—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Biotech Life Sciences ↔ relates to ↔ Police Law Enforcement

13 Wikipedia bridge articles confirmed in both vertical ledgers. 259 deterministic cross-vertical edges. 6,924 external source links harvested. Every edge provenance-stamped. Every claim auditable.

13 QID Bridge Articles
259 Cross Edges
6,924 External Sources
281 Wikipedia Articles
16 🌲 Evergreen
192 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Biotech Life Sciences
× Police Law Enforcement
QID Bridge Articles
13
confirmed Wikipedia overlap
Total Cross Edges
259
External Sources Harvested
6,924
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  32 shared tokens
QID Bridge Titles (13)
IdahoTreasure ValleyDrug Enforcement AdministrationBoise State UniversityCollege of Western IdahoBoise metropolitan areaBoise RiverNampa, IdahoBoise, IdahoCaldwell, IdahoAda County, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanmileswesternadacanyoncapitalrivertreasurevalleycollegenampaagriculturalapproximatelyeasternpacificmeridianland
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:46:54 UTC
Content Hash
5c4a60ff572fe6f5
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
13 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (32): "agricultural", "approximately", "associated", "boise", "capital", "contains", "distinct", "eastern", "economy", "idaho", "isolated", "laboratory", "land", "miles", "million", "national", "official", "organized", "pacific", "people".... | EXACT TITLE in biotech_life_sciences: "Idaho". | EXACT TITLE in police_law_enforcement: "Idaho".
agriculturalapproximatelyassociatedboisecapitalcontainsdistincteasterneconomyidahoisolatedlaboratorylandmilesmillionnationalofficialorganizedpacificpeoplepopulationproductsriverscienceseparatesignificantsmallsquaresuppliestechnology+2
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (17): "agricultural", "association", "boise", "commerce", "eastern", "historically", "idaho", "land", "local", "metropolitan", "opportunities", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in biotech_life_sciences: "Treasure Valley". | EXACT TITLE in police_law_enforcement: "Treasure Valley".
agriculturalassociationboisecommerceeasternhistoricallyidaholandlocalmetropolitanopportunitiesregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Drug Enforcement Administration
Q622899 EXACT TITLE 1.000
QID OVERLAP: Q622899 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (27): "act", "administration", "agency", "bureau", "community", "controlled", "dea", "department", "drug", "drugs", "enforcement", "established", "federal", "government", "intelligence", "investigation", "involving", "jurisdiction", "law", "national".... | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration". | EXACT TITLE in police_law_enforcement: "Drug Enforcement Administration".
actadministrationagencybureaucommunitycontrolleddeadepartmentdrugdrugsenforcementestablishedfederalgovernmentintelligenceinvestigationinvolvingjurisdictionlawnationaloperationsprotectionratherreportsresponsiblesubstancesuses
agency under the U.S. Department of Justice tasked with combating illicit drug trafficking and distribution within the U.S. It is the lead agency for domestic enforcement of the Controlled Substances Act, sharing concurrent jurisdiction with the Federal Bureau of Investigation and U.S. Customs and Border Protection. The DEA is responsible for coordinating and pursuing U.S. drug investigations both domestically and internationally. The DEA has an intelligence unit that is also a member of the U.S. Intelligence Community. While the unit is part of the DEA chain-of-command, it also reports to the director of national intelligence. The administration has been criticized for scheduling drugs that have medicinal uses, and for focusing on operations that allow it to seize money rather than those involving drugs that cause more harm. The DEA was established in 1973 as part of the U.S.
History and mandate The Drug Enforcement Administration was established on July 1, 1973, by Reorganization Plan No. 2 of 1973, signed by President Richard Nixon on July 28. It proposed the creation of a single federal agency to enforce the federal drug laws as well as consolidate and coordinate the government's drug control activities. Congress accepted the proposal, as they were concerned with the growing availability of drugs. As a result, the Bureau of Narcotics and Dangerous Drugs (BNDD), the Office of Drug Abuse Law Enforcement (ODALE); approximately 600 Special Agents of the Bureau of Customs, Customs Agency Service, and other federal offices merged to create the DEA. The DEA is the primary federal agency charged with implementing and enforcing the Controlled Substances Act (CSA), which is Title II of a larger Federal Act called the Comprehensive Drug Abuse Prevention and Control Act of 1970. The DEA is responsible for drugs listed in the CSA's five drug Schedules, categories that rank drugs by their potential for harm, and whether they have a medical use. The CSA seeks to ensure legitimate access to controlled pharmaceuticals, while preventing illicit use of controlled drugs.
On April 19, 1995, Timothy McVeigh carried out a terrorist attack on the Alfred P. Murrah Federal Building in Oklahoma City. He was targeting regional offices for the Federal Bureau of Investigation (FBI), Bureau of Alcohol, Tobacco, Firearms and Explosives (ATF) and DEA, all of which had carried out raids that he viewed as unjustified intrusions on the rights of the people. This attack caused the deaths of two DEA employees, one task force member and two contractors in the Oklahoma City bombing. Subsequently, the DEA headquarters complex was classified as a Level IV installation under United States federal building security standards, meaning it was to be considered a high-risk law enforcement target for terrorists.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "boise", "business", "college", "colleges", "division", "education", "exceeding", "graduate", "health", "idaho", "independent", "institution", "master", "million", "program", "programs", "public", "reported".... | EXACT TITLE in biotech_life_sciences: "Boise State University". | EXACT TITLE in police_law_enforcement: "Boise State University".
activityamongboisebusinesscollegecollegesdivisioneducationexceedinggraduatehealthidahoindependentinstitutionmastermillionprogramprogramspublicreportedresearchschoolteamsuniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (27): "ada", "board", "boise", "campus", "canyon", "college", "colleges", "community", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents".... | EXACT TITLE in biotech_life_sciences: "College of Western Idaho". | EXACT TITLE in police_law_enforcement: "College of Western Idaho".
adaboardboisecampuscanyoncollegecollegescommunitydevelopmenteasterneducationgovernedidaholargenampapopulationprogramspublicreportedresidentssouthweststudentstudentstreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Boise metropolitan area
Q4938481 EXACT TITLE 0.980
QID OVERLAP: Q4938481 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (14): "ada", "boise", "canyon", "component", "designated", "idaho", "meridian", "metro", "metropolitan", "nampa", "pacific", "population", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area". | EXACT TITLE in police_law_enforcement: "Boise metropolitan area".
adaboisecanyoncomponentdesignatedidahomeridianmetrometropolitannampapacificpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Boise River
Q891080 EXACT TITLE 0.860
QID OVERLAP: Q891080 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (8): "agricultural", "approximately", "boise", "idaho", "miles", "river", "square", "western". | EXACT TITLE in biotech_life_sciences: "Boise River". | EXACT TITLE in police_law_enforcement: "Boise River".
agriculturalapproximatelyboiseidahomilesriversquarewestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in biotech_life_sciences (tier:branch) and police_law_enforcement (tier:branch). | SHARED TOKENS (15): "according", "boise", "canyon", "college", "idaho", "interstate", "meridian", "metropolitan", "miles", "nampa", "population", "principal", "student", "university", "western".
accordingboisecanyoncollegeidahointerstatemeridianmetropolitanmilesnampapopulationprincipalstudentuniversitywestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in biotech_life_sciences (tier:branch) and police_law_enforcement (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "idaho", "locally", "major", "metropolitan", "miles", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalidaholocallymajormetropolitanmilespopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in biotech_life_sciences (tier:branch) and police_law_enforcement (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in biotech_life_sciences (tier:evergreen) and police_law_enforcement (tier:branch). | SHARED TOKENS (10): "ada", "boise", "capital", "idaho", "jurisdiction", "local", "metropolitan", "pacific", "population", "private".
adaboisecapitalidahojurisdictionlocalmetropolitanpacificpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in biotech_life_sciences (tier:branch) and police_law_enforcement (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in biotech_life_sciences (tier:branch) and police_law_enforcement (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
246 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP246 edges
🌲 EVERGREEN3 edges
0.650
agencyboisecenterscommunitydepartmentdistrictsenforcementidaholawleadershipmeridianoperatespeoplestandardsthemtraining
SHARED TOKENS (16): "agency", "boise", "centers", "community", "department", "districts", "enforcement", "idaho", "law", "leadership", "meridian", "operates", "people", "standards", "them", "training". | URL->B (1): https://www.idoc.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho Department of Correction".
0.650
adaboisecentercommercialdepartmentfacilityfieldfirefunctionsgeneralidahoincreasemilesmillionnationaloperatesprotectionreceiverightssupport
SHARED TOKENS (23): "ada", "boise", "center", "commercial", "department", "facility", "field", "fire", "functions", "general", "idaho", "increase", "miles", "million", "national", "operates", "protection", "receive", "rights", "support".... | URL->B (1): http://www.iflyboise.com/. | EXACT TITLE in police_law_enforcement: "Boise Airport".
0.630
agencyanimalsbureauchildrendepartmentenforcementidaholawmunicipalorderordersorganizationpublicstatewide
SHARED TOKENS (14): "agency", "animals", "bureau", "children", "department", "enforcement", "idaho", "law", "municipal", "order", "orders", "organization", "public", "statewide". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho State Police".
🌿 BRANCH192 edges
0.500
Antibody ↗ Q79460 EXACT TITLE
animalbecomecapacityclassificationcompositioncontainsdemonstratedescribesdescribingdifferentdirectlydistinctformfunctionfunctionsgeneralhumanidentifyindependentlyindividual
SHARED TOKENS (33): "animal", "become", "capacity", "classification", "composition", "contains", "demonstrate", "describes", "describing", "different", "directly", "distinct", "form", "function", "functions", "general", "human", "identify", "independently", "individual".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
addressanimalanimalsanotherappliesapprovalbasicbenefitsbiologycoredevelopeddevelopingdevelopmentdirectlydrugsfieldfieldsfunctionshigherhuman
SHARED TOKENS (61): "address", "animal", "animals", "another", "applies", "approval", "basic", "benefits", "biology", "core", "developed", "developing", "development", "directly", "drugs", "field", "fields", "functions", "higher", "human".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
amongapproximatelyboisecampusdivisionestablishedgraduateidaholateroperatesproductionprofessionalpublicrepresentedresearchstatewidestudentsundergraduateuniversity
SHARED TOKENS (19): "among", "approximately", "boise", "campus", "division", "established", "graduate", "idaho", "later", "operates", "production", "professional", "public", "represented", "research", "statewide", "students", "undergraduate", "university". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
0.500
appearscentercostscoverseconomyinformationinvolvingmakesonlinepreventionpropertyreportsafetysinglestudiesstudytype
SHARED TOKENS (17): "appears", "center", "costs", "covers", "economy", "information", "involving", "makes", "online", "prevention", "property", "report", "safety", "single", "studies", "study", "type". | EXACT TITLE in police_law_enforcement: "Internet fraud".
0.500
activityconditionsdependsdevelopingdirectlyfoodformhealthmaintainmajorpeoplephysicalrequiredsafewaterwork
SHARED TOKENS (16): "activity", "conditions", "depends", "developing", "directly", "food", "form", "health", "maintain", "major", "people", "physical", "required", "safe", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
accordinganalyticalappliedbecomecomplexdifferentfieldfieldsfunctionidentifiedidentitypatternpresentedprocedurestructurethem
SHARED TOKENS (16): "according", "analytical", "applied", "become", "complex", "different", "field", "fields", "function", "identified", "identity", "pattern", "presented", "procedure", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
anotherbiologycollectioncreatedevelopmentfieldhigherinsideinteractionlifeorderphysicalprocessremainssmallstudiessubjectstechniquesusesview
SHARED TOKENS (20): "another", "biology", "collection", "create", "development", "field", "higher", "inside", "interaction", "life", "order", "physical", "process", "remains", "small", "studies", "subjects", "techniques", "uses", "view". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
SWAT ↗ Q324563 EXACT TITLE
amongannualcontroldevicesdrugsenforcementequipmentincreasedinterestslawnegotiationresearchschoolsearchsignificantspecializedstudyteamstimestrained
SHARED TOKENS (20): "among", "annual", "control", "devices", "drugs", "enforcement", "equipment", "increased", "interests", "law", "negotiation", "research", "school", "search", "significant", "specialized", "study", "teams", "times", "trained". | EXACT TITLE in police_law_enforcement: "SWAT".
0.500
Police ↗ Q35535 EXACT TITLE
activitiesactivityagainstagencyassociatedauthorizedbecomecomplexdepartmentdevelopeddifferentdiffersenforcementhealthlawlegalmembersmodernnationalorder
SHARED TOKENS (33): "activities", "activity", "against", "agency", "associated", "authorized", "become", "complex", "department", "developed", "different", "differs", "enforcement", "health", "law", "legal", "members", "modern", "national", "order".... | EXACT TITLE in police_law_enforcement: "Police".
0.500
againstconductdescribingevidenceformalinformationknowledgelawlegalobtainpeopleperformprocedurespropertyrequiredrequirementsearchsearchestextuses
SHARED TOKENS (20): "against", "conduct", "describing", "evidence", "formal", "information", "knowledge", "law", "legal", "obtain", "people", "perform", "procedures", "property", "required", "requirement", "search", "searches", "text", "uses". | EXACT TITLE in police_law_enforcement: "Probable cause".
0.500
Vaccine ↗ Q134808 EXACT TITLE
activeadministrationagainstassociatedcontainsdescribeddevelopeddevelopmentdifferenthealthorganizationpracticeproductionreportsresponsiblesafetysciencesystemtitle
SHARED TOKENS (19): "active", "administration", "against", "associated", "contains", "described", "developed", "development", "different", "health", "organization", "practice", "production", "reports", "responsible", "safety", "science", "system", "title". | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
accordingagainstcontrolleddesignateddrugdrugsevengovernmentincorporatedlawnationalproductionprovideregulatedsinglesubstanceswhose
SHARED TOKENS (17): "according", "against", "controlled", "designated", "drug", "drugs", "even", "government", "incorporated", "law", "national", "production", "provide", "regulated", "single", "substances", "whose". | EXACT TITLE in biotech_life_sciences: "Controlled substance". | EXACT TITLE in police_law_enforcement: "Controlled substance".
0.500
actadministrationauthoritycontroldevicesdrugdrugsfederalfoodforminvestigationlawmedicalmembersnationalprincipalprovisionsrequirementssafetystudy
SHARED TOKENS (21): "act", "administration", "authority", "control", "devices", "drug", "drugs", "federal", "food", "form", "investigation", "law", "medical", "members", "national", "principal", "provisions", "requirements", "safety", "study".... | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
activitiesagencyannualbureaucommercedepartmentemployeesenforcementfederalfirehandlinginterstateinvestigationinvolvinglaboratorylawlicensinglocaloperatesoperation
SHARED TOKENS (26): "activities", "agency", "annual", "bureau", "commerce", "department", "employees", "enforcement", "federal", "fire", "handling", "interstate", "investigation", "involving", "laboratory", "law", "licensing", "local", "operates", "operation".... | EXACT TITLE in police_law_enforcement: "Bureau of Alcohol, Tobacco, Firearms and Explosives".
0.500
approvalcannotcontractcostsdevelopingdevelopmentdevicesdrugdrugsentryevidenceexperienceformhouseinstitutionslargelifemaintainmanagementmedical
SHARED TOKENS (34): "approval", "cannot", "contract", "costs", "developing", "development", "devices", "drug", "drugs", "entry", "evidence", "experience", "form", "house", "institutions", "large", "life", "maintain", "management", "medical".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
agenciesagencyanimalapprovalsbloodbuildingclassificationcomplexconditionsdevicesdifferentdirectlydnadrugdrugsgeneralhumanisolatedmarketmedical
SHARED TOKENS (39): "agencies", "agency", "animal", "approvals", "blood", "building", "classification", "complex", "conditions", "devices", "different", "directly", "dna", "drug", "drugs", "general", "human", "isolated", "market", "medical".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
amonganalysisappearsappliedassessmentbasicbiologybloodchangecollectionconditionsdatadecisionsdescriptiondesigndisciplinesfunctiongeneralhealthhealthcare
SHARED TOKENS (47): "among", "analysis", "appears", "applied", "assessment", "basic", "biology", "blood", "change", "collection", "conditions", "data", "decisions", "description", "design", "disciplines", "function", "general", "health", "healthcare".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
actadministrationagencyappliesapplydrugfederalfoodintendedlawprivateprotectionpublicregulatedrequiredsafestandardssystemsystemswater
SHARED TOKENS (20): "act", "administration", "agency", "applies", "apply", "drug", "federal", "food", "intended", "law", "private", "protection", "public", "regulated", "required", "safe", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeagainstassociatedbecomebiologycharacteristicscoversdisciplinesfieldshealthinterpretedlatermaintainmedicinenodesphysicalratherresponsesmallstudies
SHARED TOKENS (25): "active", "against", "associated", "become", "biology", "characteristics", "covers", "disciplines", "fields", "health", "interpreted", "later", "maintain", "medicine", "nodes", "physical", "rather", "response", "small", "studies".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityanimalsbehaviorbiologychemistrycomplexcomputercouncildescribeddnadrugsfieldfunctiongoverninghigherlaboratorymedicalmedicinemodelmolecular
SHARED TOKENS (33): "activity", "animals", "behavior", "biology", "chemistry", "complex", "computer", "council", "described", "dna", "drugs", "field", "function", "governing", "higher", "laboratory", "medical", "medicine", "model", "molecular".... | EXACT TITLE in biotech_life_sciences: "Molecular biology". | EXACT TITLE in police_law_enforcement: "Molecular biology".
0.500
behaviorbiologychemistrycombinescomputerdescribeddifferentexpandedfunctionsindividualmedicinemolecularsciencescopestatisticsstudiesstudysystemtechniques
SHARED TOKENS (19): "behavior", "biology", "chemistry", "combines", "computer", "described", "different", "expanded", "functions", "individual", "medicine", "molecular", "science", "scope", "statistics", "studies", "study", "system", "techniques". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.500
Cell biology ↗ Q7141 EXACT TITLE
basicbehaviorbiologycompositionfieldsfunctionlifemedicalmolecularresearchresponsiblestructurestudiesstudytechniqueswork
SHARED TOKENS (16): "basic", "behavior", "biology", "composition", "fields", "function", "life", "medical", "molecular", "research", "responsible", "structure", "studies", "study", "techniques", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.500
Virology ↗ Q7215 EXACT TITLE
animalanimalsappliedbiologyclassificationcomponentcoveringdetectiondifferentdistinctdnafieldfunctionshealthidentificationinteractionlaboratorymedicalmedicineofficial
SHARED TOKENS (31): "animal", "animals", "applied", "biology", "classification", "component", "covering", "detection", "different", "distinct", "dna", "field", "functions", "health", "identification", "interaction", "laboratory", "medical", "medicine", "official".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
Clery Act ↗ Q5131951 EXACT TITLE
actagainstcampuscodecollegescompliancedepartmenteducationfederalinformationinstitutionslawparticipatepolicyprogramsrequiressafetystatisticsstudentuniversities
SHARED TOKENS (21): "act", "against", "campus", "code", "colleges", "compliance", "department", "education", "federal", "information", "institutions", "law", "participate", "policy", "programs", "requires", "safety", "statistics", "student", "universities".... | EXACT TITLE in police_law_enforcement: "Clery Act".
0.500
annualanotherbecomebusinesscapitalconductcontroldecisionsdevelopmentdisposalemployeesentityfinancefirmsformfundinggrowthhistoryinformationinitial
SHARED TOKENS (41): "annual", "another", "become", "business", "capital", "conduct", "control", "decisions", "development", "disposal", "employees", "entity", "finance", "firms", "form", "funding", "growth", "history", "information", "initial".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
centercenterscentralcomputercontroldataemergencyequipmentfieldfunctionsinformationmaintainmaintenanceoperatorspersonnelprovidepublicresourcessafetystatus
SHARED TOKENS (25): "center", "centers", "central", "computer", "control", "data", "emergency", "equipment", "field", "functions", "information", "maintain", "maintenance", "operators", "personnel", "provide", "public", "resources", "safety", "status".... | EXACT TITLE in police_law_enforcement: "Computer-aided dispatch".
0.500
againstagenciesassetbasicbehaviorconductcontroldepartmentsemploymentenforcementindependentindividualinternallaworderoversightproceduresprocesspublicrather
SHARED TOKENS (27): "against", "agencies", "asset", "basic", "behavior", "conduct", "control", "departments", "employment", "enforcement", "independent", "individual", "internal", "law", "order", "oversight", "procedures", "process", "public", "rather".... | EXACT TITLE in police_law_enforcement: "Police accountability".
0.500
Cybercrime ↗ Q29137 EXACT TITLE
accessactivitiesagainstcomputerdatadetectiondeviceseconomyequipmentgovernmentsinformationinvolvingmajornetworknetworksonlineorganizationsorganizedotherwiseposition
SHARED TOKENS (32): "access", "activities", "against", "computer", "data", "detection", "devices", "economy", "equipment", "governments", "information", "involving", "major", "network", "networks", "online", "organizations", "organized", "otherwise", "position".... | EXACT TITLE in police_law_enforcement: "Cybercrime".
0.500
analysisappliesapprovalbehaviorbenefitsboardcareconductconducteddesignateddevicesdrugsfieldsformhealthhumanindependentinstitutioninstitutionalinvolving
SHARED TOKENS (39): "analysis", "applies", "approval", "behavior", "benefits", "board", "care", "conduct", "conducted", "designated", "devices", "drugs", "fields", "form", "health", "human", "independent", "institution", "institutional", "involving".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
agriculturalanotherdisposalenvironmentfacilityindustrialmunicipalperformsprocessprocessesresultingtreatmenttypeuseswater
SHARED TOKENS (15): "agricultural", "another", "disposal", "environment", "facility", "industrial", "municipal", "performs", "process", "processes", "resulting", "treatment", "type", "uses", "water". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
approximatelychangesconducteddiffersemergencyexperiencefamilyformgovernmenthousehumanidentifyinglegalmillionpeopleprivatepublicsafestandardizedstatus
SHARED TOKENS (22): "approximately", "changes", "conducted", "differs", "emergency", "experience", "family", "form", "government", "house", "human", "identifying", "legal", "million", "people", "private", "public", "safe", "standardized", "status".... | EXACT TITLE in police_law_enforcement: "Homelessness".
0.500
approximatelybehaviorbuiltcomplexcurrentdepartmenteasternfacilitiesfacilityhistoricallyhistoryidahoknowledgelaboratorieslaboratorynationalorganizationspeopleresearchwestern
SHARED TOKENS (20): "approximately", "behavior", "built", "complex", "current", "department", "eastern", "facilities", "facility", "historically", "history", "idaho", "knowledge", "laboratories", "laboratory", "national", "organizations", "people", "research", "western". | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
businessescreatecreationdevelopedhumanindividualinformationlandlawlegalmodernownershippeopleprocessespropertyrightssystemsthemtheorytrade
SHARED TOKENS (20): "businesses", "create", "creation", "developed", "human", "individual", "information", "land", "law", "legal", "modern", "ownership", "people", "processes", "property", "rights", "systems", "them", "theory", "trade". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
Toxicology ↗ Q7218 EXACT TITLE
biologychemistrydrugsenvironmentfieldinfluencemedicinepracticepracticesrelationshipresearchstudysubjectsubstancestoxicologytreatingtreatment
SHARED TOKENS (17): "biology", "chemistry", "drugs", "environment", "field", "influence", "medicine", "practice", "practices", "relationship", "research", "study", "subject", "substances", "toxicology", "treating", "treatment". | EXACT TITLE in biotech_life_sciences: "Toxicology". | EXACT TITLE in police_law_enforcement: "Toxicology".
0.500
activitiesapprovalbenefitscentraldutieseducationentitygovernmenthealthcareindividualinfrastructureinstitutionslawpolicypresentedprogramprogramsrequiressystems
SHARED TOKENS (19): "activities", "approval", "benefits", "central", "duties", "education", "entity", "government", "healthcare", "individual", "infrastructure", "institutions", "law", "policy", "presented", "program", "programs", "requires", "systems". | EXACT TITLE in biotech_life_sciences: "Government budget".
0.500
Microbiology ↗ Q7193 EXACT TITLE
biologycomplexcurrentdesigndevelopeddnaenvironmentsidentificationlifemeansmedicalmolecularpossesssearchsmallstudythemwork
SHARED TOKENS (18): "biology", "complex", "current", "design", "developed", "dna", "environments", "identification", "life", "means", "medical", "molecular", "possess", "search", "small", "study", "them", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecarechemistrycommunitydirectdrugdrugshealthinformationinstitutionalinvestigationlinksmodernofficepharmaciespracticeproductsprofessionalrelatedroles
SHARED TOKENS (27): "become", "care", "chemistry", "community", "direct", "drug", "drugs", "health", "information", "institutional", "investigation", "links", "modern", "office", "pharmacies", "practice", "products", "professional", "related", "roles".... | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
actagainstagreementsbecomechildrencommercialdistinctenforcementformhumanindividuallaborlegalmodernnationaloccurorganizationspeoplepoliciesrights
SHARED TOKENS (24): "act", "against", "agreements", "become", "children", "commercial", "distinct", "enforcement", "form", "human", "individual", "labor", "legal", "modern", "national", "occur", "organizations", "people", "policies", "rights".... | EXACT TITLE in police_law_enforcement: "Human trafficking".
0.500
actadministrationagenciesclassificationclassificationscontrolcontrolleddeadecisionsdrugdrugsenforcementestablishingfederalfoodinitialisolatedlawmedicalnational
SHARED TOKENS (29): "act", "administration", "agencies", "classification", "classifications", "control", "controlled", "dea", "decisions", "drug", "drugs", "enforcement", "establishing", "federal", "food", "initial", "isolated", "law", "medical", "national".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
activeanalysisbiologychannelscontroldesigndevelopmentdnaexternalfieldformmeansmediamolecularotherwisepracticalprocessprocessesscienceseparate
SHARED TOKENS (26): "active", "analysis", "biology", "channels", "control", "design", "development", "dna", "external", "field", "form", "means", "media", "molecular", "otherwise", "practical", "process", "processes", "science", "separate".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
addressagriculturalappliedbiologycontrolcreatedesigndevicesequipmentknowledgematerialsmedicalprocessprocessesproductsrapidresearchresearcherssciencestandards
SHARED TOKENS (23): "address", "agricultural", "applied", "biology", "control", "create", "design", "devices", "equipment", "knowledge", "materials", "medical", "process", "processes", "products", "rapid", "research", "researchers", "science", "standards".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
actagainstamongbroaderchildrenconflictscontrolcreatediffersdirectdocumentationestablishedestimatesexperiencefamilyhealthhigherlifemembersoffice
SHARED TOKENS (32): "act", "against", "among", "broader", "children", "conflicts", "control", "create", "differs", "direct", "documentation", "established", "estimates", "experience", "family", "health", "higher", "life", "members", "office".... | EXACT TITLE in police_law_enforcement: "Domestic violence".
0.500
Patent ↗ Q253623 EXACT TITLE
accordingagreementsamongfieldsindustriallawlegalmakingnationalorderorganizationprivateprocedurepropertyprotectionpublicratherrequirementsrightsscope
SHARED TOKENS (24): "according", "agreements", "among", "fields", "industrial", "law", "legal", "making", "national", "order", "organization", "private", "procedure", "property", "protection", "public", "rather", "requirements", "rights", "scope".... | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
agriculturalanalysisbiologybuildingchemistrycomplexcomputerdatadevelopmentdnafieldidentificationinformationlargemolecularnetworkspathwaysprocessprocessingprogramming
SHARED TOKENS (28): "agricultural", "analysis", "biology", "building", "chemistry", "complex", "computer", "data", "development", "dna", "field", "identification", "information", "large", "molecular", "networks", "pathways", "process", "processing", "programming".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anotherbiologycarechemistrydevelopmentdifferentexperiencedfieldfunctiongrowthhistorylargematerialsmedicalmedicineproductssciencestudysystemsystems
SHARED TOKENS (20): "another", "biology", "care", "chemistry", "development", "different", "experienced", "field", "function", "growth", "history", "large", "materials", "medical", "medicine", "products", "science", "study", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
accordingappliesapplybiologycomputercontroldesigndevicesdisciplinesfieldmolecularorderpurposessciencesystemsthem
SHARED TOKENS (16): "according", "applies", "apply", "biology", "computer", "control", "design", "devices", "disciplines", "field", "molecular", "order", "purposes", "science", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.500
administrationagencyapproximatelyauthorityconnectingdatadepartmentdetectionenforcementfacilitiesfederalgovernmentheadquarteredidentificationlawlocalmissionnetworkspersonnelpolicies
SHARED TOKENS (35): "administration", "agency", "approximately", "authority", "connecting", "data", "department", "detection", "enforcement", "facilities", "federal", "government", "headquartered", "identification", "law", "local", "mission", "networks", "personnel", "policies".... | EXACT TITLE in police_law_enforcement: "Transportation Security Administration".
0.500
activitiesagenciesagencyauthoritybuildingbureaucentralcollectioncommunityconductcoordinationdepartmentenforcementestablishedfederalfieldfunctionfunctionsgeneralgovernment
SHARED TOKENS (40): "activities", "agencies", "agency", "authority", "building", "bureau", "central", "collection", "community", "conduct", "coordination", "department", "enforcement", "established", "federal", "field", "function", "functions", "general", "government".... | EXACT TITLE in police_law_enforcement: "Federal Bureau of Investigation".
0.500
activityapprovalauthoritybecomecentercenterscentralcollectionconductconductedcontractcostsdatadesigndevelopmentdevicesdrugdrugsfunctionsgenerate
SHARED TOKENS (44): "activity", "approval", "authority", "become", "center", "centers", "central", "collection", "conduct", "conducted", "contract", "costs", "data", "design", "development", "devices", "drug", "drugs", "functions", "generate".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
agriculturalappliedcentralchemistrycompositionconductdesigndevelopmentdirectlyevaluationfieldfoodlifematerialsmodernmolecularorganizedperformpracticesprocesses
SHARED TOKENS (30): "agricultural", "applied", "central", "chemistry", "composition", "conduct", "design", "development", "directly", "evaluation", "field", "food", "life", "materials", "modern", "molecular", "organized", "perform", "practices", "processes".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
Probation ↗ Q13961 EXACT TITLE
appliesbehaviorcommunityconditionsdrugdrugseducationaljurisdictionlawmaintainmeansorderordersparticipateperformprogramremainrequiredrulessubject
SHARED TOKENS (21): "applies", "behavior", "community", "conditions", "drug", "drugs", "educational", "jurisdiction", "law", "maintain", "means", "order", "orders", "participate", "perform", "program", "remain", "required", "rules", "subject".... | EXACT TITLE in police_law_enforcement: "Probation".
0.500
affectanalysisanalyticalassociatedcostsdifferentestablishingformhigherlaboratorylaterprocessproductionseparatesitessmallersystemtechniquesthem
SHARED TOKENS (19): "affect", "analysis", "analytical", "associated", "costs", "different", "establishing", "form", "higher", "laboratory", "later", "process", "production", "separate", "sites", "smaller", "system", "techniques", "them". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
departmentfundinggovernedhealthholdhumaninstitutionalinstitutionsinvolvingoversightpublicresearchresearchersreviewrightsrulesignificantsubjectstitlewelfare
SHARED TOKENS (20): "department", "funding", "governed", "health", "hold", "human", "institutional", "institutions", "involving", "oversight", "public", "research", "researchers", "review", "rights", "rule", "significant", "subjects", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongbiologycarecurrentdesigndevelopmentdevicesdrugsequipmentfieldfieldsgrowthhealthhealthcarehospitalsmaintenancemakingmanagementmedicalmedicine
SHARED TOKENS (31): "among", "biology", "care", "current", "design", "development", "devices", "drugs", "equipment", "field", "fields", "growth", "health", "healthcare", "hospitals", "maintenance", "making", "management", "medical", "medicine".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
biologybloodchangeschemistrycriticaldevelopmentexperiencedfieldhumaninterpretedmajormedicalmedicinemolecularphysicalregulationrolesciencestructurework
SHARED TOKENS (20): "biology", "blood", "changes", "chemistry", "critical", "development", "experienced", "field", "human", "interpreted", "major", "medical", "medicine", "molecular", "physical", "regulation", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
actagainstagencieschannelschildrendepartmentdistributedenforcementfederallawlocalnationalnetworkofficeoperationorganizedpreventionprogramresourcesstrategy
SHARED TOKENS (21): "act", "against", "agencies", "channels", "children", "department", "distributed", "enforcement", "federal", "law", "local", "national", "network", "office", "operation", "organized", "prevention", "program", "resources", "strategy".... | EXACT TITLE in police_law_enforcement: "Internet Crimes Against Children Task Force".
0.500
actamendmentsassociatedcomplexcontrolsdesigndevicesdrugestablishestablishedfederalfieldfoodgeneralgovernmentsincreaseintendedlaterlifemajor
SHARED TOKENS (38): "act", "amendments", "associated", "complex", "controls", "design", "devices", "drug", "establish", "established", "federal", "field", "food", "general", "governments", "increase", "intended", "later", "life", "major".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
Pathology ↗ Q7208 EXACT TITLE
analysisbiologychangesconditionsconducteddevelopmentdifferentdistinctfieldfieldsgeneralhumanmajormedicalmodernphysicalpracticepracticesprocessesresearch
SHARED TOKENS (24): "analysis", "biology", "changes", "conditions", "conducted", "development", "different", "distinct", "field", "fields", "general", "human", "major", "medical", "modern", "physical", "practice", "practices", "processes", "research".... | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
assetscannotcenterchannelschildrencomplexconnectdatadepartmentfamilyformalinformationlawlegalnationalofficialorganizationspeoplepracticesprivacy
SHARED TOKENS (26): "assets", "cannot", "center", "channels", "children", "complex", "connect", "data", "department", "family", "formal", "information", "law", "legal", "national", "official", "organizations", "people", "practices", "privacy".... | EXACT TITLE in police_law_enforcement: "Missing person".
0.500
actadministrationagencyassetsdecisionsdepartmentdistrictsenforcementestablishedfederalgeneralgovernmenthistorylawmanagementnationalofficeoperatesoperationoperations
SHARED TOKENS (29): "act", "administration", "agency", "assets", "decisions", "department", "districts", "enforcement", "established", "federal", "general", "government", "history", "law", "management", "national", "office", "operates", "operation", "operations".... | EXACT TITLE in police_law_enforcement: "United States Marshals Service".
0.500
accurateanalysisanalyticalappliedautomatedbasicbiologybloodcapabilitieschangeschemistrydevelopmentdifferentdivisiondrugevaluationfieldformhealthhealthcare
SHARED TOKENS (47): "accurate", "analysis", "analytical", "applied", "automated", "basic", "biology", "blood", "capabilities", "changes", "chemistry", "development", "different", "division", "drug", "evaluation", "field", "form", "health", "healthcare".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
activitiesanalysisanalyticalautomatedchemistrycommercialconductdatadevelopmentdevicesdifferentfieldgovernmentgraduateincreaselaboratorieslaboratoryotherwiseproceduresprocess
SHARED TOKENS (35): "activities", "analysis", "analytical", "automated", "chemistry", "commercial", "conduct", "data", "development", "devices", "different", "field", "government", "graduate", "increase", "laboratories", "laboratory", "otherwise", "procedures", "process".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
agencyapproximatelyauthoritybusinessescomponentconstructiondirecteconomygovernmentgovernmentsgrowthlocalorganizationorganizationspracticesprivateprocessprocurementproducespublic
SHARED TOKENS (28): "agency", "approximately", "authority", "businesses", "component", "construction", "direct", "economy", "government", "governments", "growth", "local", "organization", "organizations", "practices", "private", "process", "procurement", "produces", "public".... | EXACT TITLE in biotech_life_sciences: "Government procurement".
0.500
analysisconductedcybersecuritydatadevelopeddnaemployeesevidencefieldfirefirmsgovernedgovernmentinvestigationlaboratorylawlegalmajormodernpatterns
SHARED TOKENS (33): "analysis", "conducted", "cybersecurity", "data", "developed", "dna", "employees", "evidence", "field", "fire", "firms", "governed", "government", "investigation", "laboratory", "law", "legal", "major", "modern", "patterns".... | EXACT TITLE in police_law_enforcement: "Forensic science".
0.500
agenciesanalysisdataenforcementfunctionidentifyinginformationlawpatternspreventionprocessreportresourcesrolescience
SHARED TOKENS (15): "agencies", "analysis", "data", "enforcement", "function", "identifying", "information", "law", "patterns", "prevention", "process", "report", "resources", "role", "science". | EXACT TITLE in police_law_enforcement: "Crime analysis".
0.500
agenciesbasicblsbusinessescaredepartmentdevelopingemergencyemployeesfacilitiesfirehistoricallyhospitallifemedicalmembersmodeloperatepersonnelplaces
SHARED TOKENS (34): "agencies", "basic", "bls", "businesses", "care", "department", "developing", "emergency", "employees", "facilities", "fire", "historically", "hospital", "life", "medical", "members", "model", "operate", "personnel", "places".... | EXACT TITLE in police_law_enforcement: "Emergency medical services".
0.500
appliedcomputerdocumentsestablishedevidencefederalformincreasedinformationlawprocedureproceduresprocessingprogramspurposesrelevantrequiredrulerulesstandards
SHARED TOKENS (21): "applied", "computer", "documents", "established", "evidence", "federal", "form", "increased", "information", "law", "procedure", "procedures", "processing", "programs", "purposes", "relevant", "required", "rule", "rules", "standards".... | EXACT TITLE in police_law_enforcement: "Digital evidence".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
appliedassociatedbecomebiologychemistrycontroldependsdevelopeddisciplinesdistinctenvironmentfieldsfunctionfunctionshealthindustriallifemaintainmedicinemolecular
SHARED TOKENS (34): "applied", "associated", "become", "biology", "chemistry", "control", "depends", "developed", "disciplines", "distinct", "environment", "fields", "function", "functions", "health", "industrial", "life", "maintain", "medicine", "molecular".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
actadministrationagencyanimalassociatedauthoritybloodcontrolcurrentdepartmentdevicesdirectlydrugdrugsemployeesfederalfieldfoodhealthhuman
SHARED TOKENS (33): "act", "administration", "agency", "animal", "associated", "authority", "blood", "control", "current", "department", "devices", "directly", "drug", "drugs", "employees", "federal", "field", "food", "health", "human".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
appliedassociatedbenefitscapacitycapitalcostsdirectlydocumentestablishingformgrowthinformationinitialinstitutionallegallistedmarketprivateprocessprovide
SHARED TOKENS (27): "applied", "associated", "benefits", "capacity", "capital", "costs", "directly", "document", "establishing", "form", "growth", "information", "initial", "institutional", "legal", "listed", "market", "private", "process", "provide".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
actagenciesagencyauthoritycodeemergencyemployeeenforcementgovernmentgovernmentslawlocalmunicipalordinanceregionalrulessubjectsystemtypework
SHARED TOKENS (20): "act", "agencies", "agency", "authority", "code", "emergency", "employee", "enforcement", "government", "governments", "law", "local", "municipal", "ordinance", "regional", "rules", "subject", "system", "type", "work". | EXACT TITLE in police_law_enforcement: "Code enforcement".
0.500
Evidence ↗ Q1347572 EXACT TITLE
accessaccordingassociatedcompetingconnectiondescribesdifferentestablisheventsevidenceexperiencefieldsgeneralholdinformationknowledgelawmakesphysicalprivate
SHARED TOKENS (25): "access", "according", "associated", "competing", "connection", "describes", "different", "establish", "events", "evidence", "experience", "fields", "general", "hold", "information", "knowledge", "law", "makes", "physical", "private".... | EXACT TITLE in biotech_life_sciences: "Evidence". | EXACT TITLE in police_law_enforcement: "Evidence".
0.500
careerscentercentralcertificationcollegescriticaleducationfacultyhigherinstitutionsknowledgelifemembersmissionprivateproductionpublicratherresearchsites
SHARED TOKENS (26): "careers", "center", "central", "certification", "colleges", "critical", "education", "faculty", "higher", "institutions", "knowledge", "life", "members", "mission", "private", "production", "public", "rather", "research", "sites".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.480
addressapproximatelycommunityconducteddifferentemergencyofficeoperationphysicalpublicpurposesreportingsafetysystem
SHARED TOKENS (14): "address", "approximately", "community", "conducted", "different", "emergency", "office", "operation", "physical", "public", "purposes", "reporting", "safety", "system". | EXACT TITLE in police_law_enforcement: "911 (emergency telephone number)".
0.480
Cleanroom ↗ Q794827 EXACT TITLE
biologycontainsfacilitiesindustrialinsidemaintainsmaterialspermitsprocessesproductionresearchsizesmallerwork
SHARED TOKENS (14): "biology", "contains", "facilities", "industrial", "inside", "maintains", "materials", "permits", "processes", "production", "research", "size", "smaller", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.480
Biosensor ↗ Q669391 EXACT TITLE
analyticalanotherassociatedcombinescomponentconnectsdetectiondifferentgenerateinteractionresponsibleresultingstudyworks
SHARED TOKENS (14): "analytical", "another", "associated", "combines", "component", "connects", "detection", "different", "generate", "interaction", "responsible", "resulting", "study", "works". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.480
Prison ↗ Q40357 EXACT TITLE
administrationauthoritycenterfacilityfunctionsgoverninghouselargelawpeopleprocessregimessystemtimes
SHARED TOKENS (14): "administration", "authority", "center", "facility", "functions", "governing", "house", "large", "law", "people", "process", "regimes", "system", "times". | EXACT TITLE in police_law_enforcement: "Prison".
0.480
actactiveanothercharacteristicsconditionscontroldrughealthjurisdictionorganizationssafetyshowthemuses
SHARED TOKENS (14): "act", "active", "another", "characteristics", "conditions", "control", "drug", "health", "jurisdiction", "organizations", "safety", "show", "them", "uses". | EXACT TITLE in police_law_enforcement: "Violent crime".
0.480
agriculturalanimalscharacteristicsdevelopeddifferentgrowthinvolvingmolecularpossessproductssciencesizetechniquestimes
SHARED TOKENS (14): "agricultural", "animals", "characteristics", "developed", "different", "growth", "involving", "molecular", "possess", "products", "science", "size", "techniques", "times". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.480
agenciesconsumerenforcementgeneralidaholawlegallocalofficeownershippropertyprotectionproviderepresentation
SHARED TOKENS (14): "agencies", "consumer", "enforcement", "general", "idaho", "law", "legal", "local", "office", "ownership", "property", "protection", "provide", "representation". | EXACT TITLE in police_law_enforcement: "Idaho Attorney General".
0.460
Dispatcher ↗ Q570755 EXACT TITLE
coordinatesdepartmentsdirectemergencyfireinformationmedicaloperationsorganizationspersonnelproviderspublicsystems
SHARED TOKENS (13): "coordinates", "departments", "direct", "emergency", "fire", "information", "medical", "operations", "organizations", "personnel", "providers", "public", "systems". | EXACT TITLE in police_law_enforcement: "Dispatcher".
0.460
activitydevicesdisposalfieldsfunctionsmaterialsotherwiseprocesspublicrolessafesafetyseparate
SHARED TOKENS (13): "activity", "devices", "disposal", "fields", "functions", "materials", "otherwise", "process", "public", "roles", "safe", "safety", "separate". | EXACT TITLE in police_law_enforcement: "Bomb disposal".
0.460
Arrest ↗ Q1403016 EXACT TITLE
actagainstconditionscontrolenforcementlawlegalplacesprocedureprotectionrequirerequirementsystem
SHARED TOKENS (13): "act", "against", "conditions", "control", "enforcement", "law", "legal", "places", "procedure", "protection", "require", "requirement", "system". | EXACT TITLE in police_law_enforcement: "Arrest".
0.450
govgovernmenthealthmedicinenational
SHARED TOKENS (5): "gov", "government", "health", "medicine", "national". | URL->A (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.450
activityagenciescomponentdepartmentsdutiesemergencyenforcementfacilitiesfederalinfrastructureinvestigationlawlocalmaintenancemajoroperatesoperationorderordersprivate
SHARED TOKENS (30): "activity", "agencies", "component", "departments", "duties", "emergency", "enforcement", "facilities", "federal", "infrastructure", "investigation", "law", "local", "maintenance", "major", "operates", "operation", "order", "orders", "private".... | URL->B (1): https://www.irs.gov/compliance/criminal-investigation.
0.440
analysisappliedbiologychemistrycomputerdatafieldmolecularrelationshipssciencesystemstechniques
SHARED TOKENS (12): "analysis", "applied", "biology", "chemistry", "computer", "data", "field", "molecular", "relationships", "science", "systems", "techniques". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.440
administrationapplycannotcommunitydemanddrugfieldformhospitalhospitalspharmaciesprovide
SHARED TOKENS (12): "administration", "apply", "cannot", "community", "demand", "drug", "field", "form", "hospital", "hospitals", "pharmacies", "provide". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.440
activecommunitycomplexdepartmentsdevelopeddifferentfundinghealthintendedpeopleprofessionalwork
SHARED TOKENS (12): "active", "community", "complex", "departments", "developed", "different", "funding", "health", "intended", "people", "professional", "work". | EXACT TITLE in police_law_enforcement: "Supportive housing".
0.440
Parole ↗ Q5357120 EXACT TITLE
associatedcomplianceconditionsdesignateddiffersformoriginatingoutsidepeopleratherservingsystem
SHARED TOKENS (12): "associated", "compliance", "conditions", "designated", "differs", "form", "originating", "outside", "people", "rather", "serving", "system". | EXACT TITLE in police_law_enforcement: "Parole".
0.440
animalsblooddifferentdnafacilityinformationlaboratorymaterialsmedicalpeopleresearchstudies
SHARED TOKENS (12): "animals", "blood", "different", "dna", "facility", "information", "laboratory", "materials", "medical", "people", "research", "studies". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.440
activitiesamongappliesdatabaseeducationemploymenthistoryidentificationindividualprocessrecordsearch
SHARED TOKENS (12): "activities", "among", "applies", "database", "education", "employment", "history", "identification", "individual", "process", "record", "search". | EXACT TITLE in police_law_enforcement: "Background check".
0.440
agenciesboardcontrolenforcementfundinggovernmentlawlegallocalmunicipalreceivereport
SHARED TOKENS (12): "agencies", "board", "control", "enforcement", "funding", "government", "law", "legal", "local", "municipal", "receive", "report". | EXACT TITLE in police_law_enforcement: "Municipal police".
0.420
agencybenefitsdepartmentdevelopmentidahoinsurancelaborprocessesresponsibletechnologyworkforce
SHARED TOKENS (11): "agency", "benefits", "department", "development", "idaho", "insurance", "labor", "processes", "responsible", "technology", "workforce". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.420
activityamongcampusidahomeridianprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (11): "activity", "among", "campus", "idaho", "meridian", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
0.420
Histology ↗ Q7168 EXACT TITLE
animalsbiologyfieldhistoricallyidentificationmedicinemodernplacesstudiesstudyvisible
SHARED TOKENS (11): "animals", "biology", "field", "historically", "identification", "medicine", "modern", "places", "studies", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.400
activitycommunitydedicatedmembersorganizedpreventionreportresidentssafesafety
SHARED TOKENS (10): "activity", "community", "dedicated", "members", "organized", "prevention", "report", "residents", "safe", "safety". | EXACT TITLE in police_law_enforcement: "Neighborhood watch".
0.400
Phlebotomy ↗ Q3595842 EXACT TITLE
bloodinvolvingmakingmedicalperformsprocedureprocesstechnicianstreatmentvolume
SHARED TOKENS (10): "blood", "involving", "making", "medical", "performs", "procedure", "process", "technicians", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.400
agenciesconductdocumenteddocumentsexpectationsgovernmentinformationjurisdictionpublicrecords
SHARED TOKENS (10): "agencies", "conduct", "documented", "documents", "expectations", "government", "information", "jurisdiction", "public", "records". | EXACT TITLE in police_law_enforcement: "Public records".
0.400
agenciesanalysiscomponentenforcementidentifyinformationlawpatternsstrategysystems
SHARED TOKENS (10): "agencies", "analysis", "component", "enforcement", "identify", "information", "law", "patterns", "strategy", "systems". | EXACT TITLE in police_law_enforcement: "Crime mapping".
0.400
activitiesenforcementjurisdictionlawmunicipalnationalorganizedregionalrelevanttype
SHARED TOKENS (10): "activities", "enforcement", "jurisdiction", "law", "municipal", "national", "organized", "regional", "relevant", "type". | EXACT TITLE in police_law_enforcement: "State police".
0.380
Hazardous waste ↗ EXACT TITLE
environmenthealthhumanlocalmaterialsmillionnationalproducesregulated
SHARED TOKENS (9): "environment", "health", "human", "local", "materials", "million", "national", "produces", "regulated". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.380
agencyboisedepartmentfederalgovernmentidahomaintainedregionalresponsible
SHARED TOKENS (9): "agency", "boise", "department", "federal", "government", "idaho", "maintained", "regional", "responsible". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.380
actchaptercodefederalhealthlawpublictitlewelfare
SHARED TOKENS (9): "act", "chapter", "code", "federal", "health", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.380
amendmentsapplybasicfederallaboratoryregulatoryresearchstandardstesting
SHARED TOKENS (9): "amendments", "apply", "basic", "federal", "laboratory", "regulatory", "research", "standards", "testing". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.360
associationcentersfirmsindustrialorganizationrelatedresearchserves
SHARED TOKENS (8): "association", "centers", "firms", "industrial", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.360
Sheriff ↗ Q578478 EXACT TITLE
developeddutiesgovernmenthistoricalindependentlyofficeofficialoriginated
SHARED TOKENS (8): "developed", "duties", "government", "historical", "independently", "office", "official", "originated". | EXACT TITLE in police_law_enforcement: "Sheriff".
0.350
federalgovernmenthealthmedicalmedicinemillionnationalrelatedreportsworks
SHARED TOKENS (10): "federal", "government", "health", "medical", "medicine", "million", "national", "related", "reports", "works". | URL->A (1): http://clinicaltrials.gov/.
0.340
affectanimalsconditionscyclesidentificationmanagementstudy
SHARED TOKENS (7): "affect", "animals", "conditions", "cycles", "identification", "management", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.320
actdisposalfederalgoverninglawresource
SHARED TOKENS (6): "act", "disposal", "federal", "governing", "law", "resource". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.320
evenfunctionoperatesstructurestudysystems
SHARED TOKENS (6): "even", "function", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.300
actagenciescontrolcouncilcybersecuritydepartmentdepartmentsemployeesfederalhealthhousehumanoperationspolicypublicresponseresponsiblesignificanttransportation
SHARED TOKENS (19): "act", "agencies", "control", "council", "cybersecurity", "department", "departments", "employees", "federal", "health", "house", "human", "operations", "policy", "public", "response", "responsible", "significant", "transportation".
0.300
analysisappliedarchitecturebeyondcommercialcomponentdatadevelopmentdifferentenvironmentsequipmentevenfacilitiesfunctionshistoricallyinformationinfrastructurelaboratorymanagementmedicine
SHARED TOKENS (38): "analysis", "applied", "architecture", "beyond", "commercial", "component", "data", "development", "different", "environments", "equipment", "even", "facilities", "functions", "historically", "information", "infrastructure", "laboratory", "management", "medicine"....
0.300
Criminology ↗ Q161733 KW CROSS HIGH
activitiesadministrationagenciesconditionscontroleducationalenforcementfieldinstitutionsinterestslawlegallinesprivateprocessespublicrelatedresearchstudiesstudy
SHARED TOKENS (22): "activities", "administration", "agencies", "conditions", "control", "educational", "enforcement", "field", "institutions", "interests", "law", "legal", "lines", "private", "processes", "public", "related", "research", "studies", "study"....
0.300
accordingagriculturalanimalcontroldevelopeddirectdisposalexpansiongeneralgrowthhealthhistoryincreaselargeorderpipelineproductionrolescalesmall
SHARED TOKENS (24): "according", "agricultural", "animal", "control", "developed", "direct", "disposal", "expansion", "general", "growth", "health", "history", "increase", "large", "order", "pipeline", "production", "role", "scale", "small"....
0.300
appliedbusinesscapitalcenterscollegesdevelopmenteducationalemploymentgovernmenthigherinstitutionslocalnetworksplacesprivatepublicrelatedresearchrevenuetechnology
SHARED TOKENS (22): "applied", "business", "capital", "centers", "colleges", "development", "educational", "employment", "government", "higher", "institutions", "local", "networks", "places", "private", "public", "related", "research", "revenue", "technology"....
0.300
activitiesanotherappliedappliesapplyauthorityauthorizedbenefitsboardcapacityconditionsconductconducteddecisionsevidenceformhealthcareimmediateindividualinformation
SHARED TOKENS (48): "activities", "another", "applied", "applies", "apply", "authority", "authorized", "benefits", "board", "capacity", "conditions", "conduct", "conducted", "decisions", "evidence", "form", "healthcare", "immediate", "individual", "information"....
0.300
actadministrationapplyapprovalbenefitsboardcommercialconductedcontroldatademonstratedesigndevicesdrugevaluationfoodhumaninformationinstitutionalintended
SHARED TOKENS (44): "act", "administration", "apply", "approval", "benefits", "board", "commercial", "conducted", "control", "data", "demonstrate", "design", "devices", "drug", "evaluation", "food", "human", "information", "institutional", "intended"....
0.300
accesscentercentersdepartmentemergencyfirelocalmedicalnetworkoperatorsorderpeoplepublicresponseresponsiblesafetystationsystemtrainedtype
SHARED TOKENS (20): "access", "center", "centers", "department", "emergency", "fire", "local", "medical", "network", "operators", "order", "people", "public", "response", "responsible", "safety", "station", "system", "trained", "type".
0.300
Security guard ↗ Q856887 KW CROSS HIGH
agenciesassetsauthoritybehaviorbusinessesdepartmentsdirectlyeligibilityemergencyequipmentexperiencefunctiongovernedgovernmentindividualjurisdictionlegallocalmedicalmodern
SHARED TOKENS (32): "agencies", "assets", "authority", "behavior", "businesses", "departments", "directly", "eligibility", "emergency", "equipment", "experience", "function", "governed", "government", "individual", "jurisdiction", "legal", "local", "medical", "modern"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysiscompositioncoversdistinctdnaexpandedfieldfoodfunctionsidentificationlargerequirementsscalescopesinglestructurestudysystem
SHARED TOKENS (19): "activity", "analysis", "composition", "covers", "distinct", "dna", "expanded", "field", "food", "functions", "identification", "large", "requirements", "scale", "scope", "single", "structure", "study", "system".
0.300
DNA profiling ↗ Q476697 KW CROSS HIGH
analysisanimalcharacteristicsdevelopeddnaeligibilityestablishevidencefieldsidentifyindividualintendedmedicalmodernprocessprofilesprovideratherreliableresearch
SHARED TOKENS (24): "analysis", "animal", "characteristics", "developed", "dna", "eligibility", "establish", "evidence", "fields", "identify", "individual", "intended", "medical", "modern", "process", "profiles", "provide", "rather", "reliable", "research"....
0.300
agenciesgovernmentinstitutionssupportsystem
SHARED TOKENS (5): "agencies", "government", "institutions", "support", "system". | EXACT TITLE in police_law_enforcement: "Criminal justice".
0.300
againstappliedappliescommunitydifferentgovernmentgrantsincorporatedprocesspublicrelatedremainrequirementrequiresrightsthem
SHARED TOKENS (16): "against", "applied", "applies", "community", "different", "government", "grants", "incorporated", "process", "public", "related", "remain", "requirement", "requires", "rights", "them".
0.300
Police dog ↗ Q39235 KW CROSS HIGH
associatedbecomedrugsdutiesenforcementevidenceinitiallawlocalnationalpeopleprogramspurposesremainsizesmallertrainedtrainingwork
SHARED TOKENS (19): "associated", "become", "drugs", "duties", "enforcement", "evidence", "initial", "law", "local", "national", "people", "programs", "purposes", "remain", "size", "smaller", "trained", "training", "work".
0.300
Dashcam ↗ Q5226605 KW CROSS HIGH
broadercommercialcomponentcoredataformhigherinsiderecordrecordsregistrationsourcesystemstechnologyview
SHARED TOKENS (15): "broader", "commercial", "component", "core", "data", "form", "higher", "inside", "record", "records", "registration", "source", "systems", "technology", "view".
0.300
actauthorityauthorizedbroaderchangesenforcementfederalgrantholdinitiativeintendedlawofficepeopleprivateprotectionprovisionsreceivingreportsrights
SHARED TOKENS (21): "act", "authority", "authorized", "broader", "changes", "enforcement", "federal", "grant", "hold", "initiative", "intended", "law", "office", "people", "private", "protection", "provisions", "receiving", "reports", "rights"....
0.300
enforcementlawnegotiationpeoplesubjects
SHARED TOKENS (5): "enforcement", "law", "negotiation", "people", "subjects". | EXACT TITLE in police_law_enforcement: "Crisis negotiation".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsidebiologycapabilitiescarechemistrycompositiondesigndrugdrugsfieldfunctionfunctionshealthinteractionmedicalmolecularpracticeprocessesresearchrole
SHARED TOKENS (25): "alongside", "biology", "capabilities", "care", "chemistry", "composition", "design", "drug", "drugs", "field", "function", "functions", "health", "interaction", "medical", "molecular", "practice", "processes", "research", "role"....
0.300
agenciesagencycontroldedicateddutiesemergencyemployeesenforcementevenfederalfirefunctionsgeneralinvestigationlawmanagementmedicalperformprogramsprovide
SHARED TOKENS (26): "agencies", "agency", "control", "dedicated", "duties", "emergency", "employees", "enforcement", "even", "federal", "fire", "functions", "general", "investigation", "law", "management", "medical", "perform", "programs", "provide"....
0.300
Organized crime ↗ Q46952 KW CROSS HIGH
actactivitiesactivityadministrationassessmentassociationbasicbecomebroaderbusinesscommunityconductcontroldemanddepartmentdevelopmentdrugdrugseducationenforcement
SHARED TOKENS (58): "act", "activities", "activity", "administration", "assessment", "association", "basic", "become", "broader", "business", "community", "conduct", "control", "demand", "department", "development", "drug", "drugs", "education", "enforcement"....
0.300
analysisassessmentauthoritycommunitycontrolexpandedidentificationidentifymodelorderorganizationsplacespreventionprivatepublicrequiresresearchresponsereviewrisk
SHARED TOKENS (23): "analysis", "assessment", "authority", "community", "control", "expanded", "identification", "identify", "model", "order", "organizations", "places", "prevention", "private", "public", "requires", "research", "response", "review", "risk"....
0.300
careclassificationcomponentexplainsfieldhealthcarehistoryidentifyinformationmajormedicalpatternsphysicalprocedureproceduresprocessprofessionalrequiredseekingstatistics
SHARED TOKENS (22): "care", "classification", "component", "explains", "field", "healthcare", "history", "identify", "information", "major", "medical", "patterns", "physical", "procedure", "procedures", "process", "professional", "required", "seeking", "statistics"....
0.300
addressagenciesagencyauthoritydifferentdivisionenforcementoperateparticipatepeoplepublicseparatetransportationtypework
SHARED TOKENS (15): "address", "agencies", "agency", "authority", "different", "division", "enforcement", "operate", "participate", "people", "public", "separate", "transportation", "type", "work".
0.300
anotherassociatedbecomebiologychangeconcerningconditionscreatecurrentdevelopingdevelopmentfieldsmajormedicalmolecularopportunitiesphysicalprocessespurposesrelated
SHARED TOKENS (26): "another", "associated", "become", "biology", "change", "concerning", "conditions", "create", "current", "developing", "development", "fields", "major", "medical", "molecular", "opportunities", "physical", "processes", "purposes", "related"....
0.300
affectanimalanimalscareconditionscontrolcoveringdifferentfoodhealthhumanmaintainmanagementmedicalmedicinepreventionprofessionalresearchrolessafe
SHARED TOKENS (31): "affect", "animal", "animals", "care", "conditions", "control", "covering", "different", "food", "health", "human", "maintain", "management", "medical", "medicine", "prevention", "professional", "research", "roles", "safe"....
0.300
accessactivitiesaddressapplycarecenterchildrenenforcementgovernmentinformationlawlistedpublicregistrationrequiredrequirementsresidentialresponsibleriskschool
SHARED TOKENS (23): "access", "activities", "address", "apply", "care", "center", "children", "enforcement", "government", "information", "law", "listed", "public", "registration", "required", "requirements", "residential", "responsible", "risk", "school"....
0.300
assessmentbecomebuiltcommunityenforcementexpansionintelligencelawmanagementmodeloperationsoriginatedratherriskstrategysurveillance
SHARED TOKENS (16): "assessment", "become", "built", "community", "enforcement", "expansion", "intelligence", "law", "management", "model", "operations", "originated", "rather", "risk", "strategy", "surveillance".
0.300
authoritydesignateddutiesemployeeenforcementlawlegallifemodernperformpropertypublicpublic-sectorrelatedsafetyseparatethemwhose
SHARED TOKENS (18): "authority", "designated", "duties", "employee", "enforcement", "law", "legal", "life", "modern", "perform", "property", "public", "public-sector", "related", "safety", "separate", "them", "whose".
0.300
actadministrationagencyagentsconductdepartmentdescribeddistinctenforcementfederalfunctionsincreasedincreasinglylawlegalmaintainsmajormanagementmetromission
SHARED TOKENS (36): "act", "administration", "agency", "agents", "conduct", "department", "described", "distinct", "enforcement", "federal", "functions", "increased", "increasingly", "law", "legal", "maintains", "major", "management", "metro", "mission"....
0.300
cannotconductconductedenforcemententerevidenceinvestigationlawobtainorderprivacyprivateprocedureprocesspropertyproviderequirerulesearchsearches
SHARED TOKENS (21): "cannot", "conduct", "conducted", "enforcement", "enter", "evidence", "investigation", "law", "obtain", "order", "privacy", "private", "procedure", "process", "property", "provide", "require", "rule", "search", "searches"....
0.300
actagainstappropriationsapproximatelybureauchangeconsolidatedcontroldepartmentdrugenforcementequipmentestablishedfederalfundinggrantgrantsintendedlocalmaking
SHARED TOKENS (31): "act", "against", "appropriations", "approximately", "bureau", "change", "consolidated", "control", "department", "drug", "enforcement", "equipment", "established", "federal", "funding", "grant", "grants", "intended", "local", "making"....
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
agenciesagriculturalanimalscenterscharacteristicscomplexconditionscreatedevelopingdevelopmentdifferentenvironmentsfoodgovernmenthigherinstitutionsknowledgelandmillionmolecular
SHARED TOKENS (34): "agencies", "agricultural", "animals", "centers", "characteristics", "complex", "conditions", "create", "developing", "development", "different", "environments", "food", "government", "higher", "institutions", "knowledge", "land", "million", "molecular"....
0.300
appliedassociatedblooddifferentfieldfunctionsinvolvingmaintainmaterialsmedicalmedicineperformpracticerequirescopesupportsystemuses
SHARED TOKENS (18): "applied", "associated", "blood", "different", "field", "functions", "involving", "maintain", "materials", "medical", "medicine", "perform", "practice", "require", "scope", "support", "system", "uses".
0.300
activitycannotcostscurrentdocumentsentergovernmenthouseinvestigationlargelawofficialotherwiseprocesspublicresearchreviewrisksubjectsubstantial
SHARED TOKENS (21): "activity", "cannot", "costs", "current", "documents", "enter", "government", "house", "investigation", "large", "law", "official", "otherwise", "process", "public", "research", "review", "risk", "subject", "substantial"....
0.300
accessagenciesanalysisapproximatelydatadatabasedirectlydnaenforcementfamilyfieldidentifiedidentifyidentifyingindividualinformationlawlegalmillionorganization
SHARED TOKENS (31): "access", "agencies", "analysis", "approximately", "data", "database", "directly", "dna", "enforcement", "family", "field", "identified", "identify", "identifying", "individual", "information", "law", "legal", "million", "organization"....
0.300
Police academy ↗ Q277845 KW CROSS HIGH
agenciesagencyamongbusinessescentercollegeconductcontentdepartmentdutiesenforcementequipmentevenfacilitiesindividualjurisdictionlawlegalmedicalnegotiation
SHARED TOKENS (33): "agencies", "agency", "among", "businesses", "center", "college", "conduct", "content", "department", "duties", "enforcement", "equipment", "even", "facilities", "individual", "jurisdiction", "law", "legal", "medical", "negotiation"....
0.300
accessaccurateactivitiesadministrationagencyassociationcapacitycenterschangescontentcontroldepartmentdevelopingeducationalfederalfoodgovernmentheadquarteredhealthhuman
SHARED TOKENS (42): "access", "accurate", "activities", "administration", "agency", "association", "capacity", "centers", "changes", "content", "control", "department", "developing", "educational", "federal", "food", "government", "headquartered", "health", "human"....
0.300
agenciescollectioncreatedatadescribedenforcementformgovernmentincreasedlawprivacypurposesregistrationsurveillancesystemstechnologytextuses
SHARED TOKENS (18): "agencies", "collection", "create", "data", "described", "enforcement", "form", "government", "increased", "law", "privacy", "purposes", "registration", "surveillance", "systems", "technology", "text", "uses".
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
animalconditionscontainingcontrolleddevelopmentenvironmentformgrowthhistoricalisolatedlaboratorylinesmaintainedoutsidepopulationpracticeprocessrelatedrequiresingle
SHARED TOKENS (23): "animal", "conditions", "containing", "controlled", "development", "environment", "form", "growth", "historical", "isolated", "laboratory", "lines", "maintained", "outside", "population", "practice", "process", "related", "require", "single"....
0.300
accessagenciesannualapproximatelybusinessescapitalchemistrydevelopeddevelopmentdistinctdocumenteddrugdrugseducationevaluationexpansionfieldfirmsfundinggovern
SHARED TOKENS (49): "access", "agencies", "annual", "approximately", "businesses", "capital", "chemistry", "developed", "development", "distinct", "documented", "drug", "drugs", "education", "evaluation", "expansion", "field", "firms", "funding", "govern"....
0.300
accordingadministrationannualapprovalcenterchangescommercecompliancedrugentityevaluationeventsfacilitiesfoodforminformationinterstatelegalproductsregulated
SHARED TOKENS (28): "according", "administration", "annual", "approval", "center", "changes", "commerce", "compliance", "drug", "entity", "evaluation", "events", "facilities", "food", "form", "information", "interstate", "legal", "products", "regulated"....
0.300
amendmentsappliedauthorityauthorizedbecomeboardcollegecommerceconductdecisionseducationenforcementfederalgovernmentgovernmentshouseinterpretedjurisdictionlawlife
SHARED TOKENS (36): "amendments", "applied", "authority", "authorized", "become", "board", "college", "commerce", "conduct", "decisions", "education", "enforcement", "federal", "government", "governments", "house", "interpreted", "jurisdiction", "law", "life"....
0.300
agencycreatedepartmentdocumentdutiesenforcementenvironmentlawlocalpreventionratherresourceresponsiblesafetyschoolstaffstudentswork
SHARED TOKENS (18): "agency", "create", "department", "document", "duties", "enforcement", "environment", "law", "local", "prevention", "rather", "resource", "responsible", "safety", "school", "staff", "students", "work".
0.300
Body camera ↗ Q17020273 KW CROSS HIGH
behaviorcommercecommunitiesenforcementevidencehealthcarelargelawmediamedicalpeoplepersonnelpublicrecordresearchshowssupportsurveillancesystemthem
SHARED TOKENS (22): "behavior", "commerce", "communities", "enforcement", "evidence", "healthcare", "large", "law", "media", "medical", "people", "personnel", "public", "record", "research", "shows", "support", "surveillance", "system", "them"....
0.300
Mounted police ↗ Q578015 KW CROSS HIGH
advantagecannotcontroldutiesfunctionincreasinglypeoplepreventionresponsibleresultingriskrolessearchspecializedthemtrained
SHARED TOKENS (16): "advantage", "cannot", "control", "duties", "function", "increasingly", "people", "prevention", "responsible", "resulting", "risk", "roles", "search", "specialized", "them", "trained".
0.300
accurateactiveactivitiesanalysisanalyticalbloodchemistrycombinesdetectiondisciplinesdistinctdrugdrugsevidenceexpandedfieldformhumanidentifyidentifying
SHARED TOKENS (41): "accurate", "active", "activities", "analysis", "analytical", "blood", "chemistry", "combines", "detection", "disciplines", "distinct", "drug", "drugs", "evidence", "expanded", "field", "form", "human", "identify", "identifying"....
0.300
addresscarecommunitiescreationcurrentdevelopedeconomyfinanceformhealthhealthcaremedicalproductsrequirementssystemteams
SHARED TOKENS (16): "address", "care", "communities", "creation", "current", "developed", "economy", "finance", "form", "health", "healthcare", "medical", "products", "requirements", "system", "teams".
0.300
actactivityanotherassetsbusinesscapitalcentralconsolidatedconsolidationcontrolcreatedepartmentdescribeddirectentityfederalgovernedgovernmentinterestslaw
SHARED TOKENS (39): "act", "activity", "another", "assets", "business", "capital", "central", "consolidated", "consolidation", "control", "create", "department", "described", "direct", "entity", "federal", "governed", "government", "interests", "law"....
0.300
agencyassessmentdepartmenteducationemployeeemployeesenforcementestablishingfederalfederallygovernmentgovernmentshouseindependentinformationlaboratorieslegallocalmattersnational
SHARED TOKENS (33): "agency", "assessment", "department", "education", "employee", "employees", "enforcement", "establishing", "federal", "federally", "government", "governments", "house", "independent", "information", "laboratories", "legal", "local", "matters", "national"....
0.300
agenciesassociatedchangescommunitygeneralidentityinformationknowledgelegalmedicinenationalpeopleproceduresprocessprogramprogramsprovideresearchresourcesrights
SHARED TOKENS (25): "agencies", "associated", "changes", "community", "general", "identity", "information", "knowledge", "legal", "medicine", "national", "people", "procedures", "process", "program", "programs", "provide", "research", "resources", "rights"....
0.300
activitiesagencyauthorizedbenefitsdirectentityfederalformfundinggeneralgovernmentgrantgrantslawlocalorganizationorganizationsoutsideprivateprograms
SHARED TOKENS (24): "activities", "agency", "authorized", "benefits", "direct", "entity", "federal", "form", "funding", "general", "government", "grant", "grants", "law", "local", "organization", "organizations", "outside", "private", "programs"....
0.300
activeagainstanimalsapprovalbasicbecomechemistrycommercialcomplexdevelopeddevelopmentdrugdrugsentityexperiencefieldsfundinggovernmentsgrantshealth
SHARED TOKENS (56): "active", "against", "animals", "approval", "basic", "become", "chemistry", "commercial", "complex", "developed", "development", "drug", "drugs", "entity", "experience", "fields", "funding", "governments", "grants", "health"....
0.300
activitiesanimalanimalsappearsassociatedbloodcarecharacteristicscontainingdescribeddevicesdiffersdisposaldistinctemergencyenvironmentfacilitiesgeneralgeneratehealth
SHARED TOKENS (38): "activities", "animal", "animals", "appears", "associated", "blood", "care", "characteristics", "containing", "described", "devices", "differs", "disposal", "distinct", "emergency", "environment", "facilities", "general", "generate", "health"....
0.300
accessagentscenterscontrolequipmentestablishedfacilitiesfacilityhealthhigherlaboratorieslaboratorypersonnelpreventionproceduresprotectionreportsrequiredspecifiedsystems
SHARED TOKENS (21): "access", "agents", "centers", "control", "equipment", "established", "facilities", "facility", "health", "higher", "laboratories", "laboratory", "personnel", "prevention", "procedures", "protection", "reports", "required", "specified", "systems"....
0.300
accurateanalysisappliedcontroldocumentdocumentationdocumentsdrugevidencefieldsfoodhistoricalhistorylaboratorylegalmanagementmaterialsmeansoriginateownership
SHARED TOKENS (28): "accurate", "analysis", "applied", "control", "document", "documentation", "documents", "drug", "evidence", "fields", "food", "historical", "history", "laboratory", "legal", "management", "materials", "means", "originate", "ownership"....
0.300
accordingactagainstagenciesamongappropriationsbuildingcommunitiesconnectionconsolidateddescribedenforcementestablishedevenexperienceexperiencedgovernmentgovernmentshigherhouse
SHARED TOKENS (38): "according", "act", "against", "agencies", "among", "appropriations", "building", "communities", "connection", "consolidated", "described", "enforcement", "established", "even", "experience", "experienced", "government", "governments", "higher", "house"....
0.300
beyondbusinessbusinessesdevelopingexternalfundinggrowthinfluencelargemodelprivateprojectpublicrapidsignificant
SHARED TOKENS (15): "beyond", "business", "businesses", "developing", "external", "funding", "growth", "influence", "large", "model", "private", "project", "public", "rapid", "significant".
0.300
applycodedesigndevelopingevenexpandedfieldsfunctiongeneralindustrialknowledgemarketmedicineprocessproductionresearchresearchersstructurevalue
SHARED TOKENS (19): "apply", "code", "design", "developing", "even", "expanded", "fields", "function", "general", "industrial", "knowledge", "market", "medicine", "process", "production", "research", "researchers", "structure", "value".
0.300
activitiesagenciesbecomeboardcommunitycreatedesignateddirectdutiesenforcemententityformfunctionsgovernmenthealthcarejurisdictionlawmembersoversightparticipation
SHARED TOKENS (33): "activities", "agencies", "become", "board", "community", "create", "designated", "direct", "duties", "enforcement", "entity", "form", "functions", "government", "healthcare", "jurisdiction", "law", "members", "oversight", "participation"....
0.300
administersagencyagriculturalapproximatelycommercialcommunitiescomponentcurrentdepartmentdirectlyfederalfoodgovernmentnationalnutritionproductionprogramprogramsreportsresources
SHARED TOKENS (23): "administers", "agency", "agricultural", "approximately", "commercial", "communities", "component", "current", "department", "directly", "federal", "food", "government", "national", "nutrition", "production", "program", "programs", "reports", "resources"....
0.300
actadministersadministrationagencyamendmentscarecenterscertificationchildrendepartmentfacilitiesfederalgovgovernmentshealthhealthcarehumaninsurancelaboratorymedicaid
SHARED TOKENS (28): "act", "administers", "administration", "agency", "amendments", "care", "centers", "certification", "children", "department", "facilities", "federal", "gov", "governments", "health", "healthcare", "human", "insurance", "laboratory", "medicaid"....
0.300
basicbiologybloodcharacteristicschemistrycomputercontainingdatadetectionfunctionhealthphysicalpopulationpracticeprocessresearchseparatesizeuses
SHARED TOKENS (19): "basic", "biology", "blood", "characteristics", "chemistry", "computer", "containing", "data", "detection", "function", "health", "physical", "population", "practice", "process", "research", "separate", "size", "uses".
0.300
agentsanalysisbecomebuildingchangeschemistryconstructioncyclesdetectiondevelopeddifferentdnaexposesidentificationisolatedlaboratorymedicalproceduresprocessregion
SHARED TOKENS (26): "agents", "analysis", "become", "building", "changes", "chemistry", "construction", "cycles", "detection", "developed", "different", "dna", "exposes", "identification", "isolated", "laboratory", "medical", "procedures", "process", "region"....
0.300
Use of force ↗ Q971119 KW CROSS HIGH
accordinganothercodecomplianceenforcementjurisdictionlawlegalorderpersonnelphysicalpositionpracticalpreventionquestionsrecognizedrequiredrightssubject
SHARED TOKENS (19): "according", "another", "code", "compliance", "enforcement", "jurisdiction", "law", "legal", "order", "personnel", "physical", "position", "practical", "prevention", "questions", "recognized", "required", "rights", "subject".
0.300
actadministrationagencyconditionscostsdepartmenteducationemploymentestablishedfederalhealthlaborlawmissionoccupationaloutreachreduceregulatorysafesafety
SHARED TOKENS (22): "act", "administration", "agency", "conditions", "costs", "department", "education", "employment", "established", "federal", "health", "labor", "law", "mission", "occupational", "outreach", "reduce", "regulatory", "safe", "safety"....
0.300
appliedappliesauthoritybecomedutiesemployeesenforcementgovernmentgrantsincreasinglyinvolvinglawlegalofficialoutsideperformancequestionsratherreportrights
SHARED TOKENS (23): "applied", "applies", "authority", "become", "duties", "employees", "enforcement", "government", "grants", "increasingly", "involving", "law", "legal", "official", "outside", "performance", "questions", "rather", "report", "rights"....
0.300
animalsanotherbiologyfoodhealthhumaninformationlifemajormedicinemolecularphysicalscalesciencestudiesstudytype
SHARED TOKENS (17): "animals", "another", "biology", "food", "health", "human", "information", "life", "major", "medicine", "molecular", "physical", "scale", "science", "studies", "study", "type".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalchangescontroldescribeddevelopmentexpansionfinancefirmsgeneralmanagementoperationalotherwiseownershippressprivateproductsprovidepublic
SHARED TOKENS (24): "active", "business", "capital", "changes", "control", "described", "development", "expansion", "finance", "firms", "general", "management", "operational", "otherwise", "ownership", "press", "private", "products", "provide", "public"....
0.300
animalcontrolotherwisepopulationwork
SHARED TOKENS (5): "animal", "control", "otherwise", "population", "work". | EXACT TITLE in police_law_enforcement: "Animal control".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessaccordinganotherbenefitscomputerdatadocumentsevengovernmentidentifyingidentityindividualinformationinvolvinglatermajormillionobtainofficeonline
SHARED TOKENS (33): "access", "according", "another", "benefits", "computer", "data", "documents", "even", "government", "identifying", "identity", "individual", "information", "involving", "later", "major", "million", "obtain", "office", "online"....
0.300
actbecomedutiesenforcementformincreasinglylawmembersmodernorderorderspeopleperformpersonnelpracticeprovidepublicreceiverecognizedteams
SHARED TOKENS (21): "act", "become", "duties", "enforcement", "form", "increasingly", "law", "members", "modern", "order", "orders", "people", "perform", "personnel", "practice", "provide", "public", "receive", "recognized", "teams"....
0.300
agenciesagencydeploymentdutiesemploymentenforcementgovernmentjurisdictionlawlegalorganizedperformresourcesresponsiblerightsthemtype
SHARED TOKENS (17): "agencies", "agency", "deployment", "duties", "employment", "enforcement", "government", "jurisdiction", "law", "legal", "organized", "perform", "resources", "responsible", "rights", "them", "type".
0.300
accuracyagenciesanalysischemistrycontroldifferentdrugsevidencefieldgoverningidentificationidentifylayerlegalmaterialsoperatingproceduresreportingspecialistsstandards
SHARED TOKENS (23): "accuracy", "agencies", "analysis", "chemistry", "control", "different", "drugs", "evidence", "field", "governing", "identification", "identify", "layer", "legal", "materials", "operating", "procedures", "reporting", "specialists", "standards"....
0.300
accessassociatedconstructiondevelopmentdocumentsgoverninggovernmentincreasinglyinformationinstitutionsmaintainsoversightpracticepublicpublicly
SHARED TOKENS (15): "access", "associated", "construction", "development", "documents", "governing", "government", "increasingly", "information", "institutions", "maintains", "oversight", "practice", "public", "publicly".
0.300
activitiesamonganalysisanotherbehaviorbiologycentercomplexcomponentconcerningconstructionconventionalcreatedatadescriptiondifferentdisciplinesexternalfieldfunction
SHARED TOKENS (50): "activities", "among", "analysis", "another", "behavior", "biology", "center", "complex", "component", "concerning", "construction", "conventional", "create", "data", "description", "different", "disciplines", "external", "field", "function"....
0.300
activitiesaddressamendmentsapplydecisionsestablishedevidencefederalgovernmentgovernmentshistorylaterlawlegallocalmeansphysicalprivacyprocessproperty
SHARED TOKENS (29): "activities", "address", "amendments", "apply", "decisions", "established", "evidence", "federal", "government", "governments", "history", "later", "law", "legal", "local", "means", "physical", "privacy", "process", "property"....
0.300
administrationagenciesbuildingbureaucontainsdepartmentdirectlydistrictsdrugenforcementenvironmentfederalfunctionsgeneralgovernmentgrantheadquarteredinvestigationlawmanagement
SHARED TOKENS (26): "administration", "agencies", "building", "bureau", "contains", "department", "directly", "districts", "drug", "enforcement", "environment", "federal", "functions", "general", "government", "grant", "headquartered", "investigation", "law", "management"....
0.300
Technology transfer ↗ KW CROSS HIGH
activityanalysisanothercapacitycommercialconnectingcontrolcorecreationdevelopmentenvironmentestablishesfundinggovernmentindustrialinfluenceinstitutionsinterestsknowledgelicensing
SHARED TOKENS (38): "activity", "analysis", "another", "capacity", "commercial", "connecting", "control", "core", "creation", "development", "environment", "establishes", "funding", "government", "industrial", "influence", "institutions", "interests", "knowledge", "licensing"....
0.300
analysischangecharacteristicsevidencefieldfireinsidelegalnationalprocessrecordspecialistssubjecttechniquestechnology
SHARED TOKENS (15): "analysis", "change", "characteristics", "evidence", "field", "fire", "inside", "legal", "national", "process", "record", "specialists", "subject", "techniques", "technology".
0.300
againstamendmentsanotherappliesapplycompensationcontainsfederalgovernmentgovernmentsindividualinterpretedlawlifelocalmeanspeopleprivateprocedureprocedures
SHARED TOKENS (30): "against", "amendments", "another", "applies", "apply", "compensation", "contains", "federal", "government", "governments", "individual", "interpreted", "law", "life", "local", "means", "people", "private", "procedure", "procedures"....
0.300
amongdecisionsdevelopmentdifferenthealthidentifiedindividualinitiativeinterventionsmedicalmedicinemodelmolecularnationalorganizationspeoplepracticesproductsproviderelated
SHARED TOKENS (26): "among", "decisions", "development", "different", "health", "identified", "individual", "initiative", "interventions", "medical", "medicine", "model", "molecular", "national", "organizations", "people", "practices", "products", "provide", "related"....
🫐 BERRY51 edges
0.280
Serology ↗ Q502159 EXACT TITLE
againstbloodresponsestudy
SHARED TOKENS (4): "against", "blood", "response", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.280
Forage ↗ Q13377214 EXACT TITLE
animalsannualdirectlyhistorically
SHARED TOKENS (4): "animals", "annual", "directly", "historically". | EXACT TITLE in biotech_life_sciences: "Forage".
0.280
Rape kit ↗ Q7293902 KW CROSS HIGH
collectiondevelopeddnaevidenceidentifyinginvestigationmedicalorderorganizationpersonnelphysicalprovidesafestandardized
SHARED TOKENS (14): "collection", "developed", "dna", "evidence", "identifying", "investigation", "medical", "order", "organization", "personnel", "physical", "provide", "safe", "standardized".
0.280
assetsbecomeboardcontrolcontrolledcostsdevelopedexpandedfirehumaninfrastructureriversurveillancesystem
SHARED TOKENS (14): "assets", "become", "board", "control", "controlled", "costs", "developed", "expanded", "fire", "human", "infrastructure", "river", "surveillance", "system".
0.280
Cold chain ↗ KW CROSS HIGH
activitiesagriculturalassociateddistributedequipmentfoodlogisticsmaintainmanagementproductionproductsrequiressafetyuses
SHARED TOKENS (14): "activities", "agricultural", "associated", "distributed", "equipment", "food", "logistics", "maintain", "management", "production", "products", "requires", "safety", "uses".
0.280
characteristicschildrendesignatedeveninvolvingjurisdictionmaterialsonlinepossessproductionscopesharedstatutorythem
SHARED TOKENS (14): "characteristics", "children", "designated", "even", "involving", "jurisdiction", "materials", "online", "possess", "production", "scope", "shared", "statutory", "them".
0.260
activitiesaffectblooddesignatedestablishedhealthhumanmillionoccurrisksafestandardstype
SHARED TOKENS (13): "activities", "affect", "blood", "designated", "established", "health", "human", "million", "occur", "risk", "safe", "standards", "type".
0.260
approximatelyboisedatadistrictsevengovernmenthouseidahomemberspeoplepopulationresidentssingle
SHARED TOKENS (13): "approximately", "boise", "data", "districts", "even", "government", "house", "idaho", "members", "people", "population", "residents", "single".
0.260
consumergeneralhigherinformationonlineoperatorprocessproductionproductsprovidersselectionsingletype
SHARED TOKENS (13): "consumer", "general", "higher", "information", "online", "operator", "process", "production", "products", "providers", "selection", "single", "type".
0.260
agenciesanothercommercialcontractorsenforcementjurisdictionlawmeansprivaterisktimestransporttransportation
SHARED TOKENS (13): "agencies", "another", "commercial", "contractors", "enforcement", "jurisdiction", "law", "means", "private", "risk", "times", "transport", "transportation".
0.260
coordinationdevicesemergencyinformationintendedoccurorganizedreceivingsystemsystemstextthereforeunified
SHARED TOKENS (13): "coordination", "devices", "emergency", "information", "intended", "occur", "organized", "receiving", "system", "systems", "text", "therefore", "unified".
0.260
purposesresearchstudy
SHARED TOKENS (3): "purposes", "research", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.260
Biophysics ↗ Q7100 EXACT TITLE
appliessciencestudy
SHARED TOKENS (3): "applies", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.260
Biomarker ↗ EXACT TITLE
bloodfieldsprocesses
SHARED TOKENS (3): "blood", "fields", "processes". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.260
carefacilitieshealthhealthcarehospitalhospitalsidahonetworkoperatesoperatingpeoplesupportsystem
SHARED TOKENS (13): "care", "facilities", "health", "healthcare", "hospital", "hospitals", "idaho", "network", "operates", "operating", "people", "support", "system".
0.240
animalsbiologycomplexdrugdrugsinfluencemodelplacesrelationshipsresponsestudysubstances
SHARED TOKENS (12): "animals", "biology", "complex", "drug", "drugs", "influence", "model", "places", "relationships", "response", "study", "substances".
0.240
dedicateddevelopingdrugdrugsestimateslocalmarketreduceremainsreportsizetrade
SHARED TOKENS (12): "dedicated", "developing", "drug", "drugs", "estimates", "local", "market", "reduce", "remains", "report", "size", "trade".
0.240
administrationcapacitychangescommunityenforcementlawmakespublicquestionssafetystrategytheory
SHARED TOKENS (12): "administration", "capacity", "changes", "community", "enforcement", "law", "makes", "public", "questions", "safety", "strategy", "theory".
0.240
Water quality ↗ Q625376 KW CROSS HIGH
againstassessmentcharacteristicscompliancehealthhumanphysicalsafetysignificantstandardstreatmentwater
SHARED TOKENS (12): "against", "assessment", "characteristics", "compliance", "health", "human", "physical", "safety", "significant", "standards", "treatment", "water".
0.240
Campus police ↗ Q5028727 KW CROSS HIGH
agencyassociatedcampuscollegepeopleprivatepropertypublicsafetytypeuniversitywork
SHARED TOKENS (12): "agency", "associated", "campus", "college", "people", "private", "property", "public", "safety", "type", "university", "work".
0.220
differentenvironmentforminteractionpathwaysrelationshiprelationshipsrolesstudysubstancesthem
SHARED TOKENS (11): "different", "environment", "form", "interaction", "pathways", "relationship", "relationships", "roles", "study", "substances", "them".
0.220
centersentryevenhistoryindividualinformationnationalrecordrecordsrelevantresulting
SHARED TOKENS (11): "centers", "entry", "even", "history", "individual", "information", "national", "record", "records", "relevant", "resulting".
0.220
administrationcouncildrugfoodhumaninvestigatorslinesmeansproceduresprogramregulatory
SHARED TOKENS (11): "administration", "council", "drug", "food", "human", "investigators", "lines", "means", "procedures", "program", "regulatory".
0.220
amendmentsdevelopedfieldintendedinternallaboratorymedicalprogramregulatedresearchsingle
SHARED TOKENS (11): "amendments", "developed", "field", "intended", "internal", "laboratory", "medical", "program", "regulated", "research", "single".
0.220
administrationdedicateddescribingdrugdrugsfoodinfluenceplacesrelationshipstudysubstances
SHARED TOKENS (11): "administration", "dedicated", "describing", "drug", "drugs", "food", "influence", "places", "relationship", "study", "substances".
0.210
Alfalfa ↗ Q156106 EXACT TITLE
family
SHARED TOKENS (1): "family". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.210
buildingdecisionsidaho
SHARED TOKENS (3): "building", "decisions", "idaho". | URL->B (1): http://www.isc.idaho.gov/.
0.200
actagainstboisefederalgovernmentidahojurisdictionnationalofficewhose
SHARED TOKENS (10): "act", "against", "boise", "federal", "government", "idaho", "jurisdiction", "national", "office", "whose".
0.200
amongcapacityconductconnectiondutiesevidenceofficialpropertysearchessurveillance
SHARED TOKENS (10): "among", "capacity", "conduct", "connection", "duties", "evidence", "official", "property", "searches", "surveillance".
0.180
Medical test ↗ Q2671652 KW CROSS HIGH
analysischemistrymedicalmolecularphysicalprocedureprocessestestingtreatment
SHARED TOKENS (9): "analysis", "chemistry", "medical", "molecular", "physical", "procedure", "processes", "testing", "treatment".
0.180
departmentsenforcementeventslawoperatingordersprotectionpublicresponsible
SHARED TOKENS (9): "departments", "enforcement", "events", "law", "operating", "orders", "protection", "public", "responsible".
0.180
Star, Idaho ↗ KW CROSS HIGH
adaboisecanyonhouseidahometropolitanpopulationschoolshared
SHARED TOKENS (9): "ada", "boise", "canyon", "house", "idaho", "metropolitan", "population", "school", "shared".
0.180
accordingagenciesbureauenforcementidaholawlocalresidentsstatistics
SHARED TOKENS (9): "according", "agencies", "bureau", "enforcement", "idaho", "law", "local", "residents", "statistics".
0.180
becomebiologyblooddifferentmedicinemolecularrecognizedsitestreatment
SHARED TOKENS (9): "become", "biology", "blood", "different", "medicine", "molecular", "recognized", "sites", "treatment".
0.180
Seed testing ↗ Q7445654 KW CROSS HIGH
analysisdedicatedevaluatelaboratoriespurposesresearchtechniquestestingtrained
SHARED TOKENS (9): "analysis", "dedicated", "evaluate", "laboratories", "purposes", "research", "techniques", "testing", "trained".
0.180
County police ↗ Q5177941 KW CROSS HIGH
agencyenforcementhistoricallyjurisdictionlawnationalpossesstypeunified
SHARED TOKENS (9): "agency", "enforcement", "historically", "jurisdiction", "law", "national", "possess", "type", "unified".
0.180
behaviorcharacteristicsevaluationidentifyindividualmanagementperformancephysicalrelationship
SHARED TOKENS (9): "behavior", "characteristics", "evaluation", "identify", "individual", "management", "performance", "physical", "relationship".
0.180
boisedesignatedidahointerstatemajormetropolitanmilesriverserves
SHARED TOKENS (9): "boise", "designated", "idaho", "interstate", "major", "metropolitan", "miles", "river", "serves".
0.160
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.160
Select agent ↗ KW CROSS HIGH
agentscontrolleddepartmenthealthhumanlawpublicsafety
SHARED TOKENS (8): "agents", "controlled", "department", "health", "human", "law", "public", "safety".
0.160
educationgraduatehigherprofessionalqualificationsschoolstudentsundergraduate
SHARED TOKENS (8): "education", "graduate", "higher", "professional", "qualifications", "school", "students", "undergraduate".
0.160
Police radio ↗ Q187707 KW CROSS HIGH
agenciesanotherenforcementlawmodernprivatesystemsystems
SHARED TOKENS (8): "agencies", "another", "enforcement", "law", "modern", "private", "system", "systems".
0.140
agriculturalcoversidaholandmajormilesriver
SHARED TOKENS (7): "agricultural", "covers", "idaho", "land", "major", "miles", "river".
0.140
canyonconnectingidahomeridiannamparivervalley
SHARED TOKENS (7): "canyon", "connecting", "idaho", "meridian", "nampa", "river", "valley".
0.120
Water police ↗ Q197617 KW CROSS HIGH
enforcementlaworganizationriverwaterwaters
SHARED TOKENS (6): "enforcement", "law", "organization", "river", "water", "waters".
0.120
Prison officer ↗ Q311396 KW CROSS HIGH
enforcementlawofficialregulationresponsiblesafety
SHARED TOKENS (6): "enforcement", "law", "official", "regulation", "responsible", "safety".
0.120
distinctfederallawprocedureproceduresrules
SHARED TOKENS (6): "distinct", "federal", "law", "procedure", "procedures", "rules".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahometropolitanpopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "metropolitan", "population".
0.100
controldrugdrugsinfluenceoperating
SHARED TOKENS (5): "control", "drug", "drugs", "influence", "operating".
0.100
businessentityprivatepublictype
SHARED TOKENS (5): "business", "entity", "private", "public", "type".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahomilespopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "miles", "population".
◈ Frequently Asked Questions
Biotech Life Sciences × Police Law Enforcement — Treasure Valley
HAIKU · HIGH GATE
How do Boise State University and College of Western Idaho support law enforcement training related to pharmaceutical and biotech crime investigation?
Both institutions offer forensic and chemistry programs that train Ada County and Canyon County law enforcement personnel to identify and document evidence from biotech manufacturing and pharmaceutical distribution crimes. The Drug Enforcement Administration coordinates with these colleges to ensure officers in the Boise metropolitan area understand how to secure and process controlled substance evidence from licensed biotech facilities.
What role does the DEA play in regulating biotech life sciences operations across the Treasure Valley's multiple jurisdictions?
The Drug Enforcement Administration maintains field offices in Boise, Nampa, and Caldwell to monitor compliance with controlled substance manufacturing and distribution regulations at biotech facilities throughout Ada County and Canyon County. Ada County Sheriff and Boise Police Department coordinate enforcement operations with the DEA to prevent diversion of pharmaceutical precursors and finished biotech products from licensed manufacturers.
How do Boise and Meridian law enforcement agencies address contamination and safety violations at biotech life sciences companies?
Boise Police Department and Meridian Police Department work with Ada County health inspectors to investigate reports of hazardous material violations at biotech research and manufacturing sites within their jurisdictions. When criminal negligence or environmental violations occur, these agencies coordinate with the DEA and state prosecutors to determine appropriate charges and enforce compliance with Idaho pharmaceutical safety statutes.
What collaboration exists between Nampa and Caldwell law enforcement and biotech industry oversight in Canyon County?
Nampa and Caldwell police departments partner with Canyon County Sheriff to monitor biotech facilities for theft of intellectual property, employee misconduct, and unauthorized access to controlled laboratory materials. These agencies coordinate training through College of Western Idaho to ensure officers can respond effectively to crimes at life sciences companies operating within Canyon County's boundaries.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Biotech Life Sciences × Police Law Enforcement 13 QID bridges 259 edges 6,924 ext links 2026-07-17 19:46:54 UTC b0f01996a1ad859e
Biotech Life Sciences corridor ↗ Police Law Enforcement corridor ↗ Police Law Enforcement × Biotech Life Sciences ↗ boisestandard.org/standard ↗
Parent Corridors
Biotech Life Sciences × All Other Verticals