "additional", "blood", "conditions", "disease", "patient", "spinal", "systems". | EXACT TITLE in healthcare: "Spinal fusion".
0.340
boisedepartmentfederalgovernmentidahomainregional
SHARED TOKENS (7): "boise", "department", "federal", "government", "idaho", "main", "regional". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.340
departmenteconomicidahoinsurancelabortechnologyworkforce
SHARED TOKENS (7): "department", "economic", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.340
actcodefederallawpublictitlewelfare
SHARED TOKENS (7): "act", "code", "federal", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.330
alphonsusboisebuildingbuildingshospitalidahonationalplacessmall
SHARED TOKENS (9): "alphonsus", "boise", "building", "buildings", "hospital", "idaho", "national", "places", "small". | URL->B (1): https://www.saintalphonsus.org/.
0.320
Massage ↗ Q179415 EXACT TITLE
bodyclinicalindustrypointprofessionaltreatment
SHARED TOKENS (6): "body", "clinical", "industry", "point", "professional", "treatment". | EXACT TITLE in healthcare: "Massage".
0.320
Biosensor ↗ Q669391 EXACT TITLE
cellconnectsdetectionstudyworkingworks
SHARED TOKENS (6): "cell", "connects", "detection", "study", "working", "works". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.320
federallyidahoinsuranceorganizationpeoplesmall
SHARED TOKENS (6): "federally", "idaho", "insurance", "organization", "people", "small". | EXACT TITLE in healthcare: "Your Health Idaho".
0.320
bloodfacilityinformationpeopleresearchstudies
SHARED TOKENS (6): "blood", "facility", "information", "people", "research", "studies". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.320
analysiscelldatafieldrelationshipssystems
SHARED TOKENS (6): "analysis", "cell", "data", "field", "relationships", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.320
generalpeoplephysicalrecoveryreturnrisk
SHARED TOKENS (6): "general", "people", "physical", "recovery", "return", "risk". | EXACT TITLE in healthcare: "Knee replacement".
0.320
diagnosisdrugneedspathologypeopleproblems
SHARED TOKENS (6): "diagnosis", "drug", "needs", "pathology", "people", "problems". | EXACT TITLE in healthcare: "Dual diagnosis".
0.320
Histology ↗ Q7168 EXACT TITLE
fieldmedicineplacesstudiesstudyvisible
SHARED TOKENS (6): "field", "medicine", "places", "studies", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.320
conditionsdiseaseeconomicmanagementpathologystudy
SHARED TOKENS (6): "conditions", "disease", "economic", "management", "pathology", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.310
federalgovernmentinstitutemedicinemillionnationalrelatedworks
SHARED TOKENS (8): "federal", "government", "institute", "medicine", "million", "national", "related", "works". | URL->A (1): http://clinicaltrials.gov/.
0.300
againstassociationboardcarecodecodescurrentdataeducationestablishedgovernedhouseinsurancelicensingmanagementmedicinemembershiporganizationphysicianphysicians
SHARED TOKENS (31): "against", "association", "board", "care", "code", "codes", "current", "data", "education", "established", "governed", "house", "insurance", "licensing", "management", "medicine", "membership", "organization", "physician", "physicians"....
0.300
boardbureaucarecommunitiesdepartmentdivisioneducationgovernmentinsurancemembersnationalpositionsprogramprovidersrequirementresourcesschoolstudentstimeswork
SHARED TOKENS (22): "board", "bureau", "care", "communities", "department", "division", "education", "government", "insurance", "members", "national", "positions", "program", "providers", "requirement", "resources", "school", "students", "times", "work"....
0.300
caredirecthealthcaremodelphysicianphysicianspracticeproviderprovidersqualifiedsignificantsupporttreatmenttypework
SHARED TOKENS (15): "care", "direct", "healthcare", "model", "physician", "physicians", "practice", "provider", "providers", "qualified", "significant", "support", "treatment", "type", "work".
0.300
actagenciesbusinessemployershealthcarehospitalsindependentneednursingphysicianphysicianspositionspracticeprofessionalspecificallystaffsupportwork
SHARED TOKENS (18): "act", "agencies", "business", "employers", "healthcare", "hospitals", "independent", "need", "nursing", "physician", "physicians", "positions", "practice", "professional", "specifically", "staff", "support", "work".
0.300
againstcareconsumerearlyfederalimportantindividualpatientplanqualifiedrequirementsettingstandardsystemtreatment
SHARED TOKENS (15): "against", "care", "consumer", "early", "federal", "important", "individual", "patient", "plan", "qualified", "requirement", "setting", "standard", "system", "treatment".
0.300
agriculturebackdirectearlyexpansiongeneralhistoryimportantindustrylargepipelinescalesmallsystemstechnologywelfare
SHARED TOKENS (16): "agriculture", "back", "direct", "early", "expansion", "general", "history", "important", "industry", "large", "pipeline", "scale", "small", "systems", "technology", "welfare".
0.300
businesscapitalcentersemploymentgovernmentlocalnetworksplacesprivatepublicrelatedresearchsupportingtechnologyvalleyventure
SHARED TOKENS (16): "business", "capital", "centers", "employment", "government", "local", "networks", "places", "private", "public", "related", "research", "supporting", "technology", "valley", "venture".
0.300
actboardclinicalcosmeticdatadistributiondrugfoodinformationmonitoringneedpatientsrecordsrequirereviewrisksafetysignificantsmallstudies
SHARED TOKENS (23): "act", "board", "clinical", "cosmetic", "data", "distribution", "drug", "food", "information", "monitoring", "need", "patients", "records", "require", "review", "risk", "safety", "significant", "small", "studies"....
0.300
activitybeyondbloodbodycancerchangediseaseimaginglargemanagementmillionphysicalrisksmalltype
SHARED TOKENS (15): "activity", "beyond", "blood", "body", "cancer", "change", "disease", "imaging", "large", "management", "million", "physical", "risk", "small", "type".
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysisbodycellcoversentireexpandedfieldfoodimportantlargescalespecificallystudysystem
SHARED TOKENS (15): "activity", "analysis", "body", "cell", "covers", "entire", "expanded", "field", "food", "important", "large", "scale", "specifically", "study", "system".
0.300
Immunotherapy ↗ Q1427096 KW CROSS HIGH
activeactivityagainstbetterbeyondbodycancercellcellularclinicalconditionsdiseaselicensedmedicineoncologypatientsreportedstudiesstudysystem
SHARED TOKENS (25): "active", "activity", "against", "better", "beyond", "body", "cancer", "cell", "cellular", "clinical", "conditions", "disease", "licensed", "medicine", "oncology", "patients", "reported", "studies", "study", "system"....
0.300
adultbackbloodbodycarecelldiagnosisequipmentfallsfunctionimagingindividualmainmajoroccupationalpeoplephysicalproblemsrecoveryrequire
SHARED TOKENS (26): "adult", "back", "blood", "body", "care", "cell", "diagnosis", "equipment", "falls", "function", "imaging", "individual", "main", "major", "occupational", "people", "physical", "problems", "recovery", "require"....
0.300
carediagnosisdiagnosticdiseasefieldfollowinghealthcarehistoryidentifyinformationmajorpatientphysicalpointproceduresprofessionalseekingstudy
SHARED TOKENS (18): "care", "diagnosis", "diagnostic", "disease", "field", "following", "healthcare", "history", "identify", "information", "major", "patient", "physical", "point", "procedures", "professional", "seeking", "study".
0.300
actbloodcancerdatadetectiondiagnosisdiagnosticearlyfamilyhistoryimagingpopulationrisktreatmentuniversal
SHARED TOKENS (15): "act", "blood", "cancer", "data", "detection", "diagnosis", "diagnostic", "early", "family", "history", "imaging", "population", "risk", "treatment", "universal".
0.300
additionalalongsideclinicaleducationgraduatesmedicineoperatingphysicianspracticeprogramprogramsschoolspecialtiesstudentsstudysystem
SHARED TOKENS (16): "additional", "alongside", "clinical", "education", "graduates", "medicine", "operating", "physicians", "practice", "program", "programs", "school", "specialties", "students", "study", "system".
0.300
agenciescancercarecentersclinicalcoordinatesdedicateddepartmentdiagnosisfundinggrantsinformationinstitutenationalnetworknihpatientsprogramprogramsrelated
SHARED TOKENS (22): "agencies", "cancer", "care", "centers", "clinical", "coordinates", "dedicated", "department", "diagnosis", "funding", "grants", "information", "institute", "national", "network", "nih", "patients", "program", "programs", "related"....
0.300
behaviorcaredatafieldhealthcarehospitalsinformationmanagementpatientproblemsresearchsoftwarestudysystemstechnology
SHARED TOKENS (15): "behavior", "care", "data", "field", "healthcare", "hospitals", "information", "management", "patient", "problems", "research", "software", "study", "systems", "technology".
0.300
careconditionscoveringdiagnosisdiseasefoodmaintainmanagementmedicinemonitoringphysicianprofessionalresearchsafetysupplytreatmenttypewelfareworkworkers
SHARED TOKENS (20): "care", "conditions", "covering", "diagnosis", "disease", "food", "maintain", "management", "medicine", "monitoring", "physician", "professional", "research", "safety", "supply", "treatment", "type", "welfare", "work", "workers".
0.300
actagainstcarechildrencoveringentireexpansionfederalgovernmentinsurancelargemajormedicaidmedicaremillionneedsnursingpeoplepopulationprivate
SHARED TOKENS (32): "act", "against", "care", "children", "covering", "entire", "expansion", "federal", "government", "insurance", "large", "major", "medicaid", "medicare", "million", "needs", "nursing", "people", "population", "private"....
0.300
accessalreadychildrendeliveryearlyestablishedexplicitlyfederalfederallyframeworkindividuallawlegalorganizationpatientpositionsprovidersseekingsupportwomen
SHARED TOKENS (20): "access", "already", "children", "delivery", "early", "established", "explicitly", "federal", "federally", "framework", "individual", "law", "legal", "organization", "patient", "positions", "providers", "seeking", "support", "women".
0.300
additionalbeyondbloodcancercelldiseaseexpandedfollowinginsidemajormultiplepatientpatientsstemsystemtwin
SHARED TOKENS (16): "additional", "beyond", "blood", "cancer", "cell", "disease", "expanded", "following", "inside", "major", "multiple", "patient", "patients", "stem", "system", "twin".
0.300
Buprenorphine ↗ KW CROSS HIGH
activityalreadyblooddrugfollowinghistoryimportantmedicinemillionorganizationpointreportedrisktreatmenttype
SHARED TOKENS (15): "activity", "already", "blood", "drug", "following", "history", "important", "medicine", "million", "organization", "point", "reported", "risk", "treatment", "type".
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagenciescentersconditionscurrentlydiseasefoodgovernmentgrowingimportantindustrylandmillionproductsprofessionalrelatedresearchstudytype
SHARED TOKENS (19): "additional", "agencies", "centers", "conditions", "currently", "disease", "food", "government", "growing", "important", "industry", "land", "million", "products", "professional", "related", "research", "study", "type".
0.300
conditionsmanagementspinalsystemtreatment
SHARED TOKENS (5): "conditions", "management", "spinal", "system", "treatment". | EXACT TITLE in healthcare: "Neurosurgery".
0.300
Lung cancer ↗ Q47912 KW CROSS HIGH
alongsidealreadybodycancercelldiagnosisdiseasedrugearlyexperiencefunctionimaginglargemillionnationalpeopleproblemstreatmenttypewomen
SHARED TOKENS (20): "alongside", "already", "body", "cancer", "cell", "diagnosis", "disease", "drug", "early", "experience", "function", "imaging", "large", "million", "national", "people", "problems", "treatment", "type", "women".
0.300
actannualcarecoversemergencyemployeesemployersfederallyhealthcarehospitalsinsuranceorganizationpatientsproviderprovidersregardless
SHARED TOKENS (16): "act", "annual", "care", "covers", "emergency", "employees", "employers", "federally", "healthcare", "hospitals", "insurance", "organization", "patients", "provider", "providers", "regardless".
0.300
adoptioncareclinicalcollectionconditionsdatadeliveryhealthcarehistoryidentifyinformationinnovationlargemultipleneednetworkspatientpatientspopulationprovider
SHARED TOKENS (27): "adoption", "care", "clinical", "collection", "conditions", "data", "delivery", "healthcare", "history", "identify", "information", "innovation", "large", "multiple", "need", "networks", "patient", "patients", "population", "provider"....
0.300
accessbackbettercancercareconditionsdiseaseeconomicemploymentfamilyimportantlargemajormillionorganizationphysicalpopulationrecordsrelatedrisk
SHARED TOKENS (23): "access", "back", "better", "cancer", "care", "conditions", "disease", "economic", "employment", "family", "important", "large", "major", "million", "organization", "physical", "population", "records", "related", "risk"....
0.300
Psychotherapy ↗ Q183257 KW CROSS HIGH
behaviorbestchangechildrenclinicalconditionsfamilygeneralindividuallicensedproblemsprofessionalrelationshipsresearchreviewsmallsupporttherapeutictreatmentworkers
SHARED TOKENS (20): "behavior", "best", "change", "children", "clinical", "conditions", "family", "general", "individual", "licensed", "problems", "professional", "relationships", "research", "review", "small", "support", "therapeutic", "treatment", "workers".
0.300
Sleep medicine ↗ Q744029 KW CROSS HIGH
becomeboardclinicsdiagnosisdirectlydivisioneconomicestablishedfieldhospitalinstitutemedicinenationalorganizedpatientsphysicianphysiciansprogramsrecognizedrelated
SHARED TOKENS (29): "become", "board", "clinics", "diagnosis", "directly", "division", "economic", "established", "field", "hospital", "institute", "medicine", "national", "organized", "patients", "physician", "physicians", "programs", "recognized", "related"....
0.300
actadditionalbackcareconditionscovereddeliveryeducationeligibilityexpandedexpansionfederalfundinghealthcareindividualinsurancelawlegalmajormarch
SHARED TOKENS (34): "act", "additional", "back", "care", "conditions", "covered", "delivery", "education", "eligibility", "expanded", "expansion", "federal", "funding", "healthcare", "individual", "insurance", "law", "legal", "major", "march"....
0.300
Roe v. Wade ↗ Q300950 KW CROSS HIGH
againstclassifiedcommunitycompetingearlyfederalfollowingframeworkgovernmenthistorylegallocalorganizationpointreviewstandardwomen
SHARED TOKENS (17): "against", "classified", "community", "competing", "early", "federal", "following", "framework", "government", "history", "legal", "local", "organization", "point", "review", "standard", "women".
0.300
agentsbeginbloodcancercarechildrendiseaseeducationhealthcarehomeidentifyimportantindividualinformationmaintainmillionorganizationpeopleproviderrelated
SHARED TOKENS (22): "agents", "begin", "blood", "cancer", "care", "children", "disease", "education", "healthcare", "home", "identify", "important", "individual", "information", "maintain", "million", "organization", "people", "provider", "related"....
0.300
centercliniccurrentdirecteducationenvironmenthospitalhospitalsmedicinephysicianphysicianspracticeprogramprogramsqualifiedsettinguniversity
SHARED TOKENS (17): "center", "clinic", "current", "direct", "education", "environment", "hospital", "hospitals", "medicine", "physician", "physicians", "practice", "program", "programs", "qualified", "setting", "university".
0.300
actactivitybusinesscapitalcompetitionconsolidationdepartmentdescribeddirectfederalgovernedgovernmentlawlegalmanagementmarketoperatingorganizationregulatoryrequire
SHARED TOKENS (21): "act", "activity", "business", "capital", "competition", "consolidation", "department", "described", "direct", "federal", "governed", "government", "law", "legal", "management", "market", "operating", "organization", "regulatory", "require"....
0.300
activeblogcapacitycapitalcarecurrentdatademanddirectfacilitygovernmentgraduatesgrowinghealthcarelaborlicensedlocalmarketmedicinemillion
SHARED TOKENS (37): "active", "blog", "capacity", "capital", "care", "current", "data", "demand", "direct", "facility", "government", "graduates", "growing", "healthcare", "labor", "licensed", "local", "market", "medicine", "million"....
0.300
accessanalysisbecomebehaviorbestbettercardiologycareclinicalcommunitiescomplianceconditionsdeliverydepartmentdetectionearlyemergencyhealthcarehomehospital
SHARED TOKENS (41): "access", "analysis", "become", "behavior", "best", "better", "cardiology", "care", "clinical", "communities", "compliance", "conditions", "delivery", "department", "detection", "early", "emergency", "healthcare", "home", "hospital"....
0.300
activityalreadybodycareconditionsdesignateddiseasefollowingfoodgeneralmanagementpeoplephysicalpointproceduresrelatedrisksignificantstandardtreatment
SHARED TOKENS (21): "activity", "already", "body", "care", "conditions", "designated", "disease", "following", "food", "general", "management", "people", "physical", "point", "procedures", "related", "risk", "significant", "standard", "treatment"....
0.300
additionalbettercareclinicalidentifymanagementmedicineoccupationalpathologyphysicalphysicianphysicianspracticepractitionersproceduresspecialistssupporttreatment
SHARED TOKENS (18): "additional", "better", "care", "clinical", "identify", "management", "medicine", "occupational", "pathology", "physical", "physician", "physicians", "practice", "practitioners", "procedures", "specialists", "support", "treatment".
0.300
bloodbodycareclinicalclinicsdescribeddiagnosisemergencyenvironmentgeneralhealthcarehomehospitalhospitalsnursingoperatingoriginphysiciansrequireresearch
SHARED TOKENS (23): "blood", "body", "care", "clinical", "clinics", "described", "diagnosis", "emergency", "environment", "general", "healthcare", "home", "hospital", "hospitals", "nursing", "operating", "origin", "physicians", "require", "research"....
0.300
Health equity ↗ Q1512929 KW CROSS HIGH
accessbegincareclassifieddescribeddiseasedistributedeconomichealthcareimportantindividualneedorganizationphysicalpopulationrelatedresourcesspecificallysystems
SHARED TOKENS (19): "access", "begin", "care", "classified", "described", "disease", "distributed", "economic", "healthcare", "important", "individual", "need", "organization", "physical", "population", "related", "resources", "specifically", "systems".
0.300
clinicalfederalregulatoryresearchstandards
SHARED TOKENS (5): "clinical", "federal", "regulatory", "research", "standards". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.300
Mammography ↗ Q324634 KW CROSS HIGH
additionalcancercarechangecollegedetectiondiagnosisearlyequipmentimagingpatientspointsignificantsmallwomen
SHARED TOKENS (15): "additional", "cancer", "care", "change", "college", "detection", "diagnosis", "early", "equipment", "imaging", "patients", "point", "significant", "small", "women".
0.300
Stark Law ↗ Q7601961 KW CROSS HIGH
careclinicaldesignatedemploymentequipmentfamilyfederalhomehospitalimaginginitiallawmedicaidmedicareoccupationalofficeoutpatientpathologypatientphysical
SHARED TOKENS (25): "care", "clinical", "designated", "employment", "equipment", "family", "federal", "home", "hospital", "imaging", "initial", "law", "medicaid", "medicare", "occupational", "office", "outpatient", "pathology", "patient", "physical"....
0.300
Charity care ↗ Q5074539 KW CROSS HIGH
carecompetitiondemandfederalgovernmentgrowinghospitalsinsurancemaintainmedicaidmedicarepatientsphysicianpracticeprogramsproviderssupport
SHARED TOKENS (17): "care", "competition", "demand", "federal", "government", "growing", "hospitals", "insurance", "maintain", "medicaid", "medicare", "patients", "physician", "practice", "programs", "providers", "support".
0.300
actadditionalcareemployeesenrollmentfederalinsurancelawmedicaidmillionoperationalpatientpeopleprivatesmalltype
SHARED TOKENS (16): "act", "additional", "care", "employees", "enrollment", "federal", "insurance", "law", "medicaid", "million", "operational", "patient", "people", "private", "small", "type".
0.300
againstassociationcarecurrentlygovernmenthospitalhospitalsindustryinsurancemedicareorganizationpatientspeopleproviderspublic
SHARED TOKENS (15): "against", "association", "care", "currently", "government", "hospital", "hospitals", "industry", "insurance", "medicare", "organization", "patients", "people", "providers", "public".
0.300
actconditionsdepartmenteducationemploymentestablishedfederallaborlawoccupationaloutreachregulatorysafetysettingstandardswomenworking
SHARED TOKENS (17): "act", "conditions", "department", "education", "employment", "established", "federal", "labor", "law", "occupational", "outreach", "regulatory", "safety", "setting", "standards", "women", "working".
0.300
adultannualappointmentscareconditionsdefinitionsdepartmentdrugeducationfacilityfollowinghealthcareimportantindividualinformationmillionmultiplenationalpatientspeople
SHARED TOKENS (28): "adult", "annual", "appointments", "care", "conditions", "definitions", "department", "drug", "education", "facility", "following", "healthcare", "important", "individual", "information", "million", "multiple", "national", "patients", "people"....
0.300
additionalagenciescaredepartmentemergencyemployeeshospitalmembersmodelpatientpatientsphysiciansplacespointpublicqualifiedresourcessearchsupportsystems
SHARED TOKENS (21): "additional", "agencies", "care", "department", "emergency", "employees", "hospital", "members", "model", "patient", "patients", "physicians", "places", "point", "public", "qualified", "resources", "search", "support", "systems"....
0.300
activityadditionalbecomecarecentersclinicalcollegecommunitiescommunityconditionsconnectdeliverydetectiondiseaseearlyeducationemergencyexperiencefamilygeneral
SHARED TOKENS (48): "activity", "additional", "become", "care", "centers", "clinical", "college", "communities", "community", "conditions", "connect", "delivery", "detection", "disease", "early", "education", "emergency", "experience", "family", "general"....
0.300
Acupuncture ↗ Q121713 KW CROSS HIGH
alternativebetterbodyconditionsearlyfoundationalhealthcareindustrymainmajormarketmedicinepractitionersreachreportedreviewrisksupportsystemsystems
SHARED TOKENS (22): "alternative", "better", "body", "conditions", "early", "foundational", "healthcare", "industry", "main", "major", "market", "medicine", "practitioners", "reach", "reported", "review", "risk", "support", "system", "systems"....
0.300
analysisbehaviorbettercellcellularcenterdatadiseasefieldfunctioninternalmodelmultiplenetworknetworksoperationalperformingrelationshipsresearchstudies
SHARED TOKENS (23): "analysis", "behavior", "better", "cell", "cellular", "center", "data", "disease", "field", "function", "internal", "model", "multiple", "network", "networks", "operational", "performing", "relationships", "research", "studies"....
0.300
bodycancercellcellularconditionsdiagnosisdiseaseearlygeneralimaginginsideinternallocaloncologypatientphysicianproceduresrisktherapeutictreatment
SHARED TOKENS (22): "body", "cancer", "cell", "cellular", "conditions", "diagnosis", "disease", "early", "general", "imaging", "inside", "internal", "local", "oncology", "patient", "physician", "procedures", "risk", "therapeutic", "treatment"....
0.300
accessassociationcenterdesignatedemployeesfederalgovernmentindependentinsurancelocallymembersmillionnetworkoperatesoperatingparticipatespeopleprogramprovider
SHARED TOKENS (19): "access", "association", "center", "designated", "employees", "federal", "government", "independent", "insurance", "locally", "members", "million", "network", "operates", "operating", "participates", "people", "program", "provider".
0.300
actcaredirectlyeligibilityestablishedexpansionfederalgovernmentinsurancelawmedicaidmillionpeopleplanprivateprovisionsresidents
SHARED TOKENS (17): "act", "care", "directly", "eligibility", "established", "expansion", "federal", "government", "insurance", "law", "medicaid", "million", "people", "plan", "private", "provisions", "residents".
0.300
Serology ↗ Q502159 EXACT TITLE
againstbloodbodydiseasestudy
SHARED TOKENS (5): "against", "blood", "body", "disease", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.300
Immunization ↗ Q1415366 KW CROSS HIGH
activeagainstbecomebodycancercarechildrendedicateddirectdiseasefunctionimportantindividualmainmajorpeoplepublicrisksystemsystems
SHARED TOKENS (21): "active", "against", "become", "body", "cancer", "care", "children", "dedicated", "direct", "disease", "function", "important", "individual", "main", "major", "people", "public", "risk", "system", "systems"....
0.300
actbureaucarecenterdepartmentdepartmentseconomiceducationfamilyfederalfoodgovernmentmedicaidmillionnationalpeoplepolicypopulationprogramprograms
SHARED TOKENS (27): "act", "bureau", "care", "center", "department", "departments", "economic", "education", "family", "federal", "food", "government", "medicaid", "million", "national", "people", "policy", "population", "program", "programs"....
0.300
analysisbeyondclinicaldataequipmentinformationmanagementmedicinemultipleoriginalresearchsignificantsoftwaresupportsystemsystemstimestoolswork
SHARED TOKENS (19): "analysis", "beyond", "clinical", "data", "equipment", "information", "management", "medicine", "multiple", "original", "research", "significant", "software", "support", "system", "systems", "times", "tools", "work".
0.300
becomecareclinicsdepartmentsdirectlyearlyemergencyfollowinggeneralhospitalinternalmedicinemodelpatientsphasephysicianspracticepractitionersprogramsproviders
SHARED TOKENS (26): "become", "care", "clinics", "departments", "directly", "early", "emergency", "following", "general", "hospital", "internal", "medicine", "model", "patients", "phase", "physicians", "practice", "practitioners", "programs", "providers"....
0.300
alternativeboardcapacityclinicalconditionsdefinitionsfollowinghealthcareindividualinformationlawlegalmarchnationalpatientprofessionalprovidersrequirementresearchreview
SHARED TOKENS (25): "alternative", "board", "capacity", "clinical", "conditions", "definitions", "following", "healthcare", "individual", "information", "law", "legal", "march", "national", "patient", "professional", "providers", "requirement", "research", "review"....
0.300
alternativebecomebetterbodycancerclinicaldiseaseestablishedhealthcarehistoryindustrymedicinemultipleoriginalpatientspointpracticeresearchriskstudies
SHARED TOKENS (25): "alternative", "become", "better", "body", "cancer", "clinical", "disease", "established", "healthcare", "history", "industry", "medicine", "multiple", "original", "patients", "point", "practice", "research", "risk", "studies"....
0.300
accessappointmentbecomecarecenterdepartmentdepartmentsemergencyfacilityhospitalhospitalsimportantinitialmedicinepatientpatientsrequirestaffingtreatment
SHARED TOKENS (19): "access", "appointment", "become", "care", "center", "department", "departments", "emergency", "facility", "hospital", "hospitals", "important", "initial", "medicine", "patient", "patients", "require", "staffing", "treatment".
0.300
actadoptioncareclinicaldepartmenteconomicimportantindividualinformationmanagementnationalneednetworkpdfpopulationrecordsrecoveryreportedtechnologytitle
SHARED TOKENS (20): "act", "adoption", "care", "clinical", "department", "economic", "important", "individual", "information", "management", "national", "need", "network", "pdf", "population", "records", "recovery", "reported", "technology", "title".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsidebodycarecellularclassifiedclinicaldistributiondrugfieldfunctionmainoriginpharmacypracticeresearchspecificallystudiessystemstherapeutic
SHARED TOKENS (19): "alongside", "body", "care", "cellular", "classified", "clinical", "distribution", "drug", "field", "function", "main", "origin", "pharmacy", "practice", "research", "specifically", "studies", "systems", "therapeutic".
0.300
associationbegincurrentdiagnosisfamilyfollowinghistoryhomeimportantindividualmillionpeoplephysicalproblemsprofessionalprogramsreportedriskstandardsupport
SHARED TOKENS (21): "association", "begin", "current", "diagnosis", "family", "following", "history", "home", "important", "individual", "million", "people", "physical", "problems", "professional", "programs", "reported", "risk", "standard", "support"....
0.300
alreadyanalysiscareclinicaldatadiagnosisdiseasedrughealthcaremonitoringpatientpatientspublicregulatoryrelatedsoftwarestudiessupportsystemstreatment
SHARED TOKENS (20): "already", "analysis", "care", "clinical", "data", "diagnosis", "disease", "drug", "healthcare", "monitoring", "patient", "patients", "public", "regulatory", "related", "software", "studies", "support", "systems", "treatment".
0.300
careclinicalclinicsdirectdiseasehealthcarehospitalsinsidepatientpatientspharmacyphysicianphysicianspracticepractitionersproviderwork
SHARED TOKENS (17): "care", "clinical", "clinics", "direct", "disease", "healthcare", "hospitals", "inside", "patient", "patients", "pharmacy", "physician", "physicians", "practice", "practitioners", "provider", "work".
0.300
accessadditionalagainstbloodbodycancerdeliverydiagnosisdiagnosticdirectimaginginternalmainmedicineproceduresreachrecoverysmalltherapeutictreatment
SHARED TOKENS (20): "access", "additional", "against", "blood", "body", "cancer", "delivery", "diagnosis", "diagnostic", "direct", "imaging", "internal", "main", "medicine", "procedures", "reach", "recovery", "small", "therapeutic", "treatment".
0.300
alreadybecomechangeconditionscurrentimagingimportantmajorphasephysicalproblemsrelatedresearchsystemstools
SHARED TOKENS (15): "already", "become", "change", "conditions", "current", "imaging", "important", "major", "phase", "physical", "problems", "related", "research", "systems", "tools".
0.300
actactivebettercarecenterscmscovereddepartmentdepartmentsdirectlyemergencyfederalgovernmenthospitalhospitalslaborlawlegalmedicaidmedicare
SHARED TOKENS (27): "act", "active", "better", "care", "centers", "cms", "covered", "department", "departments", "directly", "emergency", "federal", "government", "hospital", "hospitals", "labor", "law", "legal", "medicaid", "medicare"....
0.300
Cleanroom ↗ Q794827 EXACT TITLE
concentrationinsideresearchspacework
SHARED TOKENS (5): "concentration", "inside", "research", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.300
annualclinicclinicsdirectlyeducationexpansionfundinggovernmenthealthcarehistorymedicaidmillionorganizationpatientsperformingproviderreportedresearchsupporttechnology
SHARED TOKENS (20): "annual", "clinic", "clinics", "directly", "education", "expansion", "funding", "government", "healthcare", "history", "medicaid", "million", "organization", "patients", "performing", "provider", "reported", "research", "support", "technology".
0.300
actcarechangecoveredemployeesemployersfamilyfederalgovernshealthcareinformationinsurancelawmembersnationalpatientpatientsprovidersprovisionsrequire
SHARED TOKENS (23): "act", "care", "change", "covered", "employees", "employers", "family", "federal", "governs", "healthcare", "information", "insurance", "law", "members", "national", "patient", "patients", "providers", "provisions", "require"....
0.300
careclinicclinicaldiagnosticenvironmentequipmentfacilityhealthcarehomehospitalhospitalsnursingoperatingoutpatientpatientproceduressettingstaffsystem
SHARED TOKENS (19): "care", "clinic", "clinical", "diagnostic", "environment", "equipment", "facility", "healthcare", "home", "hospital", "hospitals", "nursing", "operating", "outpatient", "patient", "procedures", "setting", "staff", "system".
0.300
analysiscarecenterscollectionconsumerdataexpandedhealthcareindustryinstituteinsurancelistedmedicinenationalorganizationpatientpatientspolicyprivateprofessional
SHARED TOKENS (25): "analysis", "care", "centers", "collection", "consumer", "data", "expanded", "healthcare", "industry", "institute", "insurance", "listed", "medicine", "national", "organization", "patient", "patients", "policy", "private", "professional"....
0.300
Palliative care ↗ Q29483 KW CROSS HIGH
careclinicsdefinitionsearlyfieldhealthcarehomehospitalsimportantmainmodelneedsoccupationalorganizationoutpatientpatientpatientspeoplephysicalphysicians
SHARED TOKENS (25): "care", "clinics", "definitions", "early", "field", "healthcare", "home", "hospitals", "important", "main", "model", "needs", "occupational", "organization", "outpatient", "patient", "patients", "people", "physical", "physicians"....
0.300
accessannouncedassociationcapacitycentersdepartmentdiseasefebruaryfederalfoodgovernmentinformationinstitutemainmajornationaloccupationalorganizationprogramprograms
SHARED TOKENS (23): "access", "announced", "association", "capacity", "centers", "department", "disease", "february", "federal", "food", "government", "information", "institute", "main", "major", "national", "occupational", "organization", "program", "programs"....
0.300
boardclinicaldirecthealthcarehospitalinstitutemanagementnetworkoperatingpartnershipspatientsprofessionalresearchschoolsystem
SHARED TOKENS (15): "board", "clinical", "direct", "healthcare", "hospital", "institute", "management", "network", "operating", "partnerships", "patients", "professional", "research", "school", "system".
0.300
additionalcancercarechildrendiagnosiseducationgeneralmanagementmedicineoncologypatientspediatricpopulationstandardsupporttreatment
SHARED TOKENS (16): "additional", "cancer", "care", "children", "diagnosis", "education", "general", "management", "medicine", "oncology", "patients", "pediatric", "population", "standard", "support", "treatment".
0.300
againstbeyondbodycancercelldetectiondiagnosisearlyfamilyimagingmakesnationalpeopleprogramspublicresearchrisksystemtreatmenttype
SHARED TOKENS (21): "against", "beyond", "body", "cancer", "cell", "detection", "diagnosis", "early", "family", "imaging", "makes", "national", "people", "programs", "public", "research", "risk", "system", "treatment", "type"....
0.300
accessagenciesannualcapitalcovereddiseasedocumenteddrugeducationexpansionfieldfundinghistoricalindustrylargemajormarketpathologypatientsphysicians
SHARED TOKENS (28): "access", "agencies", "annual", "capital", "covered", "disease", "documented", "drug", "education", "expansion", "field", "funding", "historical", "industry", "large", "major", "market", "pathology", "patients", "physicians"....
0.300
accessalreadybecomebuiltcareclinicalcommunityconditionsdiseasedistributioneconomiceducationenvironmentfoodgovernmenthealthcareimportantmainorganizationpeople
SHARED TOKENS (28): "access", "already", "become", "built", "care", "clinical", "community", "conditions", "disease", "distribution", "economic", "education", "environment", "food", "government", "healthcare", "important", "main", "organization", "people"....
0.300
activealongsidebeyondbloodbodycancerdescribeddiagnosisdiseasedrugfamilyhistoryimagingmillionmonitoringneedproblemsrecognizedrisksites
SHARED TOKENS (24): "active", "alongside", "beyond", "blood", "body", "cancer", "described", "diagnosis", "disease", "drug", "family", "history", "imaging", "million", "monitoring", "need", "problems", "recognized", "risk", "sites"....
0.300
departmenteducationemployeeemployeesenforcementfederalfederallygovernmenthouseindependentinformationlegallocalmonitoringnationalprogramspublicrecognizedregionalresearch
SHARED TOKENS (23): "department", "education", "employee", "employees", "enforcement", "federal", "federally", "government", "house", "independent", "information", "legal", "local", "monitoring", "national", "programs", "public", "recognized", "regional", "research"....
0.300
actadditionalboardcentercenterschildrencmsdepartmenteducationfederalfollowingfundinggovernmenthospitalhospitalslicensuremedicaidmedicaremedicinephysician
SHARED TOKENS (26): "act", "additional", "board", "center", "centers", "children", "cms", "department", "education", "federal", "following", "funding", "government", "hospital", "hospitals", "licensure", "medicaid", "medicare", "medicine", "physician"....
0.300
adultboardcardiologycareclinicalclinicscollegeconditionsdepartmentsdiseaseemergencyequipmentfunctionhealthcarehomehospitalsmanagementmedicinenationaloutpatient
SHARED TOKENS (34): "adult", "board", "cardiology", "care", "clinical", "clinics", "college", "conditions", "departments", "disease", "emergency", "equipment", "function", "healthcare", "home", "hospitals", "management", "medicine", "national", "outpatient"....
0.300
agenciesalternativebettercarecentersconditionscosmeticcoversdrugfieldfoodhealthcarehomemajormedicinepeoplepracticeregionrelatedtreatment
SHARED TOKENS (20): "agencies", "alternative", "better", "care", "centers", "conditions", "cosmetic", "covers", "drug", "field", "food", "healthcare", "home", "major", "medicine", "people", "practice", "region", "related", "treatment".
0.300
activeagainstbecomeclinicaldrugexperiencefundinggrantsidentifyindustrylargemarketmedicinenationalneedoptimizationpeoplepracticeproductspublic
SHARED TOKENS (27): "active", "against", "become", "clinical", "drug", "experience", "funding", "grants", "identify", "industry", "large", "market", "medicine", "national", "need", "optimization", "people", "practice", "products", "public"....
0.300
accessactassociationbetterbusinesscarecoveredearlyeducationemployersestablishedexpansionfederalfundinggovernmentgrowinghealthcarehospitalinnovationinsurance
SHARED TOKENS (35): "access", "act", "association", "better", "business", "care", "covered", "early", "education", "employers", "established", "expansion", "federal", "funding", "government", "growing", "healthcare", "hospital", "innovation", "insurance"....
0.300
bettercancercareclinicalconditionsdiseasedistributiondrugearlyemployersinsurancemanagementmarketneednetworkpatientpatientspharmacyprovidersrelated
SHARED TOKENS (22): "better", "cancer", "care", "clinical", "conditions", "disease", "distribution", "drug", "early", "employers", "insurance", "management", "market", "need", "network", "patient", "patients", "pharmacy", "providers", "related"....
0.300
actadoptionbusinesscaredescribedeligibilityestablishedexpandedexpansionfamilyfederalfundinggovernmenthealthcareindependentinsurancemarchmedicaidmillionnational
SHARED TOKENS (31): "act", "adoption", "business", "care", "described", "eligibility", "established", "expanded", "expansion", "family", "federal", "funding", "government", "healthcare", "independent", "insurance", "march", "medicaid", "million", "national"....
0.300
cellfunctionoperatesstudysystems
SHARED TOKENS (5): "cell", "function", "operates", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.300
accessactadditionalannualcarecenterschildrencovereddepartmenteligibilityemergencyemployersexpandedexpansionfederalhealthcareindividualinsurancelawmedicaid
SHARED TOKENS (32): "access", "act", "additional", "annual", "care", "centers", "children", "covered", "department", "eligibility", "emergency", "employers", "expanded", "expansion", "federal", "healthcare", "individual", "insurance", "law", "medicaid"....
0.300
Childbirth ↗ Q34581 KW CROSS HIGH
becomebestdeliveryemergencyenvironmentfollowinghomehospitalsinternalmajormillionpracticeproblemsproceduresrecoveryregardlessriskspinalwomen
SHARED TOKENS (19): "become", "best", "delivery", "emergency", "environment", "following", "home", "hospitals", "internal", "major", "million", "practice", "problems", "procedures", "recovery", "regardless", "risk", "spinal", "women".
0.300
Alcoholism ↗ Q15326 KW CROSS HIGH
cancerclinicaldefinitionsdiagnosisdiagnosticdirectlyenvironmenthistoricalindividualinformationmillionorganizationpeoplephysicalproblemsrecordsrequirereviewriskseeking
SHARED TOKENS (26): "cancer", "clinical", "definitions", "diagnosis", "diagnostic", "directly", "environment", "historical", "individual", "information", "million", "organization", "people", "physical", "problems", "records", "require", "review", "risk", "seeking"....
0.300
administersagriculturecommunitiescurrentdepartmentdirectlyfebruaryfederalfoodgovernmentnationalneedsprogramprogramsresourcessafetyworks
SHARED TOKENS (17): "administers", "agriculture", "communities", "current", "department", "directly", "february", "federal", "food", "government", "national", "needs", "program", "programs", "resources", "safety", "works".
0.300
accessibleassociationcarechildrencollegedetectionearlyhomeimportantinformationmaintainpatientpediatricprogramrecognizedresourcesrisk
SHARED TOKENS (17): "accessible", "association", "care", "children", "college", "detection", "early", "home", "important", "information", "maintain", "patient", "pediatric", "program", "recognized", "resources", "risk".
0.300
Sepsis ↗ Q183134 KW CROSS HIGH
accessbloodbodycancercarechangechildrenconditionsdatadiagnosisdiseasefollowingfunctionimaginginitialmaintainmajormillionneedpeople
SHARED TOKENS (27): "access", "blood", "body", "cancer", "care", "change", "children", "conditions", "data", "diagnosis", "disease", "following", "function", "imaging", "initial", "maintain", "major", "million", "need", "people"....
0.300
carecentercentersclinicdedicateddeliverydepartmentemergencyexpandedfacilityfocusedhospitalmedicinenationalnetworkrequiretreatmenttype
SHARED TOKENS (18): "care", "center", "centers", "clinic", "dedicated", "delivery", "department", "emergency", "expanded", "facility", "focused", "hospital", "medicine", "national", "network", "require", "treatment", "type".
0.300
agentsanalysisbecomebuildingdetectiondiagnosismainmonitoringoriginalproceduresregionresearchsettingsmallspecificallystudy
SHARED TOKENS (16): "agents", "analysis", "become", "building", "detection", "diagnosis", "main", "monitoring", "original", "procedures", "region", "research", "setting", "small", "specifically", "study".
0.300
Pediatrics ↗ Q123028 KW CROSS HIGH
carecenterschildrenclinicscoversgeneralhospitalsinsurancemedicinepatientspediatricpeoplepracticeresearchresourceswork
SHARED TOKENS (16): "care", "centers", "children", "clinics", "covers", "general", "hospitals", "insurance", "medicine", "patients", "pediatric", "people", "practice", "research", "resources", "work".
0.300
activefacilityfamilyhospitalindividualoperatesoutpatientpatientsprogramprogrammingprogramsrequireresidentialscalesmallsupporttreatmentwork
SHARED TOKENS (18): "active", "facility", "family", "hospital", "individual", "operates", "outpatient", "patients", "program", "programming", "programs", "require", "residential", "scale", "small", "support", "treatment", "work".
0.300
MHealth ↗ Q17069079 KW CROSS HIGH
accessannualcapacitycareclinicalcollectioncommunitydatadeliverydirecteducationexpandedfieldhealthcareinformationmarketmedicinemonitoringpatientpatients
SHARED TOKENS (28): "access", "annual", "capacity", "care", "clinical", "collection", "community", "data", "delivery", "direct", "education", "expanded", "field", "healthcare", "information", "market", "medicine", "monitoring", "patient", "patients"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitaldescribedexpansionfindgeneralmanagementoperationalpartnershipspressprivateproductspublicventureworking
SHARED TOKENS (16): "active", "business", "capital", "described", "expansion", "find", "general", "management", "operational", "partnerships", "press", "private", "products", "public", "venture", "working".
0.300
Deductible ↗ Q132560103 KW CROSS HIGH
careconsumercoveredcoveringgeneralhomeinsurancelargemultipleplanpolicyprogramsproviderrequirementsignificant
SHARED TOKENS (15): "care", "consumer", "covered", "covering", "general", "home", "insurance", "large", "multiple", "plan", "policy", "programs", "provider", "requirement", "significant".
0.300
actbusinessconcentrationconsolidationcoveringdrugemployeeemployeesfederalgeneralgovernmenthealthcareinsideinsurancemanagementmarketmedicaremillionnetworkpeople
SHARED TOKENS (27): "act", "business", "concentration", "consolidation", "covering", "drug", "employee", "employees", "federal", "general", "government", "healthcare", "inside", "insurance", "management", "market", "medicare", "million", "network", "people"....
0.300
additionalalongsidealternativecampuscapitalcaredatadirecteconomichospitalmarketoperatingpatientperformingproceduresremoterequiresystemsystemstype
SHARED TOKENS (21): "additional", "alongside", "alternative", "campus", "capital", "care", "data", "direct", "economic", "hospital", "market", "operating", "patient", "performing", "procedures", "remote", "require", "system", "systems", "type"....
0.300
boardcarecommunitiesemergencygovernmenthealthcarehospitalsmanagementmedicinenationaloccupationalplanpolicypracticeprivateprofessionalpublicrecoveryrelatedspecialist
SHARED TOKENS (23): "board", "care", "communities", "emergency", "government", "healthcare", "hospitals", "management", "medicine", "national", "occupational", "plan", "policy", "practice", "private", "professional", "public", "recovery", "related", "specialist"....
0.300
analysisassociationcareclinicsconditionsdiagnosisemergencyhealthcarelistedoperatingphysicianplacespracticeprofessionalprogramsrecognizedtherapeutictreatmentwork
SHARED TOKENS (19): "analysis", "association", "care", "clinics", "conditions", "diagnosis", "emergency", "healthcare", "listed", "operating", "physician", "places", "practice", "professional", "programs", "recognized", "therapeutic", "treatment", "work".
0.300
Technology transfer ↗ KW CROSS HIGH
activityanalysiscapacityenvironmentfundinggovernmentimportantinnovationlicensingmarketorganizationprivateproductspublicrelatedresearchsolutionstechnology
SHARED TOKENS (18): "activity", "analysis", "capacity", "environment", "funding", "government", "important", "innovation", "licensing", "market", "organization", "private", "products", "public", "related", "research", "solutions", "technology".
0.300
backbetterdiagnosticdiseaseindividualmedicinemodelnationalpatientpatientspeopleproductsrelatedrisksystemstreatment
SHARED TOKENS (16): "back", "better", "diagnostic", "disease", "individual", "medicine", "model", "national", "patient", "patients", "people", "products", "related", "risk", "systems", "treatment".
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
associationbehaviorclinicalcommunityconditionsdiagnosisdiagnosticemploymenthistoricalhistoryindividualindustryinitialinstitutemedicinenationaloccupationalorganizationoutpatientphysical
SHARED TOKENS (27): "association", "behavior", "clinical", "community", "conditions", "diagnosis", "diagnostic", "employment", "historical", "history", "individual", "industry", "initial", "institute", "medicine", "national", "occupational", "organization", "outpatient", "physical"....
🫐 BERRY96 edges
0.280
additionalagenciesalongsidecaredepartmentsemergencyemployeeshospitalsphysicianpracticeprofessionalpublicrequirework
SHARED TOKENS (14): "additional", "agencies", "alongside", "care", "departments", "emergency", "employees", "hospitals", "physician", "practice", "professional", "public", "require", "work".
0.280
actfederallawrecovery
SHARED TOKENS (4): "act", "federal", "law", "recovery". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.280
Phlebotomy ↗ Q3595842 EXACT TITLE
adultbloodtherapeutictreatment
SHARED TOKENS (4): "adult", "blood", "therapeutic", "treatment". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.280
becomehiptherapiestreatment
SHARED TOKENS (4): "become", "hip", "therapies", "treatment". | EXACT TITLE in healthcare: "Joint replacement".
0.280
Hazardous waste ↗ EXACT TITLE
environmentlocalmillionnational
SHARED TOKENS (4): "environment", "local", "million", "national". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.280
becomeentirefieldfunction
SHARED TOKENS (4): "become", "entire", "field", "function". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.280
Pulmonology ↗ Q203337 KW CROSS HIGH
builtcardiologycareconditionsdepartmentsinternalmedicineneedpatientsrelatedspecialtiesstudysupportwork
SHARED TOKENS (14): "built", "cardiology", "care", "conditions", "departments", "internal", "medicine", "need", "patients", "related", "specialties", "study", "support", "work".
0.280
Nephrology ↗ Q177635 KW CROSS HIGH
additionaladultbecomeconditionsdiseasefunctioninternalmedicinepediatricphysicianspecificallystudiesstudytreatment
SHARED TOKENS (14): "additional", "adult", "become", "conditions", "disease", "function", "internal", "medicine", "pediatric", "physician", "specifically", "studies", "study", "treatment".
0.280
analysisphasesitessystem
SHARED TOKENS (4): "analysis", "phase", "sites", "system". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.280
adultcarecenterdemandfacilityfollowinggeneralhospitalmodelneedneedsreturnsettingtreatment
SHARED TOKENS (14): "adult", "care", "center", "demand", "facility", "following", "general", "hospital", "model", "need", "needs", "return", "setting", "treatment".
0.280
analysisbodyexperiencefieldfocusedfollowingframeworkhealthcaremedicineorganizationpatientpatientsresearchsafety
SHARED TOKENS (14): "analysis", "body", "experience", "field", "focused", "following", "framework", "healthcare", "medicine", "organization", "patient", "patients", "research", "safety".
0.280
carecentersdeliveryinformationmanagementprovidersrecordssafetysitessmallstudiessystemsystemstechnology
SHARED TOKENS (14): "care", "centers", "delivery", "information", "management", "providers", "records", "safety", "sites", "small", "studies", "system", "systems", "technology".
0.260
Cell culture ↗ Q189082 KW CROSS HIGH
bodycellconditionsenvironmenthistoricalneedoriginalpopulationpracticeregulatesrelatedrequiretype
SHARED TOKENS (13): "body", "cell", "conditions", "environment", "historical", "need", "original", "population", "practice", "regulates", "related", "require", "type".
0.260
actcarecovereddrugfederalgovernmenthospitalslawoutpatientpatientsprogrampublicresources
SHARED TOKENS (13): "act", "care", "covered", "drug", "federal", "government", "hospitals", "law", "outpatient", "patients", "program", "public", "resources".
0.260
centercentersdepartmentearlyfacilityhospitalhospitalsoutpatientpatientsphysicianrequiresafetystudies
SHARED TOKENS (13): "center", "centers", "department", "early", "facility", "hospital", "hospitals", "outpatient", "patients", "physician", "require", "safety", "studies".
0.260
productstimestools
SHARED TOKENS (3): "products", "times", "tools". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.260
annualcenterclinicalcompliancedrugfoodinformationlegalphaseproductsresearchstandardsstudies
SHARED TOKENS (13): "annual", "center", "clinical", "compliance", "drug", "food", "information", "legal", "phase", "products", "research", "standards", "studies".
0.260
alreadyfieldsystems
SHARED TOKENS (3): "already", "field", "systems". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.260
bloodcellclinicaldatadetectiondiagnosisfocusedfunctionlabphysicalpopulationpracticeresearch
SHARED TOKENS (13): "blood", "cell", "clinical", "data", "detection", "diagnosis", "focused", "function", "lab", "physical", "population", "practice", "research".
0.260
Boise River ↗ Q891080 EXACT TITLE
boiseidahowestern
SHARED TOKENS (3): "boise", "idaho", "western". | EXACT TITLE in biotech_life_sciences: "Boise River".
0.240
Caregiver ↗ Q553079 KW CROSS HIGH
carecentersfamilyhealthcarehomehospitalsnursingpeopleperformingproviderssupportworkers
SHARED TOKENS (12): "care", "centers", "family", "healthcare", "home", "hospitals", "nursing", "people", "performing", "providers", "support", "workers".
0.240
Neonatology ↗ Q898674 KW CROSS HIGH
careclinicalconditionsdeliverymedicinemonitoringneedresearchsupporttechnologytreatmentworking
SHARED TOKENS (12): "care", "clinical", "conditions", "delivery", "medicine", "monitoring", "need", "research", "support", "technology", "treatment", "working".
0.240
alternativecarecentershealthcaremedicaidmedicareorganizationpatientspractitionersprogramprovidertype
SHARED TOKENS (12): "alternative", "care", "centers", "healthcare", "medicaid", "medicare", "organization", "patients", "practitioners", "program", "provider", "type".
0.240
backbecomebloodcancercelldiagnosismedicinemultiplerecognizedsitesspecificallytreatment
SHARED TOKENS (12): "back", "become", "blood", "cancer", "cell", "diagnosis", "medicine", "multiple", "recognized", "sites", "specifically", "treatment".
0.240
bodyclinicaldiagnosisdiseasefunctionimaginginsidemajormedicineproceduresrecordstreatment
SHARED TOKENS (12): "body", "clinical", "diagnosis", "disease", "function", "imaging", "inside", "major", "medicine", "procedures", "records", "treatment".
0.240
agriculturefoodinformationmajormedicinepharmacyphysicalscalestandardstudiesstudytype
SHARED TOKENS (12): "agriculture", "food", "information", "major", "medicine", "pharmacy", "physical", "scale", "standard", "studies", "study", "type".
0.220
actagainstcarefederalgovernmentlawmedicaidmedicareorganizationpeopleprograms
SHARED TOKENS (11): "act", "against", "care", "federal", "government", "law", "medicaid", "medicare", "organization", "people", "programs".
0.220
bloodcancerdesignateddiseaseestablishedmillionmultipleproblemsriskstandardstype
SHARED TOKENS (11): "blood", "cancer", "designated", "disease", "established", "million", "multiple", "problems", "risk", "standards", "type".
0.220
accessactemergencyfacilityhospitalhospitalsmedicareprogramprogramssmalltype
SHARED TOKENS (11): "access", "act", "emergency", "facility", "hospital", "hospitals", "medicare", "program", "programs", "small", "type".
0.220
Forage ↗ Q13377214 EXACT TITLE
annualdirectly
SHARED TOKENS (2): "annual", "directly". | EXACT TITLE in biotech_life_sciences: "Forage".
0.220
hippatient
SHARED TOKENS (2): "hip", "patient". | EXACT TITLE in healthcare: "Hip replacement".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
familyimportant
SHARED TOKENS (2): "family", "important". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.220
additionaladoptioncoveredgovernmentgrowinghealthcareinsuranceplanrequirementtypeworkers
SHARED TOKENS (11): "additional", "adoption", "covered", "government", "growing", "healthcare", "insurance", "plan", "requirement", "type", "workers".
0.220
Home care ↗ Q1642542 KW CROSS HIGH
carecommunitygovernmenthomeindividuallocalmarketnationalpatientpeopleprofessional
SHARED TOKENS (11): "care", "community", "government", "home", "individual", "local", "market", "national", "patient", "people", "professional".
0.220
Biomarker ↗ EXACT TITLE
bloodtherapeutic
SHARED TOKENS (2): "blood", "therapeutic". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.220
bodyconditionscosmeticcoversestablishedfunctionmainphysicalrequirespecialtiestreatment
SHARED TOKENS (11): "body", "conditions", "cosmetic", "covers", "established", "function", "main", "physical", "require", "specialties", "treatment".
0.220
communityfederalhealthcarehospitalhospitalslegalneedneedsplanregulatorystudy
SHARED TOKENS (11): "community", "federal", "healthcare", "hospital", "hospitals", "legal", "need", "needs", "plan", "regulatory", "study".
0.220
careinsurance
SHARED TOKENS (2): "care", "insurance". | EXACT TITLE in healthcare: "Dental insurance".
0.220
beyondbusinessearlyfundinggrowinglargemodelprivatepublicsignificantstartup
SHARED TOKENS (11): "beyond", "business", "early", "funding", "growing", "large", "model", "private", "public", "significant", "startup".
0.220
Obstetrics ↗ Q5284418 EXACT TITLE
fieldstudy
SHARED TOKENS (2): "field", "study". | EXACT TITLE in healthcare: "Obstetrics".
0.220
researchstudy
SHARED TOKENS (2): "research", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.210
Biophysics ↗ Q7100 EXACT TITLE
study
SHARED TOKENS (1): "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.200
additionalcarehospitalmonitoringoriginphysicianphysicianspractitionersrequirespecialists
SHARED TOKENS (10): "additional", "care", "hospital", "monitoring", "origin", "physician", "physicians", "practitioners", "require", "specialists".
0.200
Medical error ↗ Q460433 KW CROSS HIGH
behaviorcarediagnosisdiseasehealthcareorganizationpatientpeoplesettingtreatment
SHARED TOKENS (10): "behavior", "care", "diagnosis", "disease", "healthcare", "organization", "patient", "people", "setting", "treatment".
0.200
Blood bank ↗ Q763244 KW CROSS HIGH
agenciesbloodcenterclinicalcollectiondepartmenthospitalhospitalspathologyrelated
SHARED TOKENS (10): "agencies", "blood", "center", "clinical", "collection", "department", "hospital", "hospitals", "pathology", "related".
0.200
Midwifery ↗ Q20862341 KW CROSS HIGH
caredirecteducationgeneralindependentlaborprofessionalreviewriskwomen
SHARED TOKENS (10): "care", "direct", "education", "general", "independent", "labor", "professional", "review", "risk", "women".
0.200
Dermatology ↗ Q171171 KW CROSS HIGH
beyondconditionscosmeticfieldmedicinephysicalpopulationrelatedschoolspecialist
SHARED TOKENS (10): "beyond", "conditions", "cosmetic", "field", "medicine", "physical", "population", "related", "school", "specialist".
0.200
blooddefinitionsfieldmaintainmedicinepracticerequirestemsupportsystem
SHARED TOKENS (10): "blood", "definitions", "field", "maintain", "medicine", "practice", "require", "stem", "support", "system".
0.200
carecommunitiescurrenteconomicfocusedhealthcareindustrypatientsproductssystem
SHARED TOKENS (10): "care", "communities", "current", "economic", "focused", "healthcare", "industry", "patients", "products", "system".
0.200
accessagentscentersdiseaseequipmentestablishedfacilitymultipleproceduressystems
SHARED TOKENS (10): "access", "agents", "centers", "disease", "equipment", "established", "facility", "multiple", "procedures", "systems".
0.200
Cold chain ↗ KW CROSS HIGH
chainsdistributeddistributionequipmentfoodmaintainmanagementproductssafetysupply
SHARED TOKENS (10): "chains", "distributed", "distribution", "equipment", "food", "maintain", "management", "products", "safety", "supply".
0.180
Medical test ↗ Q2671652 KW CROSS HIGH
analysiscellularclinicaldiagnosticdiseaseimagingphysicalsettingtreatment
SHARED TOKENS (9): "analysis", "cellular", "clinical", "diagnostic", "disease", "imaging", "physical", "setting", "treatment".
0.180
concentrationdominantdrugmainmodelplacesrelationshipsstudytools
SHARED TOKENS (9): "concentration", "dominant", "drug", "main", "model", "places", "relationships", "study", "tools".
0.180
bestdiagnosisdiseasedrugphysicianspracticeresearchspecialisttreatment
SHARED TOKENS (9): "best", "diagnosis", "disease", "drug", "physicians", "practice", "research", "specialist", "treatment".
0.180
conditionsdruggenerallegalpatientpeoplerecoverytherapiestreatment
SHARED TOKENS (9): "conditions", "drug", "general", "legal", "patient", "people", "recovery", "therapies", "treatment".
0.180
consumergeneralinformationmultipleneedsproductsproviderssitetype
SHARED TOKENS (9): "consumer", "general", "information", "multiple", "needs", "products", "providers", "site", "type".
0.180
Gynaecology ↗ Q1221899 KW CROSS HIGH
carecommunityconditionsfamilyfieldmedicinerequiresystemwomen
SHARED TOKENS (9): "care", "community", "conditions", "family", "field", "medicine", "require", "system", "women".
0.180
becomeboardfieldgeneralidentifymedicinephysicianspracticestudy
SHARED TOKENS (9): "become", "board", "field", "general", "identify", "medicine", "physicians", "practice", "study".
0.180
Rheumatology ↗ Q327657 KW CROSS HIGH
coverscurrentdiagnosisinternalmanagementmedicinesignificantstudiessystem
SHARED TOKENS (9): "covers", "current", "diagnosis", "internal", "management", "medicine", "significant", "studies", "system".
0.180
annualcapacityfacilityfoodidahoimportantlandmajorproducts
SHARED TOKENS (9): "annual", "capacity", "facility", "food", "idaho", "important", "land", "major", "products".
0.160
Radiography ↗ Q245341 KW CROSS HIGH
bodydiagnosticimaginginformationinternalpointtherapeutictimes
SHARED TOKENS (8): "body", "diagnostic", "imaging", "information", "internal", "point", "therapeutic", "times".
0.160
Orthodontics ↗ Q118301 KW CROSS HIGH
diagnosismainmanagementpatientsplanreportedrequiretreatment
SHARED TOKENS (8): "diagnosis", "main", "management", "patients", "plan", "reported", "require", "treatment".
0.160
carecoveringfieldimportantmanagementprogramssystemwomen
SHARED TOKENS (8): "care", "covering", "field", "important", "management", "programs", "system", "women".
0.160
Water quality ↗ Q625376 KW CROSS HIGH
againstcompliancephysicalsafetysignificantstandardssupplytreatment
SHARED TOKENS (8): "against", "compliance", "physical", "safety", "significant", "standards", "supply", "treatment".
0.160
Methadone ↗ Q179996 KW CROSS HIGH
functionmanagementmedicineorganizationpatientpeoplesoldtreatment
SHARED TOKENS (8): "function", "management", "medicine", "organization", "patient", "people", "sold", "treatment".
0.160
bodyconcentrationdedicateddrugfoodplacespointstudy
SHARED TOKENS (8): "body", "concentration", "dedicated", "drug", "food", "places", "point", "study".
0.160
annualcaredirectmedicinemembershippatientphysicianpractice
SHARED TOKENS (8): "annual", "care", "direct", "medicine", "membership", "patient", "physician", "practice".
0.160
alreadyclinicaldoctoralmedicinephysicianprofessionalresearchstandard
SHARED TOKENS (8): "already", "clinical", "doctoral", "medicine", "physician", "professional", "research", "standard".
0.160
blooddiagnosisgeneralmanagementnearphysiciansproceduressystem
SHARED TOKENS (8): "blood", "diagnosis", "general", "management", "near", "physicians", "procedures", "system".
0.140
alternativebodydrugmedicinepractitionersspecificallysupporting
SHARED TOKENS (7): "alternative", "body", "drug", "medicine", "practitioners", "specifically", "supporting".
0.140
fundinghospitalhospitalsorganizationpatientpublictype
SHARED TOKENS (7): "funding", "hospital", "hospitals", "organization", "patient", "public", "type".
0.140
clinicaldiagnosticfieldinnovationinternalprogramresearch
SHARED TOKENS (7): "clinical", "diagnostic", "field", "innovation", "internal", "program", "research".
0.140
codeexpandedfunctiongeneralmarketmedicineresearch
SHARED TOKENS (7): "code", "expanded", "function", "general", "market", "medicine", "research".
0.140
Periodontology ↗ Q938196 KW CROSS HIGH
conditionsdiagnosisdiseasefieldstudiessupportingtreatment
SHARED TOKENS (7): "conditions", "diagnosis", "disease", "field", "studies", "supporting", "treatment".
0.140
clinicalcouncildrugfoodproceduresprogramregulatory
SHARED TOKENS (7): "clinical", "council", "drug", "food", "procedures", "program", "regulatory".
0.140
Naturopathy ↗ Q213403 KW CROSS HIGH
accreditationalternativelegalmedicinepatientspracticepractitioners
SHARED TOKENS (7): "accreditation", "alternative", "legal", "medicine", "patients", "practice", "practitioners".
0.140
associationfieldhealthcarelicensingpathologyprofessionaltreatment
SHARED TOKENS (7): "association", "field", "healthcare", "licensing", "pathology", "professional", "treatment".
0.140
conditionsmanagementmedicinepatientsphysicianssystemtreatment
SHARED TOKENS (7): "conditions", "management", "medicine", "patients", "physicians", "system", "treatment".
0.120
experienceindividualpatientspeopleprogramstreatment
SHARED TOKENS (6): "experience", "individual", "patients", "people", "programs", "treatment".
0.120
Endocrinology ↗ Q162606 KW CROSS HIGH
bloodbodydirectlyfunctionmedicinesystem
SHARED TOKENS (6): "blood", "body", "directly", "function", "medicine", "system".
0.120
homemillionorganizationregionworkworkers
SHARED TOKENS (6): "home", "million", "organization", "region", "work", "workers".
0.120
generalhealthcarehospitalremotesmallspecifically
SHARED TOKENS (6): "general", "healthcare", "hospital", "remote", "small", "specifically".
0.120
estatemodelphysicianproviderrealregardless
SHARED TOKENS (6): "estate", "model", "physician", "provider", "real", "regardless".
0.120
Régence ↗ Q1362712 KW CROSS HIGH
councilgovernedgovernmenthistorylawsystem
SHARED TOKENS (6): "council", "governed", "government", "history", "law", "system".
0.120
Select agent ↗ KW CROSS HIGH
agentsagriculturedepartmentlawpublicsafety
SHARED TOKENS (6): "agents", "agriculture", "department", "law", "public", "safety".
0.120
actfieldmedicinephysiciansspecialistswork
SHARED TOKENS (6): "act", "field", "medicine", "physicians", "specialists", "work".
0.120
Prenatal care ↗ Q3308829 KW CROSS HIGH
carediagnosishealthcareproblemstypewomen
SHARED TOKENS (6): "care", "diagnosis", "healthcare", "problems", "type", "women".
0.100
Medical debt ↗ Q6806499 KW CROSS HIGH
carehealthcarepeopleplanrelated
SHARED TOKENS (5): "care", "healthcare", "people", "plan", "related".
0.100
associationcollegemembersmembershipprofessional
SHARED TOKENS (5): "association", "college", "members", "membership", "professional".
0.100
educationphaseprofessionalschoolstudents
SHARED TOKENS (5): "education", "phase", "professional", "school", "students".
0.100
childrendiagnosispediatricpopulationtreatment
SHARED TOKENS (5): "children", "diagnosis", "pediatric", "population", "treatment".
0.100
actfederalhospitalhospitalslaw
SHARED TOKENS (5): "act", "federal", "hospital", "hospitals", "law".
0.100
establishedhospitalhospitalsnetworksstudy
SHARED TOKENS (5): "established", "hospital", "hospitals", "networks", "study".
0.100
coversidaholandmajornorthwest
SHARED TOKENS (5): "covers", "idaho", "land", "major", "northwest".
0.100
Seed testing ↗ Q7445654 KW CROSS HIGH
analysisdedicatedresearchseedsold
SHARED TOKENS (5): "analysis", "dedicated", "research", "seed", "sold".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahonorthwestpopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population".
◈ Frequently Asked Questions
Biotech Life Sciences × Healthcare — Treasure Valley
HAIKU · HIGH GATE
How do vaccine research programs at Idaho State University and University of Idaho serve Treasure Valley healthcare providers?
Idaho State University and University of Idaho conduct vaccine development research that informs clinical practice for healthcare systems across Ada County, Idaho and Nampa, Idaho. These university programs generate immunology and pathology data that healthcare facilities use to improve preventive medicine protocols and coordinate with Centers for Medicare & Medicaid Services compliance standards.
What role do Boise-based medical device companies play in supporting Idaho Department of Health and Welfare initiatives?
Medical device manufacturers operating in Boise, Idaho develop diagnostic and therapeutic equipment that integrates with state health infrastructure managed by Idaho Department of Health and Welfare. These companies employ researchers trained at Boise State University and collaborate with regional healthcare networks to advance pharmacy and pathology services across the Treasure Valley.
How do immunology research programs in the Treasure Valley connect university study to clinical pharmacy practice?
Immunology research at Idaho State University and University of Idaho generates findings that pharmacy programs in Ada County implement through clinical applications in hospitals and clinics throughout Boise, Idaho and Nampa, Idaho. This research-to-practice pathway ensures that vaccine protocols, immunological testing, and pharmaceutical interventions align with current scientific evidence.
Why do Treasure Valley healthcare organizations recruit biotech researchers from Boise State University and Idaho State University?
Healthcare organizations across Ada County, Idaho seek biotech researchers trained in pathology, immunology, and medical device innovation to strengthen clinical research and diagnostic capabilities. University of Idaho and Boise State University graduates bring expertise directly applicable to Centers for Medicare & Medicaid Services quality measures and Idaho Department of Health and Welfare regulatory standards.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Biotech Life Sciences × Healthcare 18 QID bridges 347 edges 9,947 ext links 2026-07-17 19:45:05 UTC 67f8c3e55f557412
Biotech Life Sciences corridor ↗ Healthcare corridor ↗ Healthcare × Biotech Life Sciences ↗ boisestandard.org/standard ↗
Parent Corridors
Biotech Life Sciences × All Other Verticals