—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Biotech Life Sciences ↔ relates to ↔ Agriculture

14 Wikipedia bridge articles confirmed in both vertical ledgers. 219 deterministic cross-vertical edges. 5,918 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
219 Cross Edges
5,918 External Sources
241 Wikipedia Articles
14 🌲 Evergreen
165 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Biotech Life Sciences
× Agriculture
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
219
External Sources Harvested
5,918
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
University of Idaho
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (14)
University of IdahoTreasure ValleyPlant pathologyBoise RiverDairy farmingVeterinary medicineAlfalfaBoise, IdahoNampa, IdahoAda County, IdahoSeed testingCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationapproximatelyresearchagriculturalriverwesternplantlivestockadacapitalhomecanyonprimarilyproductionuniversitylocaltreasurevalley
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:43:15 UTC
Content Hash
c82cd94cc50278d3
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in biotech_life_sciences (tier:evergreen) and agriculture (tier:evergreen). | SHARED TOKENS (15): "approximately", "boise", "established", "extension", "falls", "idaho", "later", "operates", "primarily", "production", "public", "research", "statewide", "uidaho", "university". | EXACT TITLE in biotech_life_sciences: "University of Idaho". | EXACT TITLE in agriculture: "University of Idaho".
approximatelyboiseestablishedextensionfallsidaholateroperatesprimarilyproductionpublicresearchstatewideuidahouniversity
years ago in 1889 and opened three years later, it was the state's sole university for 71 years, until 1963. The university comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
legiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference. In addition to the main campus in Moscow, the U of I has branch campuses in Coeur d'Alene, Boise, and Idaho Falls; it also operates a research park in Post Falls, and dozens of extension offices statewide. History On January 30, 1889, Governor Edward Stevenson of the Idaho Territory signed the territorial legislature's Council Bill No. 20, which officially established the UI as the upcoming state's land-grant institution. Nearly four years later, the university opened for classes on October 3, 1892. The choice of location for the University of Idaho was an "Olive Branch of Peace" by Gov. Stevenson for his actions in styming the nearly successful effort to detach the north Idaho panhandle and join the state of Washington. Formed by the Idaho Territory legislature in 1889, the university opened its doors in 1892 with a class of 40 students.
Ridenbaugh Hall The Board of Regents authorized the construction of Ridenbaugh Hall as the first women's dormitory on campus. Completed in 1901 at a cost of $17,000, it is the oldest extant building on campus. It was designed by architect Willis A. Ritchie of Spokane, who also designed the Spokane County Courthouse. The building used stone quarried in Latah County for the exterior walls. It was also used as a space for domestic science classes until 1927 when it became a men's dormitory. The building was later used for music practice rooms and currently houses the Art and Architecture gallery. Ridenbaugh Hall was the first U of I campus structure to be named after a person. The hall was dedicated to "the young women of Idaho" in honor of Mary E. Ridenbaugh (1857–1926) of Boise, who was vice president of the U of I Board of Regents, and served as regent from 1901 to 1907.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in biotech_life_sciences (tier:evergreen) and agriculture (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "eastern", "historically", "idaho", "land", "local", "lower", "primarily", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in biotech_life_sciences: "Treasure Valley". | EXACT TITLE in agriculture: "Treasure Valley".
agriculturalassociationboiseeasternhistoricallyidaholandlocallowerprimarilyregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Plant pathology
Q188956 EXACT TITLE 0.900
QID OVERLAP: Q188956 in biotech_life_sciences (tier:evergreen) and agriculture (tier:evergreen). | SHARED TOKENS (10): "affect", "conditions", "cycles", "disease", "economic", "environmental", "management", "pathology", "plant", "resistance". | EXACT TITLE in biotech_life_sciences: "Plant pathology". | EXACT TITLE in agriculture: "Plant pathology".
affectconditionscyclesdiseaseeconomicenvironmentalmanagementpathologyplantresistance
al factors). Plant pathology involves the study of pathogen identification, disease etiology, disease cycles, economic impact, plant disease epidemiology, plant disease resistance, how plant diseases affect humans and animals, pathosystem genetics, and management of plant diseases. Plant pathogenicity Plant pathogens, organisms that cause infectious plant diseases, include fungi, oomycetes, bacteria, viruses, viroids, virus-like organisms, phytoplasmas, protozoa, nematodes and parasitic plants. In most plant pathosystems, virulence depends on hydrolases and enzymes that degrade the cell wall. The vast majority of these act on pectins (for example, pectinesterase, pectate lyase, and pectinases). For microbes, the cell wall polysaccharides are both a food source and a barrier to be overcome. Many pathogens grow opportunistically when the host breaks down its own cell walls, most often during fruit ripening.
Some abiotic disorders can be confused with pathogen-induced disorders. Abiotic causes include natural processes such as drought, frost, snow and hail; flooding and poor drainage; nutrient deficiency; deposition of mineral salts such as sodium chloride and gypsum; windburn and breakage by storms; and wildfires. Epidemiology Epidemiology is the study of factors affecting the outbreak and spread of infectious diseases. A disease triangle describes the basic factors required for plant diseases. These are the host plant, the pathogen, and the environment.
n, disease etiology, disease cycles, economic impact, plant disease epidemiology, plant disease resistance, how plant diseases affect humans and animals, pathosystem genetics, and management of plant diseases. Plant pathogenicity Plant pathogens, organisms that cause infectious plant diseases, include fungi, oomycetes, bacteria, viruses, viroids, virus-like organisms, phytoplasmas, protozoa, nematodes and parasitic plants. In most plant pathosystems, virulence depends on hydrolases and enzymes that degrade the cell wall. The vast majority of these act on pectins (for example, pectinesterase, pectate lyase, and pectinases). For microbes, the cell wall polysaccharides are both a food source and a barrier to be overcome. Many pathogens grow opportunistically when the host breaks down its own cell walls, most often during fruit ripening.
Boise River
Q891080 EXACT TITLE 0.840
QID OVERLAP: Q891080 in biotech_life_sciences (tier:evergreen) and agriculture (tier:evergreen). | SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "square", "western". | EXACT TITLE in biotech_life_sciences: "Boise River". | EXACT TITLE in agriculture: "Boise River".
agriculturalapproximatelyboiseidahoriversquarewestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Dairy farming
Q14096331 QID OVERLAP 0.800
QID OVERLAP: Q14096331 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (32): "agricultural", "agriculture", "back", "commercially", "consequences", "control", "dairy", "developed", "disposal", "early", "environmental", "expansion", "farms", "growth", "health", "history", "important", "increase", "industry", "large"....
agriculturalagriculturebackcommerciallyconsequencescontroldairydevelopeddisposalearlyenvironmentalexpansionfarmsgrowthhealthhistoryimportantincreaseindustrylargelivestockmilkorderplantproducersproductproductionrolescalesmall+2
o the FAO. There has been substantial concern over the amount of waste output created by dairy industries, seen through manure disposal and air pollution caused by methane gas. The industry's role in agricultural greenhouse gas emissions has also been noted to implicate environmental consequences. Various measures have been put in place in order to control the amount of phosphorus excreted by dairy livestock. The usage of rBST has also been controversial.
Nutritional management Feed for their cattle is by far one of the largest expenses for dairy producer whether it be provided by the land they graze or crops grown or purchased. Pasture based dairy producers invest much time and effort into maintaining their pastures and thus feed for their cattle. Pasture management techniques such as rotational grazing are common for dairy production. Many large dairies that deliver food to their cattle have a dedicated nutritionist who is responsible for formulating diets with animal health, milk production, and cost efficiency in mind. For maximum productivity diets must be formulated differently depending on the growth rate, milk production, and reproductive status of each animal. Cattle are classified as ruminants (suborder ruminantia belonging to the order artiodactyl) as they are able to acquire nutrients from even low quality plant-based food, thanks mainly to their symbiotic relationship with the microbes that ferment it in a chamber of their stomachs called the rumen. The rumen is a literal micro-ecosystem within each dairy cow. For optimal digestion, the environment of the rumen must be ideal for the microbes. In this way, the job of a ruminant nutritionist is to feed the microbes not the cow. The nutritional requirements of cattle are usually divided into maintenance requirements, which depend on the cow's weight; and milk production requirements, which in turn depend on the volume of milk the cow is producing. The nutritional contents of each available feed are used to formulate a diet that meets all nutritional needs in the most cost effective way. Notably, cattle must be fed a diet high in fiber to maintain a proper environment for the rumen microbes. Farmers typically grow their own forage for their cattle. Crops grown may include corn, alfalfa, timothy, wheat, oats, sorghum and clover. These plants are often processed after harvest to preserve or improve nutrient value and prevent spoiling. Corn, alfalfa, wheat, oats, and sorghum crops are often anaerobically fermented to create silage. Many crops such as alfalfa, timothy, oats, and clover are allowed to dry in the field after cutting before being baled into hay. To increase the energy density of their diet, cattle are commonly fed cereal grains. In many areas of the world, dairy rations also commonly include byproducts from other agricultural sectors. For example, in California cattle are commonly fed almond hulls and cotton seed. Feeding of byproducts can reduce the environmental impact of other agricultural sectors by keeping these materials out of landfills. To meet all of their nutritional requirements cows must eat their entire ration. Unfortunately, much like humans, cattle have their favorite foods. To keep cattle from selectively eating the most desirable parts of the diet, most produces feed a total mixed ration (TMR). In this system all the components of the feed are well mixed in a mixing truck before being delivered to the cattle.
The practice of dairy production in a factory farm environment has been criticized by animal welfare activists. Some of the ethical complaints regarding dairy production cited include how often the dairy cattle must remain pregnant, the separation of calves from their mothers (called cow-calf separation), how dairy cattle are housed, and environmental concerns regarding dairy production. The production of milk requires that the cow be in lactation, which is a result of the cow having given birth to a calf. The cycle of insemination, pregnancy, parturition, and lactation, followed by a "dry" period of about two months of forty-five to fifty days, before calving which allows udder tissue to regenerate. A dry period that falls outside this time frame can result in decreased milk production in subsequent lactation. An important part of the dairy industry is the removal of the calves off the mother's milk after the three days of needed colostrum, allowing for the collection of the milk produced. On some dairies, in order for this to take place, the calves are fed milk replacer, a substitute for the whole milk produced by the cow. Milk replacer is generally a powder, which comes in large bags, and is added to precise amounts of water, and then fed to the calf via bucket, bottle or automated feeder. Milk replacers are classified by three categories: protein source, protein/fat (energy) levels, and medication or additives (e.g. vitamins and minerals). Proteins for the milk replacer come from different sources; the more favorable and more expensive all milk protein (e.g. whey protein- a by-product of the cheese industry) and alternative proteins including soy, animal plasma and wheat gluten. The ideal levels for fat and protein in milk replacer are 10-28% and 18-30%, respectively. The higher the energy levels (fat and protein), the less starter feed (feed which is given to young animals) the animal will consume. Weaning can take place when a calf is consuming at least two pounds of starter feed a day and has been on starter for at least three weeks. Milk replacer has climbed in cost US$15–20 a bag in recent years, so early weaning is economically crucial to effective calf management. Common ailments affecting dairy cows include infectious disease (e.g. mastitis, endometritis and digital dermatitis), metabolic disease (e.g. milk fever and ketosis) and injuries caused by their environment (e.g. hoof and hock lesions). Lameness is commonly considered one of the most significant animal welfare issues for dairy cattle, and is best defined as any abnormality that causes an animal to change its gait. It can be caused by a number of sources, including infections of the hoof tissue (e.g. fungal infections that cause dermatitis) and physical damage causing bruising or lesions (e.g. ulcers or hemorrhage of the hoof). Housing and management features common in modern dairy farms (such as concrete barn floors, limited access to pasture and suboptimal bed-stall design) have been identified as contributing risk factors to infections and injuries. A mobility scoring system is commonly used to assess cattle Lameness combined with scoring systems to assess adjacent risk factors. Greenhouse gas emissions Milk is estimated to have been responsible for 18% of agricultural greenhouse gas emissions in 2014. Market Worldwide There is a great deal of variation in the pattern of dairy production worldwide. Many countries which are large producers consume most of this internally, while others (in particular New Zealand), export a large percentage of their production. Internal consumption is often in the form of liquid milk, while the bulk of international trade is in processed dairy products such as milk powder. The milking of cows was traditionally a labor-intensive operation and still is in less developed countries. Small farms need several people to milk and care for only a few dozen cows, though for many farms these employees have traditionally been the children of the farm family, giving rise to the term "family farm". Advances in technology have mostly led to the radical redefinition of "family farms" in industrialized countries such as Australia, New Zealand, and the United States. With farms of hundreds of cows producing large volumes of milk, the larger and more efficient dairy farms are more able to weather severe changes in milk price and operate profitably, while "traditional" family farms generally do not have the equity or income other larger scale farms do. The common public perception of large corporate farms supplanting smaller ones is generally a misconception, as many small family farms expand to take advantage of economies of scale, and incorporate the business to limit the legal liabilities of the owners and simplify such things as tax management.The transition from family farms to farms with employed staff who carry out the day-to-day management of the herd's animals has changed the farmer's duties and role on the farm. New questions have arisen concerning how the development of bigger farms places greater demands on strategies focused on financial control, leadership, and personnel issues. Before large scale mechanization arrived in the 1950s, keeping a dozen milk cows for the sale of milk was profitable. Now most dairies must have more than one hundred cows being milked at a time in order to be profitable, with other cows and heifers waiting to be "freshened" to join the milking herd. In New Zealand, the average herd size increased from 113 cows in the 1975–76 season to 435 cows in 2018–19 season. Worldwide, the largest cow milk producer is the United States, the largest cow milk exporter is New Zealand, and the largest importer is China.
Veterinary medicine
Q170201 QID OVERLAP 0.800
QID OVERLAP: Q170201 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (19): "affect", "conditions", "control", "diagnosis", "disease", "food", "health", "livestock", "maintain", "management", "research", "roles", "safety", "science", "specialized", "supply", "treatment", "veterinary", "work".
affectconditionscontroldiagnosisdiseasefoodhealthlivestockmaintainmanagementresearchrolessafetysciencespecializedsupplytreatmentveterinarywork
t, diagnosis, and treatment of disease, disorder, and injury in non-human animals. Its scope is wide, covering all animal species, both domesticated and wild, with a wide range of conditions that can affect different species. Veterinary medicine is practiced both with and without professional supervision. Professional care is most often led by a veterinary physician (also known as a veterinarian, veterinary surgeon, or "vet"), but also by paraveterinary workers, including veterinary nurses, veterinary technicians, and veterinary assistants. Other paraprofessionals may have specialized roles, such as animal physiotherapy or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
paraprofessionals may have specialized roles, such as animal physiotherapy or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
Mobile Veterinarians The veterinary profession was massively impacted by the arrival of automobiles. Due to the addition of automobiles, veterinarians can now have a mobile clinic and drive to assist animals in need. This is extremely helpful for large animal veterinarians (who typically specialize in larger animals) due to the issue of transporting the larger animals. There are also small animal veternarians (who typically specialize in smaller animals) who are mobile veterinarians as well, but it is more common in large animal veterinarians. The benefits of being a Mobile Veterinarian are massive, as it allows for the veterinarian to have a clinic and a practice without having a brick-and-mortar location. Veterinary research Veterinary research includes prevention, control, diagnosis, and treatment of diseases of animals, and basic biology, welfare, and care of animals. Veterinary research transcends species boundaries and includes the study of spontaneously occurring and experimentally induced models of both human and animal diseases and research at human-animal interfaces, such as food safety, wildlife and ecosystem health, zoonotic diseases, and public policy.
Alfalfa
Q156106 EXACT TITLE 0.780
QID OVERLAP: Q156106 in biotech_life_sciences (tier:evergreen) and agriculture (tier:branch). | SHARED TOKENS (4): "crop", "important", "livestock", "plant". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
cropimportantlivestockplant
perennial flowering plant in the legume family, Fabaceae. Native to warmer temperate climates, alfalfa has long been cultivated as livestock fodder, perhaps since antiquity. It is an important forage crop in many countries around the world and is used for grazing, hay, and silage. Description Alfalfa is a perennial forage legume which normally lives four to eight years but can live more than 20 years, depending on variety and climate. The plant grows to a height of up to 1 metre (3+1⁄2 feet). Its root system typically grows to a depth of 2–3 m (7–10 ft) depending on subsoil constraints but sometimes grows to a depth of more than 15 m (49 ft) to reach groundwater. The leaves are typically trifoliolate. The plant has clusters of 5–20 florets, which are usually purple but can be blue, yellow, or cream.
Etymology According to Merriam-Webster, English use of alfalfa dates to 1791 and derives from the identical cognate in Spanish, whose origin is al-faṣfaṣa, of an Arabic dialect. Etymology Online suggests that alfalfa derives from the same Spanish cognate (c. 1845), from the Spanish predecessor alfalfez; according to "Iberian sources" the word's root was al-fisfisa, claimed to mean "fresh fodder". Linguist Calvert Watkins suggested that the Arabic word might derive from an Old Iranian compound meaning "horse food". Lucerne, or lucern, as a synonym for alfalfa was borrowed from French, first appearing in written English in 1652. The French word was itself a borrowing from the Occitan luzerno, meaning "glowworm", likely a reference to the bright yellow seeds of some strains of alfalfa. Ecology Alfalfa is considered an insectary plant and may help other crops such as cotton because it harbours predatory and parasitic insects that would protect the other crop if the two were interplanted. Harvesting the alfalfa by mowing the entire crop area destroys the insect population; this can be avoided by mowing in strips so that part of the growth remains. Alfalfa develops extensive taproots that can extend around 6 feet per year in loose soil. This allows the plant to access soil moisture that is not accessible to plants with shallow root systems, making it more resistant to droughts and soil erosion. This depth of root system, and perenniality of crowns that store carbohydrates as an energy reserve, makes it very resilient. Alfalfa exhibits autotoxicity, which means it is difficult for alfalfa seed to grow in existing stands of alfalfa. Therefore, alfalfa fields are recommended to be rotated with other species (for example, corn or wheat) before reseeding. The exact mechanism of autotoxicity is unclear, with medicarpins and phenols both seeming to play a role. The level of autotoxicity in soil depends on soil type (clay soils maintain autotoxicity for longer), cultivar and age of the previous crop. A soil assay can be used to measure autotoxicity.
Alfalfa is considered an insectary plant and may help other crops such as cotton because it harbours predatory and parasitic insects that would protect the other crop if the two were interplanted. Harvesting the alfalfa by mowing the entire crop area destroys the insect population; this can be avoided by mowing in strips so that part of the growth remains. Alfalfa develops extensive taproots that can extend around 6 feet per year in loose soil. This allows the plant to access soil moisture that is not accessible to plants with shallow root systems, making it more resistant to droughts and soil erosion. This depth of root system, and perenniality of crowns that store carbohydrates as an energy reserve, makes it very resilient. Alfalfa exhibits autotoxicity, which means it is difficult for alfalfa seed to grow in existing stands of alfalfa. Therefore, alfalfa fields are recommended to be rotated with other species (for example, corn or wheat) before reseeding. The exact mechanism of autotoxicity is unclear, with medicarpins and phenols both seeming to play a role. The level of autotoxicity in soil depends on soil type (clay soils maintain autotoxicity for longer), cultivar and age of the previous crop. A soil assay can be used to measure autotoxicity.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "home", "idaho", "locally", "major", "manufacturing", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalhomeidaholocallymajormanufacturingpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "northwest", "population", "university", "western".
boisecanyoncollegehomeidahomeridiannampanorthwestpopulationuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in biotech_life_sciences (tier:evergreen) and agriculture (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "capital", "home", "idaho", "local", "northwest", "population", "private".
adaboisecapitalhomeidaholocalnorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Seed testing
Q7445654 QID OVERLAP 0.660
QID OVERLAP: Q7445654 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (8): "commercially", "laboratories", "quality", "research", "seed", "seeds", "sold", "storage".
commerciallylaboratoriesqualityresearchseedseedssoldstorage
ermine if seed storage techniques are functioning. Common seed tests include Germination tests, Viability tests, purity tests and weed tests. The first two are common for scientific research. For commercially sold seed, all four of these tests are done in dedicated laboratories by trained and usually certified analysts. The tests are designed to evaluate the quality of the seed lot being sold. Germination tests A germination test reports the percentage of seed that germinated.
include Germination tests, Viability tests, purity tests and weed tests. The first two are common for scientific research. For commercially sold seed, all four of these tests are done in dedicated laboratories by trained and usually certified analysts. The tests are designed to evaluate the quality of the seed lot being sold. Germination tests A germination test reports the percentage of seed that germinated.
Viability test The Tetrazolium Chloride (TZ) test, often called the quick germination test, is a chemical test used to determine seed viability, and results are usually available within 24 to 48 hours The TZ test differs from a germination test in that the TZ test can give you an early and quick snapshot of seed viability but is not a replacement for the more comprehensive seed germination test. In Canada, the TZ test is not officially recognized by the CFIA (except for western wheatgrass where the TZ result may be added to the germination for a final germination total). In the United States, the TZ test can be used as a replacement for a germination test, although a follow-up germination test is usually recommended. Advantages of the TZ test A rapid evaluation of seed viability. Detect seed weaknesses before they become evident in germination tests. Timely guidance in quality control programs. Properly conducted TZ and germination test results are generally in close agreement and within the range of normal sampling variation. Differences of 3% to 5% may be due to an unavoidable sampling variation error.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallypopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in biotech_life_sciences (tier:branch) and agriculture (tier:evergreen). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in biotech_life_sciences (tier:branch) and agriculture (tier:branch). | SHARED TOKENS (7): "ada", "boise", "capital", "idaho", "making", "meridian", "population".
adaboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
205 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP205 edges
🌿 BRANCH165 edges
0.500
Antibody ↗ Q79460 EXACT TITLE
allowingbecomebodycapacitychainschemicaldeliverydescribesdirectlydiseasedistinctdistributionessentialexampleformfunctionindividuallargeleastless
SHARED TOKENS (31): "allowing", "become", "body", "capacity", "chains", "chemical", "delivery", "describes", "directly", "disease", "distinct", "distribution", "essential", "example", "form", "function", "individual", "large", "least", "less".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Onion ↗ Q23485 EXACT TITLE
annualappliedbasebecomebeginscentralchemicalcropestablishedfoodformgrowingharvestedmultipleoriginalplantpotatoscaleseparatestorage
SHARED TOKENS (22): "annual", "applied", "base", "become", "begins", "central", "chemical", "crop", "established", "food", "form", "growing", "harvested", "multiple", "original", "plant", "potato", "scale", "separate", "storage".... | EXACT TITLE in agriculture: "Onion".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
addressagricultureanotherapprovalbackbreedingchemicalcleancorecropsculturedevelopeddevelopingdevelopmentdirectlyemphasizesengineeringenvironmentalexamplefield
SHARED TOKENS (60): "address", "agriculture", "another", "approval", "back", "breeding", "chemical", "clean", "core", "crops", "culture", "developed", "developing", "development", "directly", "emphasizes", "engineering", "environmental", "example", "field".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
conditionsconsumeddependsdevelopingdirectlydiseaseenvironmentalfoodformgoodhealthmaintainmajorpeoplephysicalrequiredwaterwork
SHARED TOKENS (18): "conditions", "consumed", "depends", "developing", "directly", "disease", "environmental", "food", "form", "good", "health", "maintain", "major", "people", "physical", "required", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
allowinganothercreatedevelopmentessentialexamplefieldinsidelifelightorderphysicalremainssmallstandard
SHARED TOKENS (15): "allowing", "another", "create", "development", "essential", "example", "field", "inside", "life", "light", "order", "physical", "remains", "small", "standard". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelybestboisecapitalcropdistinctearlyeasterneconomyidahoisolatedlaboratorylandmanufacturingmillionnationalnorthwestpeople
SHARED TOKENS (33): "agricultural", "agriculture", "approximately", "best", "boise", "capital", "crop", "distinct", "early", "eastern", "economy", "idaho", "isolated", "laboratory", "land", "manufacturing", "million", "national", "northwest", "people".... | EXACT TITLE in biotech_life_sciences: "Idaho". | EXACT TITLE in agriculture: "Idaho".
0.500
Wheat ↗ EXACT TITLE
contentcropcropsdemanddiseaseessentialfoodglobalimportantindustrylandmajormakingmillionmultiplepopulationproductionqualityrecordsmall
SHARED TOKENS (21): "content", "crop", "crops", "demand", "disease", "essential", "food", "global", "important", "industry", "land", "major", "making", "million", "multiple", "population", "production", "quality", "record", "small".... | EXACT TITLE in agriculture: "Wheat".
0.500
Hay ↗ Q336989 EXACT TITLE
accesscannotcattlecropsexamplefieldhealthincreaselargelivestockmakingprocessingproductionsmalleryield
SHARED TOKENS (15): "access", "cannot", "cattle", "crops", "example", "field", "health", "increase", "large", "livestock", "making", "processing", "production", "smaller", "yield". | EXACT TITLE in agriculture: "Hay".
0.500
adaboisecanyondesignatedhomeidahomeridianmetronampanearlynorthwestpercentpopulationsectiontreasurevalley
SHARED TOKENS (16): "ada", "boise", "canyon", "designated", "home", "idaho", "meridian", "metro", "nampa", "nearly", "northwest", "percent", "population", "section", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
0.500
approvalcannotcontractcostsdevelopingdevelopmententryexpertiseforminstitutionsinternationallargelifemaintainmanagementmarketsneedprovidequalityreal
SHARED TOKENS (30): "approval", "cannot", "contract", "costs", "developing", "development", "entry", "expertise", "form", "institutions", "international", "large", "life", "maintain", "management", "markets", "need", "provide", "quality", "real".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotcertificationchemicalconsumercreatesdeliverydevelopeddiseaseenforcementexportfoodgrowthguidelineshandlinghealthindustryinspectionlessmanagementmarket
SHARED TOKENS (30): "cannot", "certification", "chemical", "consumer", "creates", "delivery", "developed", "disease", "enforcement", "export", "food", "growth", "guidelines", "handling", "health", "industry", "inspection", "less", "management", "market".... | EXACT TITLE in biotech_life_sciences: "Food safety".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingdevelopeddevelopmentformgovernmentgrowthguidelinesindustriallandland-uselocalorderplacesplanningpolicypropertyregulationsregulatoryrulesscale
SHARED TOKENS (24): "allowing", "developed", "development", "form", "government", "growth", "guidelines", "industrial", "land", "land-use", "local", "order", "places", "planning", "policy", "property", "regulations", "regulatory", "rules", "scale".... | EXACT TITLE in biotech_life_sciences: "Zoning".
0.500
agenciesagencycomplexconditionscropdirectlyengineeredengineeringexampleisolatedmarketoutsideperformanceplantproductproductionproductsratherregulatoryresearch
SHARED TOKENS (27): "agencies", "agency", "complex", "conditions", "crop", "directly", "engineered", "engineering", "example", "isolated", "market", "outside", "performance", "plant", "product", "production", "products", "rather", "regulatory", "research".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
appearsappliedbetterchangeconditionsdatadecisionsdiseasedistributionengineeringenvironmentalexamplesfunctionhealthhistoricallyknowledgemajorpatternspeopleplant
SHARED TOKENS (31): "appears", "applied", "better", "change", "conditions", "data", "decisions", "disease", "distribution", "engineering", "environmental", "examples", "function", "health", "historically", "knowledge", "major", "patterns", "people", "plant".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
actagencyenvironmentalfederalfoodlawprivateprotectionpublicqualityrequiredstandardssystemsystemswater
SHARED TOKENS (15): "act", "agency", "environmental", "federal", "food", "law", "private", "protection", "public", "quality", "required", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeagainstbecomebodycharacteristicschemicalearlyembeddedessentialfieldshealthimportantlatermaintainphysicalratherrecognitionsmallsystemsystems
SHARED TOKENS (22): "active", "against", "become", "body", "characteristics", "chemical", "early", "embedded", "essential", "fields", "health", "important", "later", "maintain", "physical", "rather", "recognition", "small", "system", "systems".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
behaviorbetterchemicalcomplexdescribeddiseaseearlyfieldfunctionlaboratorylevelsmodelphysicalprocessesresearchsciencestructuresystemswork
SHARED TOKENS (19): "behavior", "better", "chemical", "complex", "described", "disease", "early", "field", "function", "laboratory", "levels", "model", "physical", "processes", "research", "science", "structure", "systems", "work". | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Virology ↗ Q7215 EXACT TITLE
agricultureappliedculturediseasedistinctfieldhealthlaboratorymicrobiologypathologyplantresearchsciencesourcestructureveterinary
SHARED TOKENS (16): "agriculture", "applied", "culture", "disease", "distinct", "field", "health", "laboratory", "microbiology", "pathology", "plant", "research", "science", "source", "structure", "veterinary". | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
annualanotherbecomebusinesscapitalcontroldecisionsdevelopmentdisposalearlyentityfinancefinancingfirmsformgrowthhistoryinformationinstitutionalmarket
SHARED TOKENS (39): "annual", "another", "become", "business", "capital", "control", "decisions", "development", "disposal", "early", "entity", "finance", "financing", "firms", "form", "growth", "history", "information", "institutional", "market".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
approvalbehaviorboardcommitteedesignatedfieldsformhealthinstitutioninstitutionalinternationallegallymaterialsnationalpeoplephysicalprivateprojectsregulationsrelated
SHARED TOKENS (26): "approval", "behavior", "board", "committee", "designated", "fields", "form", "health", "institution", "institutional", "international", "legally", "materials", "national", "people", "physical", "private", "projects", "regulations", "related".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
agriculturalanotherbodychemicaldisposalenvironmentfacilityindustrialindustrymunicipalplantprocessesreturntreatedtreatmentwater
SHARED TOKENS (16): "agricultural", "another", "body", "chemical", "disposal", "environment", "facility", "industrial", "industry", "municipal", "plant", "processes", "return", "treated", "treatment", "water". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
approximatelybehaviorbuiltcomplexcurrentdepartmenteasternengineeringenvironmentalfacilitiesfacilityfallshistoricallyhistoryidahoknowledgelablaboratorieslaboratorynational
SHARED TOKENS (25): "approximately", "behavior", "built", "complex", "current", "department", "eastern", "engineering", "environmental", "facilities", "facility", "falls", "historically", "history", "idaho", "knowledge", "lab", "laboratories", "laboratory", "national".... | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
businessescreatedevelopedeconomicgoodindividualinformationlandlawlegallowermodernoriginalpeopleproblemsprocessesproducerspropertyrightssystems
SHARED TOKENS (20): "businesses", "create", "developed", "economic", "good", "individual", "information", "land", "law", "legal", "lower", "modern", "original", "people", "problems", "processes", "producers", "property", "rights", "systems". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
actappliedassociationauthoritybehaviorbestcentralchangechangescommunityconditionsconflictsconservationcostsdependsdevelopmentdistrictseconomicenvironmentalessential
SHARED TOKENS (41): "act", "applied", "association", "authority", "behavior", "best", "central", "change", "changes", "community", "conditions", "conflicts", "conservation", "costs", "depends", "development", "districts", "economic", "environmental", "essential".... | EXACT TITLE in agriculture: "Land-use planning".
0.500
Frozen food ↗ Q751728 EXACT TITLE
agencychangeearlyfoodgrowthimportantindustrymodernpossibleprocessesproductqualityreportedresourcessmallerstandardsstructuresupportingtechnology
SHARED TOKENS (19): "agency", "change", "early", "food", "growth", "important", "industry", "modern", "possible", "processes", "product", "quality", "reported", "resources", "smaller", "standards", "structure", "supporting", "technology". | EXACT TITLE in agriculture: "Frozen food".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomechemicalcommunityhealthinformationinstitutionallinksmodernproductsrelatedrolessafetysciencesellsettingsupplieswork
SHARED TOKENS (17): "become", "chemical", "community", "health", "information", "institutional", "links", "modern", "products", "related", "roles", "safety", "science", "sell", "setting", "supplies", "work". | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
agenciesagriculturalcropsdevelopmentdistrictseducationexamplesfarmlandfarmsgovernmentgrowinglandlesslevelslivestocklocalnationaloperationalplanningpolicy
SHARED TOKENS (26): "agencies", "agricultural", "crops", "development", "districts", "education", "examples", "farmland", "farms", "government", "growing", "land", "less", "levels", "livestock", "local", "national", "operational", "planning", "policy".... | EXACT TITLE in agriculture: "Farmland preservation".
0.500
adaapproximatelyboisecanyoncapacityfarmlandidahoirrigationmultipleriversystemtreasurevalleywaterwestern
SHARED TOKENS (15): "ada", "approximately", "boise", "canyon", "capacity", "farmland", "idaho", "irrigation", "multiple", "river", "system", "treasure", "valley", "water", "western". | EXACT TITLE in agriculture: "New York Canal".
0.500
actagenciescontrolcontrolleddecisionsdistributionenforcementfederalfoodinternationalisolatedlawnationalpolicyrequiredsingletitletreatment
SHARED TOKENS (18): "act", "agencies", "control", "controlled", "decisions", "distribution", "enforcement", "federal", "food", "international", "isolated", "law", "national", "policy", "required", "single", "title", "treatment". | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
activecontroldevelopmentexamplesexternalfieldformhundredslabmeansmixpracticalprocessesscienceseparatesinglesmallsupplysystemsystems
SHARED TOKENS (22): "active", "control", "development", "examples", "external", "field", "form", "hundreds", "lab", "means", "mix", "practical", "processes", "science", "separate", "single", "small", "supply", "system", "systems".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
addressagriculturalappliedchemicalchemicalscontrolcreatediseaseengineeredengineeringequipmentexamplesexpertiseimproveknowledgematerialsprocessesproductsresearchresearchers
SHARED TOKENS (25): "address", "agricultural", "applied", "chemical", "chemicals", "control", "create", "disease", "engineered", "engineering", "equipment", "examples", "expertise", "improve", "knowledge", "materials", "processes", "products", "research", "researchers".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsfieldsindustrialinternationallawlegalmakingnationalorderprivatepropertyprotectionpublicratherrequirementsrightstechnology
SHARED TOKENS (17): "agreements", "fields", "industrial", "international", "law", "legal", "making", "national", "order", "private", "property", "protection", "public", "rather", "requirements", "rights", "technology". | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
agriculturalbettercomplexdatadevelopmentdiseaseengineeringfieldimportantinformationlargeprocessingprogrammingrolesciencesinglestatisticssystems
SHARED TOKENS (18): "agricultural", "better", "complex", "data", "development", "disease", "engineering", "field", "important", "information", "large", "processing", "programming", "role", "science", "single", "statistics", "systems". | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anotherbodydevelopmentengineeredengineeringfieldfunctiongrowthhistorylargematerialmaterialsproductssciencesystemsystems
SHARED TOKENS (16): "another", "body", "development", "engineered", "engineering", "field", "function", "growth", "history", "large", "material", "materials", "products", "science", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondcharacteristicsenvironmentharvestedhomeindustriallandlayermajormaterialmaterialsregionrelatedsourcewateryield
SHARED TOKENS (16): "beyond", "characteristics", "environment", "harvested", "home", "industrial", "land", "layer", "major", "material", "materials", "region", "related", "source", "water", "yield". | EXACT TITLE in agriculture: "Aquifer".
0.500
actagencybureaucommunitycontrolleddepartmentdistributionenforcementestablishedfederalgovernmentintelligencelawnationalprotectionratherreports
SHARED TOKENS (17): "act", "agency", "bureau", "community", "controlled", "department", "distribution", "enforcement", "established", "federal", "government", "intelligence", "law", "national", "protection", "rather", "reports". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
approvalauthoritybecomecentercenterscentralcommitteecontractcostsdatadevelopmentgeneratehealthlablaboratorymultiplepercentproductrequireresearch
SHARED TOKENS (29): "approval", "authority", "become", "center", "centers", "central", "committee", "contract", "costs", "data", "development", "generate", "health", "lab", "laboratory", "multiple", "percent", "product", "require", "research".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
agriculturalagriculturechangeschemicalcomplexenvironmentalfoodformhomeimportantindustriallevelsmakingneedsphysicalprocessingproductproductsrequiredroles
SHARED TOKENS (20): "agricultural", "agriculture", "changes", "chemical", "complex", "environmental", "food", "form", "home", "important", "industrial", "levels", "making", "needs", "physical", "processing", "product", "products", "required", "roles". | EXACT TITLE in biotech_life_sciences: "Food processing". | EXACT TITLE in agriculture: "Food processing".
0.500
agriculturalappliedcentralchemicaldevelopmentdirectlyearlyfieldfoodlifematerialsmicrobiologymodernpackagingpracticesprocessesprocessingproductionproductssafety
SHARED TOKENS (22): "agricultural", "applied", "central", "chemical", "development", "directly", "early", "field", "food", "life", "materials", "microbiology", "modern", "packaging", "practices", "processes", "processing", "production", "products", "safety".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
Soil science ↗ EXACT TITLE
chemicaldiversityfoodgrowingknowledgelandmanagementphysicalplanningpopulationpossibleregionalrelatedsciencesoilwater
SHARED TOKENS (16): "chemical", "diversity", "food", "growing", "knowledge", "land", "management", "physical", "planning", "population", "possible", "regional", "related", "science", "soil", "water". | EXACT TITLE in agriculture: "Soil science".
0.500
agriculturalagriculturecropdataexamplesguidelinesirrigationlandlivestockmembersnationalneedsprocessingsizestructure
SHARED TOKENS (15): "agricultural", "agriculture", "crop", "data", "examples", "guidelines", "irrigation", "land", "livestock", "members", "national", "needs", "processing", "size", "structure". | EXACT TITLE in agriculture: "Census of agriculture".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciescanyoncentralcommercialconstructioncontrolculturedevelopedeasternfallsfarmlandhistoryidahoimportantirrigationlargelowermajornationalnear
SHARED TOKENS (34): "agencies", "canyon", "central", "commercial", "construction", "control", "culture", "developed", "eastern", "falls", "farmland", "history", "idaho", "important", "irrigation", "large", "lower", "major", "national", "near".... | EXACT TITLE in agriculture: "Snake River".
0.500
currentdevelopmentdiagnosisengineeringequipmentfieldfieldsgrowthhealthindustrymaintenancemakingmanagementrelevantresearchrolestandardstreatmentwork
SHARED TOKENS (19): "current", "development", "diagnosis", "engineering", "equipment", "field", "fields", "growth", "health", "industry", "maintenance", "making", "management", "relevant", "research", "role", "standards", "treatment", "work". | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
Cattle ↗ Q830 EXACT TITLE
cattlecentraldairyfoundgloballargelivestockmembersmillionmodernprimarilyproductsseparatesmallwestern
SHARED TOKENS (15): "cattle", "central", "dairy", "found", "global", "large", "livestock", "members", "million", "modern", "primarily", "products", "separate", "small", "western". | EXACT TITLE in biotech_life_sciences: "Cattle". | EXACT TITLE in agriculture: "Cattle".
0.500
Livestock ↗ Q103459 EXACT TITLE
agriculturalagriculturebreedingcattlecommercialdairyeconomicenvironmenthealthlaborlivestockmaintenancemajormaterialmilkmodernpracticesproductsprovidepublic
SHARED TOKENS (25): "agricultural", "agriculture", "breeding", "cattle", "commercial", "dairy", "economic", "environment", "health", "labor", "livestock", "maintenance", "major", "material", "milk", "modern", "practices", "products", "provide", "public".... | EXACT TITLE in biotech_life_sciences: "Livestock". | EXACT TITLE in agriculture: "Livestock".
0.500
backchangescriticaldevelopmentdiseaseengineeringexamplesfieldinterfacelowermajorphysicalrolesciencestructuretissueswork
SHARED TOKENS (17): "back", "changes", "critical", "development", "disease", "engineering", "examples", "field", "interface", "lower", "major", "physical", "role", "science", "structure", "tissues", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
actbackcomplexcontrolsengineeringestablishedexamplesfederalfieldfoodglobalincreaselaterlifemajormarketmodernorderoversightrequired
SHARED TOKENS (25): "act", "back", "complex", "controls", "engineering", "established", "examples", "federal", "field", "food", "global", "increase", "later", "life", "major", "market", "modern", "order", "oversight", "required".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
boisebusinesscollegeeconomicseducationengineeringhealthidahoinstitutionmastermillionprogramprogramspublicreportedresearchuniversitiesuniversity
SHARED TOKENS (18): "boise", "business", "college", "economics", "education", "engineering", "health", "idaho", "institution", "master", "million", "program", "programs", "public", "reported", "research", "universities", "university". | EXACT TITLE in biotech_life_sciences: "Boise State University". | EXACT TITLE in agriculture: "Boise State University".
0.500
Pathology ↗ Q7208 EXACT TITLE
changesconditionsconsequencesdevelopmentdiagnosisdiseasedistinctexamplefieldfieldsmajormodernpathologyphysicalpracticesprocessesresearchsystemstreatment
SHARED TOKENS (19): "changes", "conditions", "consequences", "development", "diagnosis", "disease", "distinct", "example", "field", "fields", "major", "modern", "pathology", "physical", "practices", "processes", "research", "systems", "treatment". | EXACT TITLE in biotech_life_sciences: "Pathology". | EXACT TITLE in agriculture: "Pathology".
0.500
appliedchangeschemicaldevelopmentdiseaseengineeringfieldformhealthimportantinterfaceknowledgelaboratorieslaboratorylaterlightorderpathologyprovideproviders
SHARED TOKENS (29): "applied", "changes", "chemical", "development", "disease", "engineering", "field", "form", "health", "important", "interface", "knowledge", "laboratories", "laboratory", "later", "light", "order", "pathology", "provide", "providers".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
academiccommercialdatadevelopmentemphasisentireexamplefieldgovernmentimprovementincreaselablaboratorieslaboratorylarge-scaleprocessesprogramprogramsqualityreduce
SHARED TOKENS (27): "academic", "commercial", "data", "development", "emphasis", "entire", "example", "field", "government", "improvement", "increase", "lab", "laboratories", "laboratory", "large-scale", "processes", "program", "programs", "quality", "reduce".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
Canal ↗ Q12284 EXACT TITLE
builtcontrolcreatecurrentengineeredexampleexternalincreaseirrigationlevelsmanagementmodernrequiringresourcesriversourcesupplyvalleywater
SHARED TOKENS (19): "built", "control", "create", "current", "engineered", "example", "external", "increase", "irrigation", "levels", "management", "modern", "requiring", "resources", "river", "source", "supply", "valley", "water". | EXACT TITLE in agriculture: "Canal".
0.500
Pomology ↗ Q35911 EXACT TITLE
agriculturalappliedconservationcontrolcostscropsdevelopmentdiseasegrowingimprovementirrigationmanagementpestpracticesproductionqualityresearchsciencetraining
SHARED TOKENS (19): "agricultural", "applied", "conservation", "control", "costs", "crops", "development", "disease", "growing", "improvement", "irrigation", "management", "pest", "practices", "production", "quality", "research", "science", "training". | EXACT TITLE in agriculture: "Pomology".
0.500
actagricultureapproximatelyboardboisebureaucapacitycenterconstructionfallshomeidahoirrigationlaborlawmaterialsnationalprojectsprovideriver
SHARED TOKENS (25): "act", "agriculture", "approximately", "board", "boise", "bureau", "capacity", "center", "construction", "falls", "home", "idaho", "irrigation", "labor", "law", "materials", "national", "projects", "provide", "river".... | EXACT TITLE in agriculture: "Anderson Ranch Dam".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureappliedbecomechemicalcontrolcropdependsdevelopeddiagnosisdiseasedistinctengineeringenvironmentexampleexplainingfieldsfunctionhealthindustriallife
SHARED TOKENS (36): "agriculture", "applied", "become", "chemical", "control", "crop", "depends", "developed", "diagnosis", "disease", "distinct", "engineering", "environment", "example", "explaining", "fields", "function", "health", "industrial", "life".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
academicadaboardboisecanyoncollegecommunitydevelopmenteasterneducationidaholargenampapopulationprogramspublicreportedresidentssouthwesttransfer
SHARED TOKENS (23): "academic", "ada", "board", "boise", "canyon", "college", "community", "development", "eastern", "education", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents", "southwest", "transfer".... | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
0.500
actagencyauthoritycontrolcurrentdepartmentdirectlyfederalfeedfieldfoodhealthlaboratorieslaboratoryproductspublicregulationsrelatedreportssafety
SHARED TOKENS (23): "act", "agency", "authority", "control", "current", "department", "directly", "federal", "feed", "field", "food", "health", "laboratories", "laboratory", "products", "public", "regulations", "related", "reports", "safety".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
Hops ↗ Q3214940 EXACT TITLE
commercialcommerciallydocumentsearlyfieldlaterlessmeansplantprimarilyproductionseedseparatesourcevarieties
SHARED TOKENS (15): "commercial", "commercially", "documents", "early", "field", "later", "less", "means", "plant", "primarily", "production", "seed", "separate", "source", "varieties". | EXACT TITLE in agriculture: "Hops".
0.500
Potato ↗ Q10998 EXACT TITLE
becomebreedingcomplexconsumedcropeasternessentialexpansionfoodfoundlightplantpotatoproductionregionremainsshowsinglesupplyvarieties
SHARED TOKENS (20): "become", "breeding", "complex", "consumed", "crop", "eastern", "essential", "expansion", "food", "found", "light", "plant", "potato", "production", "region", "remains", "show", "single", "supply", "varieties". | EXACT TITLE in biotech_life_sciences: "Potato". | EXACT TITLE in agriculture: "Potato".
0.500
againstagriculturalagricultureconditionsconsequencescontrolcontrolscropsdevelopedenterenvironmentfoodhomeimportantlandlivestockpeoplepest
SHARED TOKENS (18): "against", "agricultural", "agriculture", "conditions", "consequences", "control", "controls", "crops", "developed", "enter", "environment", "food", "home", "important", "land", "livestock", "people", "pest". | EXACT TITLE in biotech_life_sciences: "Pest (organism)". | EXACT TITLE in agriculture: "Pest (organism)".
0.500
appliedcapacitycapitalcostsdetailsdirectlyearlyformgrowthimportantinformationinstitutionallegalmarketprivateprovidepublicsellsoldvalue
SHARED TOKENS (20): "applied", "capacity", "capital", "costs", "details", "directly", "early", "form", "growth", "important", "information", "institutional", "legal", "market", "private", "provide", "public", "sell", "sold", "value". | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
academiccentercentralcertificationcriticaleducationemphasisinstitutionsknowledgelifemembersprivateproductionpublicratherresearchsitestransferuniversitiesuniversity
SHARED TOKENS (21): "academic", "center", "central", "certification", "critical", "education", "emphasis", "institutions", "knowledge", "life", "members", "private", "production", "public", "rather", "research", "sites", "transfer", "universities", "university".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.500
Fertilizer ↗ Q83323 EXACT TITLE
accumulationagriculturalagricultureappliedcapacitychemicalconsequencescropdevelopeddistinctenvironmentalequipmentfertilizerfoodglobalgrowthharvestedhistoricallyimportantincrease
SHARED TOKENS (39): "accumulation", "agricultural", "agriculture", "applied", "capacity", "chemical", "consequences", "crop", "developed", "distinct", "environmental", "equipment", "fertilizer", "food", "global", "growth", "harvested", "historically", "important", "increase".... | EXACT TITLE in biotech_life_sciences: "Fertilizer". | EXACT TITLE in agriculture: "Fertilizer".
0.480
Cleanroom ↗ Q794827 EXACT TITLE
cleanengineeredfacilitiesindustrialinsidemanufacturingmaterialmaterialsprocessesproductionresearchsizesmallerwork
SHARED TOKENS (14): "clean", "engineered", "facilities", "industrial", "inside", "manufacturing", "material", "materials", "processes", "production", "research", "size", "smaller", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.480
Milk ↗ Q8495 EXACT TITLE
againstagriculturalbasecattledairyfarmsfoodmilkmillionpeopleproductproductssourcesystem
SHARED TOKENS (14): "against", "agricultural", "base", "cattle", "dairy", "farms", "food", "milk", "million", "people", "product", "products", "source", "system". | EXACT TITLE in biotech_life_sciences: "Milk". | EXACT TITLE in agriculture: "Milk".
0.480
academicdepartmenthealthinstitutionalinstitutionsnearlyoversightpublicresearchresearchersrightsrulestandardtitle
SHARED TOKENS (14): "academic", "department", "health", "institutional", "institutions", "nearly", "oversight", "public", "research", "researchers", "rights", "rule", "standard", "title". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.480
cropdependsdirectlyecosystemenvironmentgrowthhealthimprovementmanagementplantpossibleproductionsoilstatus
SHARED TOKENS (14): "crop", "depends", "directly", "ecosystem", "environment", "growth", "health", "improvement", "management", "plant", "possible", "production", "soil", "status". | EXACT TITLE in agriculture: "Soil health".
0.460
cannotcommunitydemandexamplefieldformlarge-scalemanufacturersmanufacturingneedsprovideregulationsrising
SHARED TOKENS (13): "cannot", "community", "demand", "example", "field", "form", "large-scale", "manufacturers", "manufacturing", "needs", "provide", "regulations", "rising". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.460
Vaccine ↗ Q134808 EXACT TITLE
activeagainstdescribeddevelopeddevelopmentdiseasehealthproductionreportssafetysciencesystemtitle
SHARED TOKENS (13): "active", "against", "described", "developed", "development", "disease", "health", "production", "reports", "safety", "science", "system", "title". | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.460
actauthoritycontrolfederalfoodformlawmembersnationalproductregulationsrequirementssafety
SHARED TOKENS (13): "act", "authority", "control", "federal", "food", "form", "law", "members", "national", "product", "regulations", "requirements", "safety". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.460
Microbiology ↗ Q7193 EXACT TITLE
complexculturecurrentdevelopedexamplelesslifematerialmeansmicrobiologymilksmallwork
SHARED TOKENS (13): "complex", "culture", "current", "developed", "example", "less", "life", "material", "means", "microbiology", "milk", "small", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology". | EXACT TITLE in agriculture: "Microbiology".
0.460
agricultureboisebureaudesignatedengineeringidahoirrigationnationalprovideriverupstreamwaterwestern
SHARED TOKENS (13): "agriculture", "boise", "bureau", "designated", "engineering", "idaho", "irrigation", "national", "provide", "river", "upstream", "water", "western". | EXACT TITLE in agriculture: "Arrowrock Dam".
0.460
agriculturalcharacteristicscropcropsculturedevelopedengineeringgrowthharvestedproductsresistancesciencesize
SHARED TOKENS (13): "agricultural", "characteristics", "crop", "crops", "culture", "developed", "engineering", "growth", "harvested", "products", "resistance", "science", "size". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.460
affectchemicalcostsformlaboratorylatermaterialproductionresultseparatesitessmallersystem
SHARED TOKENS (13): "affect", "chemical", "costs", "form", "laboratory", "later", "material", "production", "result", "separate", "sites", "smaller", "system". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.450
Simplot ↗ Q3484788 EXACT TITLE
agribusinessagricultureboiseheadquarteredidaho
SHARED TOKENS (5): "agribusiness", "agriculture", "boise", "headquartered", "idaho". | URL->B (1): https://www.simplot.com/company. | EXACT TITLE in agriculture: "Simplot".
0.450
govgovernmenthealthnationaltrials
SHARED TOKENS (5): "gov", "government", "health", "national", "trials". | URL->A (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
authorizedcertificationexporthealthmodelnationalplantproductsprotectionpublicrequirementsspecified
SHARED TOKENS (12): "authorized", "certification", "export", "health", "model", "national", "plant", "products", "protection", "public", "requirements", "specified". | EXACT TITLE in agriculture: "Phytosanitary certification".
0.440
appliedbecomechemicalcomplexentireexamplefieldfieldsfunctionidentitymechanismstructure
SHARED TOKENS (12): "applied", "become", "chemical", "complex", "entire", "example", "field", "fields", "function", "identity", "mechanism", "structure". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.440
Agronomy ↗ Q173113 EXACT TITLE
agriculturechemicalsconservationeconomicsfieldfoodlandplantresearchsciencesoiltechnology
SHARED TOKENS (12): "agriculture", "chemicals", "conservation", "economics", "field", "food", "land", "plant", "research", "science", "soil", "technology". | EXACT TITLE in agriculture: "Agronomy".
0.420
Toxicology ↗ Q7218 EXACT TITLE
academicchemicalenvironmentexamplefieldpracticesrelationshipresearchtreatingtreatmentturn
SHARED TOKENS (11): "academic", "chemical", "environment", "example", "field", "practices", "relationship", "research", "treating", "treatment", "turn". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.420
Pesticide ↗ Q131656 EXACT TITLE
agriculturalapproximatelychemicalcontrolcropdiseaseincreaseplantproductspropertyprotection
SHARED TOKENS (11): "agricultural", "approximately", "chemical", "control", "crop", "disease", "increase", "plant", "products", "property", "protection". | EXACT TITLE in biotech_life_sciences: "Pesticide". | EXACT TITLE in agriculture: "Pesticide".
0.400
agribusinessagriculturalagriculturecenterfacilityfoodprocessorsproductionresearchwork
SHARED TOKENS (10): "agribusiness", "agricultural", "agriculture", "center", "facility", "food", "processors", "production", "research", "work". | EXACT TITLE in biotech_life_sciences: "Agricultural experiment station".
0.400
Cell biology ↗ Q7141 EXACT TITLE
behaviorcultureessentialfieldsfunctionlifemicrobiologyresearchstructurework
SHARED TOKENS (10): "behavior", "culture", "essential", "fields", "function", "life", "microbiology", "research", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.400
agencyboisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulations
SHARED TOKENS (10): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.400
Crop insurance ↗ EXACT TITLE
againstagriculturalcropcropsgovernmentinsurancepricesproducersrelatedrevenue
SHARED TOKENS (10): "against", "agricultural", "crop", "crops", "government", "insurance", "prices", "producers", "related", "revenue". | EXACT TITLE in agriculture: "Crop insurance".
0.400
Biosensor ↗ Q669391 EXACT TITLE
anotherchemicalconnectsengineeringgeneratematerialpossibleprimarilyprocessorsworks
SHARED TOKENS (10): "another", "chemical", "connects", "engineering", "generate", "material", "possible", "primarily", "processors", "works". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.400
fallsidahomeridianpercentprogramspublicresearchtwinuniversitiesuniversity
SHARED TOKENS (10): "falls", "idaho", "meridian", "percent", "programs", "public", "research", "twin", "universities", "university". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
0.380
agencydepartmentdevelopmenteconomicidahoinsurancelaborprocessestechnology
SHARED TOKENS (9): "agency", "department", "development", "economic", "idaho", "insurance", "labor", "processes", "technology". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.380
chemicalcontrolengineeringfieldfoundmaterialordersciencesystems
SHARED TOKENS (9): "chemical", "control", "engineering", "field", "found", "material", "order", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.380
boisefoodheadquarteredidahopotatoprocessingprocessorsproducersproducts
SHARED TOKENS (9): "boise", "food", "headquartered", "idaho", "potato", "processing", "processors", "producers", "products". | EXACT TITLE in agriculture: "Lamb Weston".
0.360
Hazardous waste ↗ EXACT TITLE
environmenthealthinternationallocalmaterialsmillionnationalproduces
SHARED TOKENS (8): "environment", "health", "international", "local", "materials", "million", "national", "produces". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.360
associationcentersfirmsindustrialindustryrelatedresearchserves
SHARED TOKENS (8): "association", "centers", "firms", "industrial", "industry", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.360
Silage ↗ EXACT TITLE
cattlecropsentirelocalplantpointstoragetechnology
SHARED TOKENS (8): "cattle", "crops", "entire", "local", "plant", "point", "storage", "technology". | EXACT TITLE in agriculture: "Silage".
0.360
Forage ↗ Q13377214 EXACT TITLE
annualcropcropsdirectlyhistoricallylivestockmaterialplant
SHARED TOKENS (8): "annual", "crop", "crops", "directly", "historically", "livestock", "material", "plant". | EXACT TITLE in biotech_life_sciences: "Forage".
0.360
actcodecodifiedfederalhealthlawpublictitle
SHARED TOKENS (8): "act", "code", "codified", "federal", "health", "law", "public", "title". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.360
irrigationlawlegalphysicalriversourcesystemswater
SHARED TOKENS (8): "irrigation", "law", "legal", "physical", "river", "source", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Water right". | EXACT TITLE in agriculture: "Water right".
0.360
facilityinformationlaboratorymaterialmaterialspeopleresearchwritten
SHARED TOKENS (8): "facility", "information", "laboratory", "material", "materials", "people", "research", "written". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.340
agriculturalidaholandmajornorthwestprimarilyriver
SHARED TOKENS (7): "agricultural", "idaho", "land", "major", "northwest", "primarily", "river". | EXACT TITLE in agriculture: "Snake River Plain".
0.340
Sugar beet ↗ Q151964 EXACT TITLE
breedingcoldcommerciallymillionplantproducersproduction
SHARED TOKENS (7): "breeding", "cold", "commercially", "million", "plant", "producers", "production". | EXACT TITLE in agriculture: "Sugar beet".
0.340
federalimprovementlaboratoryregulatoryresearchstandardstrials
SHARED TOKENS (7): "federal", "improvement", "laboratory", "regulatory", "research", "standards", "trials". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.320
applieddatafieldrelationshipssciencesystems
SHARED TOKENS (6): "applied", "data", "field", "relationships", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.320
academicagriculturalagricultureeconomicfieldscience
SHARED TOKENS (6): "academic", "agricultural", "agriculture", "economic", "field", "science". | EXACT TITLE in biotech_life_sciences: "Agricultural science".
0.320
behaviordescribedindividualsciencestatisticssystem
SHARED TOKENS (6): "behavior", "described", "individual", "science", "statistics", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.320
Entomology ↗ EXACT TITLE
describedfieldhistoricallylessmillionrelationships
SHARED TOKENS (6): "described", "field", "historically", "less", "million", "relationships". | EXACT TITLE in agriculture: "Entomology".
0.310
federalgovernmenthealthmillionnationalrelatedreportsworks
SHARED TOKENS (8): "federal", "government", "health", "million", "national", "related", "reports", "works". | URL->A (1): http://clinicaltrials.gov/.
0.300
agriculturalagricultureassociationboardbuiltchemicalcommunitycontrolcontrolleddairydevelopingeconomicexamplesfarmsfoodgovernmentimportantjointlylandmaking
SHARED TOKENS (32): "agricultural", "agriculture", "association", "board", "built", "chemical", "community", "control", "controlled", "dairy", "developing", "economic", "examples", "farms", "food", "government", "important", "jointly", "land", "making"....
0.300
appliedbeyondcommercialdatadependentdevelopmentenvironmentalequipmentevenexamplefacilitieshistoricallyinformationinfrastructurelaboratorymanagementmanufacturingmarketsmodernmultiple
SHARED TOKENS (29): "applied", "beyond", "commercial", "data", "dependent", "development", "environmental", "equipment", "even", "example", "facilities", "historically", "information", "infrastructure", "laboratory", "management", "manufacturing", "markets", "modern", "multiple"....
0.300
appliedbusinesscapitalcenterscorporatedevelopmentemploymentgovernmentinstitutionslocalmixplacesprivatepublicrelatedresearchresultrevenuesupportingtechnology
SHARED TOKENS (22): "applied", "business", "capital", "centers", "corporate", "development", "employment", "government", "institutions", "local", "mix", "places", "private", "public", "related", "research", "result", "revenue", "supporting", "technology"....
0.300
anotherappliedauthorityauthorizedboardcapacitycodifiedcommitteeconditionsdecisionsexampleformindividualinformationinstitutionalinternationalissuelawlegallevels
SHARED TOKENS (37): "another", "applied", "authority", "authorized", "board", "capacity", "codified", "committee", "conditions", "decisions", "example", "form", "individual", "information", "institutional", "international", "issue", "law", "legal", "levels"....
0.300
actapprovalboardcommercialcontroldatadistributionfoodinformationinstitutionalknowledgelegallyneedorderqualityreportsrequirerequiredrequirementsrequires
SHARED TOKENS (27): "act", "approval", "board", "commercial", "control", "data", "distribution", "food", "information", "institutional", "knowledge", "legally", "need", "order", "quality", "reports", "require", "required", "requirements", "requires"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
bodycomplexitydistinctentirefieldfoodimportantlargelarge-scalerequirementsscalesinglespecificallystructuresystem
SHARED TOKENS (15): "body", "complexity", "distinct", "entire", "field", "food", "important", "large", "large-scale", "requirements", "scale", "single", "specifically", "structure", "system".
0.300
additionalaffectagriculturalagriculturebeyondcapturecentralchemicalscontentcreatecriticalcropdatadecisionsdiagnosisdirectlydistributionfertilizerfieldfields
SHARED TOKENS (46): "additional", "affect", "agricultural", "agriculture", "beyond", "capture", "central", "chemicals", "content", "create", "critical", "crop", "data", "decisions", "diagnosis", "directly", "distribution", "fertilizer", "field", "fields"....
0.300
Protected area ↗ Q473972 KW CROSS HIGH
approximatelybeyondcannotconservationgloballandlocalmaintainmultiplenationalpercentprocessesproductsprotectedprotectionreceiveregulationsresourceswater
SHARED TOKENS (19): "approximately", "beyond", "cannot", "conservation", "global", "land", "local", "maintain", "multiple", "national", "percent", "processes", "products", "protected", "protection", "receive", "regulations", "resources", "water".
0.300
affectdesignateddiseaseenvironmentalestablishedhealthlessmillionmultipleprecipitationprimarilyproblemsqualityresultriskstandards
SHARED TOKENS (16): "affect", "designated", "disease", "environmental", "established", "health", "less", "million", "multiple", "precipitation", "primarily", "problems", "quality", "result", "risk", "standards".
0.300
diagnosisdiseaseexampleexplainsfieldhistoryinformationmajorpatternsphysicalpointpossiblerecognitionrequiredstatistics
SHARED TOKENS (15): "diagnosis", "disease", "example", "explains", "field", "history", "information", "major", "patterns", "physical", "point", "possible", "recognition", "required", "statistics".
0.300
Farmworker ↗ Q5060555 KW CROSS HIGH
addressagriculturalagricultureconditionscropeconomicenvironmentalhealthlaborlawproductionrelatedrightssupportedtechnologyvalleywork
SHARED TOKENS (17): "address", "agricultural", "agriculture", "conditions", "crop", "economic", "environmental", "health", "labor", "law", "production", "related", "rights", "supported", "technology", "valley", "work".
0.300
anotherbecomechangechemicalconditionscreatecurrentdevelopingdevelopmentexamplefieldsfoundimportantmajorphysicalproblemsprocessesrelatedrelevantresearch
SHARED TOKENS (23): "another", "become", "change", "chemical", "conditions", "create", "current", "developing", "development", "example", "fields", "found", "important", "major", "physical", "problems", "processes", "related", "relevant", "research"....
0.300
builtcomplexcontroldescribesearlyentirefacilitiesfacilityfallsindividuallargelowermajormechanismmodelmodernoperaterathershipmentstorage
SHARED TOKENS (20): "built", "complex", "control", "describes", "early", "entire", "facilities", "facility", "falls", "individual", "large", "lower", "major", "mechanism", "model", "modern", "operate", "rather", "shipment", "storage".
0.300
actconservationdisposalfederallaw
SHARED TOKENS (5): "act", "conservation", "disposal", "federal", "law". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagenciesagriculturalbreedingcenterscharacteristicscomplexconditionscreatecropcropsdevelopingdevelopmentdiseasediversityfoodgovernmentgrowingimportantimprove
SHARED TOKENS (38): "additional", "agencies", "agricultural", "breeding", "centers", "characteristics", "complex", "conditions", "create", "crop", "crops", "developing", "development", "disease", "diversity", "food", "government", "growing", "important", "improve"....
0.300
accessagencyassociationcapacitycenterschangesconductscontentcontroldepartmentdevelopingdiseaseenvironmentalfebruaryfederalfoodgovernmentheadquarteredhealthimprove
SHARED TOKENS (34): "access", "agency", "association", "capacity", "centers", "changes", "conducts", "content", "control", "department", "developing", "disease", "environmental", "february", "federal", "food", "government", "headquartered", "health", "improve"....
0.300
Agricultural finance ↗ KW CROSS HIGH
agriculturalagricultureassociationconditionscropdemanddirectlyequipmentfinanceinstitutionsinsurancelandlargelivestocklocalmanagementmanufacturingneedsprivateprocessing
SHARED TOKENS (32): "agricultural", "agriculture", "association", "conditions", "crop", "demand", "directly", "equipment", "finance", "institutions", "insurance", "land", "large", "livestock", "local", "management", "manufacturing", "needs", "private", "processing"....
0.300
agencydepartmenthealthidahopublic
SHARED TOKENS (5): "agency", "department", "health", "idaho", "public". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.300
Viticulture ↗ KW CROSS HIGH
backcharacteristicsdevelopmentfoundhistoryirrigationleastlevelsmanagementmodernpressprovidesciencevarietieswestern
SHARED TOKENS (15): "back", "characteristics", "development", "found", "history", "irrigation", "least", "levels", "management", "modern", "press", "provide", "science", "varieties", "western".
0.300
Crop rotation ↗ Q191258 KW CROSS HIGH
agriculturalbettercropcropsdependentdevelopingecosystemexternalgrowingimproveneedpestreducesoilspecializedstructuresystem
SHARED TOKENS (17): "agricultural", "better", "crop", "crops", "dependent", "developing", "ecosystem", "external", "growing", "improve", "need", "pest", "reduce", "soil", "specialized", "structure", "system".
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
bodyconditionscontrolledculturedevelopmentenvironmentessentialformgeneticallygrowthhistoricalisolatedlaboratoryneedoptimaloriginaloutsideplantpopulationrelated
SHARED TOKENS (25): "body", "conditions", "controlled", "culture", "development", "environment", "essential", "form", "genetically", "growth", "historical", "isolated", "laboratory", "need", "optimal", "original", "outside", "plant", "population", "related"....
0.300
diseaseisolatedplantproblemquarantine
SHARED TOKENS (5): "disease", "isolated", "plant", "problem", "quarantine". | EXACT TITLE in agriculture: "Plant quarantine".
0.300
approximatelyassociationboisebureaucanyoncapacitycenterconservationcreatesdirectlyedgefebruaryfederalidahoimportantlocallowernampanationalorder
SHARED TOKENS (31): "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "conservation", "creates", "directly", "edge", "february", "federal", "idaho", "important", "local", "lower", "nampa", "national", "order"....
0.300
academicaccessagenciesannualapproximatelybusinessescapitaldevelopeddevelopmentdiseasedistincteducationessentialexamplesexpansionfieldfirmsglobalgrowthhealth
SHARED TOKENS (46): "academic", "access", "agencies", "annual", "approximately", "businesses", "capital", "developed", "development", "disease", "distinct", "education", "essential", "examples", "expansion", "field", "firms", "global", "growth", "health"....
0.300
annualapprovalcenterchangescomplianceentityfacilitiesfoodforminformationlegalmanufacturingproductproductsreportsrequirementsresearchstandards
SHARED TOKENS (18): "annual", "approval", "center", "changes", "compliance", "entity", "facilities", "food", "form", "information", "legal", "manufacturing", "product", "products", "reports", "requirements", "research", "standards".
0.300
Noxious weed ↗ Q7067310 KW CROSS HIGH
agriculturalagricultureauthoritycontrolscropcropsdesignatedecosystemfeedfoodlargelivestockmajormanagementplantproblemseedssoil
SHARED TOKENS (18): "agricultural", "agriculture", "authority", "controls", "crop", "crops", "designated", "ecosystem", "feed", "food", "large", "livestock", "major", "management", "plant", "problem", "seeds", "soil".
0.300
agriculturalbecomecentralcostsdirectlyeconomicformharvestedinsurancemanagementmarketmarketsphysicalpricesproductsprovideratherrisksectorstorage
SHARED TOKENS (21): "agricultural", "become", "central", "costs", "directly", "economic", "form", "harvested", "insurance", "management", "market", "markets", "physical", "prices", "products", "provide", "rather", "risk", "sector", "storage"....
0.300
addresscurrentdevelopedeconomiceconomyfinanceformhealthindustrypercentproductproductsrequirementssectorsystem
SHARED TOKENS (15): "address", "current", "developed", "economic", "economy", "finance", "form", "health", "industry", "percent", "product", "products", "requirements", "sector", "system".
0.300
actanotherbusinesscapitalcentralcontrolcorporatecreatedepartmentdescribedentityexamplefederalgovernmentlawlegalmanagementmarketoperatingprocesses
SHARED TOKENS (27): "act", "another", "business", "capital", "central", "control", "corporate", "create", "department", "described", "entity", "example", "federal", "government", "law", "legal", "management", "market", "operating", "processes"....
0.300
agencycommitteeconductsconservationdepartmenteducationenforcementenvironmentalfederalfederallygovernmentinformationlaboratorieslegallevelslocalmattersnationalorderprograms
SHARED TOKENS (26): "agency", "committee", "conducts", "conservation", "department", "education", "enforcement", "environmental", "federal", "federally", "government", "information", "laboratories", "legal", "levels", "local", "matters", "national", "order", "programs"....
0.300
Sheep ↗ Q7368 KW CROSS HIGH
agriculturalagriculturecentercentralculturedairyeconomyharvestedhistoryimportantlargelifelivestockmajormakingmembersmilkmodelmodernorder
SHARED TOKENS (26): "agricultural", "agriculture", "center", "central", "culture", "dairy", "economy", "harvested", "history", "important", "large", "life", "livestock", "major", "making", "members", "milk", "model", "modern", "order"....
0.300
4-H ↗ Q238139 KW CROSS HIGH
agencyagriculturechangecommunityconsumercreatedepartmentdevelopingdevelopmentextensionfederalfoodhealthlocalmembersmillionnationaloperatesprogramprograms
SHARED TOKENS (27): "agency", "agriculture", "change", "community", "consumer", "create", "department", "developing", "development", "extension", "federal", "food", "health", "local", "members", "million", "national", "operates", "program", "programs"....
0.300
activeagainstapprovalbecomechemicalcommercialcomplexdevelopeddevelopmententityfieldshealthhistoricallyincreaseindustryisolatedlargemarketmeansmodern
SHARED TOKENS (36): "active", "against", "approval", "become", "chemical", "commercial", "complex", "developed", "development", "entity", "fields", "health", "historically", "increase", "industry", "isolated", "large", "market", "means", "modern"....
0.300
appearsbodycharacteristicschemicalchemicalsdescribeddiagnosisdisposaldistinctenvironmentenvironmentalexamplesfacilitiesgeneratehealthhomeindustriallaboratorieslaboratorymaterial
SHARED TOKENS (30): "appears", "body", "characteristics", "chemical", "chemicals", "described", "diagnosis", "disposal", "distinct", "environment", "environmental", "examples", "facilities", "generate", "health", "home", "industrial", "laboratories", "laboratory", "material"....
0.300
actagenciesagencyagriculturalagriculturebroaderconservationdepartmentexampleimproveimprovementlocalprivateprogramsprojectqualityresourcessmallsoilsupported
SHARED TOKENS (22): "act", "agencies", "agency", "agricultural", "agriculture", "broader", "conservation", "department", "example", "improve", "improvement", "local", "private", "programs", "project", "quality", "resources", "small", "soil", "supported"....
0.300
accesscenterscontainerscontroldiseaseequipmentestablishedfacilitiesfacilityhealthlaboratorieslaboratorylevelsmultipleprotectionreportsrequiredspecifiedsystemstraining
SHARED TOKENS (20): "access", "centers", "containers", "control", "disease", "equipment", "established", "facilities", "facility", "health", "laboratories", "laboratory", "levels", "multiple", "protection", "reports", "required", "specified", "systems", "training".
0.300
agriculturalagriculturechemicalchemicalscommercialcommunitycontrolcropcropsdevelopeddevelopmenteconomicenvironmentfoodhealthmanagementpestphysicalpracticesprograms
SHARED TOKENS (21): "agricultural", "agriculture", "chemical", "chemicals", "commercial", "community", "control", "crop", "crops", "developed", "development", "economic", "environment", "food", "health", "management", "pest", "physical", "practices", "programs"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeagriculturalbusinesscharacteristicscommercialconservationcropdevelopeddiseasediversityearlyfacilitiesglobalgrowersgrowinggrowthhomeinternationallargematerials
SHARED TOKENS (39): "active", "agricultural", "business", "characteristics", "commercial", "conservation", "crop", "developed", "disease", "diversity", "early", "facilities", "global", "growers", "growing", "growth", "home", "international", "large", "materials"....
0.300
evenfunctionoperatesstructuresystems
SHARED TOKENS (5): "even", "function", "operates", "structure", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.300
codedevelopingengineeringevenfieldsfoundfunctionimproveindustrialknowledgemarketproductproductionrecognitionresearchresearchersstructurevalue
SHARED TOKENS (18): "code", "developing", "engineering", "even", "fields", "found", "function", "improve", "industrial", "knowledge", "market", "product", "production", "recognition", "research", "researchers", "structure", "value".
0.300
environmentalplantprocessessoilwater
SHARED TOKENS (5): "environmental", "plant", "processes", "soil", "water". | EXACT TITLE in agriculture: "Groundwater recharge".
0.300
agencyagriculturalagricultureapproximatelycommercialcurrentdepartmentdirectlyfebruaryfederalfoodgovernmentlivestocknationalneedsproductionprogramprogramsreportsresources
SHARED TOKENS (23): "agency", "agricultural", "agriculture", "approximately", "commercial", "current", "department", "directly", "february", "federal", "food", "government", "livestock", "national", "needs", "production", "program", "programs", "reports", "resources"....
0.300
actagencycenterscertificationdepartmentfacilitiesfederalfinancinggovhealthhomeimprovementinsurancelaboratoryoversightprogramprogramsqualityreportsstandards
SHARED TOKENS (22): "act", "agency", "centers", "certification", "department", "facilities", "federal", "financing", "gov", "health", "home", "improvement", "insurance", "laboratory", "oversight", "program", "programs", "quality", "reports", "standards"....
0.300
characteristicschemicaldatadiagnosisengineeringfunctionhealthlablightphysicalpopulationresearchseparatesizetrials
SHARED TOKENS (15): "characteristics", "chemical", "data", "diagnosis", "engineering", "function", "health", "lab", "light", "physical", "population", "research", "separate", "size", "trials".
0.300
adaboisebureaucanyondepartmentdesignatedeasternestablishedfallsgrowersidaholabellaborleastproducersproductionriversquaretwinvalley
SHARED TOKENS (20): "ada", "boise", "bureau", "canyon", "department", "designated", "eastern", "established", "falls", "growers", "idaho", "label", "labor", "least", "producers", "production", "river", "square", "twin", "valley".
0.300
becomechangesconstructioncyclesdevelopeddiagnosisessentialexampleisolatedjointlylaboratoryoriginalrapidlyregionresearchsciencesettingsinglesmallspecifically
SHARED TOKENS (20): "become", "changes", "construction", "cycles", "developed", "diagnosis", "essential", "example", "isolated", "jointly", "laboratory", "original", "rapidly", "region", "research", "science", "setting", "single", "small", "specifically".
0.300
Feedlot ↗ Q1400937 KW CROSS HIGH
actaffectagencyagriculturalapprovalauthoritycattlecleancontrolledenvironmentenvironmentalfarmsfeedfoodgovernmentincreaseindividualinspectionlargelaw
SHARED TOKENS (37): "act", "affect", "agency", "agricultural", "approval", "authority", "cattle", "clean", "controlled", "environment", "environmental", "farms", "feed", "food", "government", "increase", "individual", "inspection", "large", "law"....
0.300
actagencyconditionscostsdepartmenteducationemploymentestablishedfederalhealthlaborlawoutreachreduceregulationsregulatorysafetysettingstandardstraining
SHARED TOKENS (20): "act", "agency", "conditions", "costs", "department", "education", "employment", "established", "federal", "health", "labor", "law", "outreach", "reduce", "regulations", "regulatory", "safety", "setting", "standards", "training".
0.300
agriculturalappliedchemicalscommercialcropcropsenvironmentalfarmsfertilizerhealthproductproductsprotectionpublicseedsinglespecializedwater
SHARED TOKENS (18): "agricultural", "applied", "chemicals", "commercial", "crop", "crops", "environmental", "farms", "fertilizer", "health", "product", "products", "protection", "public", "seed", "single", "specialized", "water".
0.300
Histology ↗ Q7168 EXACT TITLE
fieldhistoricallymodernplacestissues
SHARED TOKENS (5): "field", "historically", "modern", "places", "tissues". | EXACT TITLE in biotech_life_sciences: "Histology".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalchangescontroldescribeddevelopmentexpansionfinancefinancingfirmsmanagementoperationalpressprivateproductproductsprovidepublicrather
SHARED TOKENS (23): "active", "business", "capital", "changes", "control", "described", "development", "expansion", "finance", "financing", "firms", "management", "operational", "press", "private", "product", "products", "provide", "public", "rather"....
0.300
boisebureaucapacityfarmlandidahoirrigationlowernampanationalnearplacesprogramprojectproviderivertreasurevalleywaterwestern
SHARED TOKENS (19): "boise", "bureau", "capacity", "farmland", "idaho", "irrigation", "lower", "nampa", "national", "near", "places", "program", "project", "provide", "river", "treasure", "valley", "water", "western".
0.300
agriculturecomplianceconservationcreatesdetailsdevelopmententityestablishedestateexamplefederalgovernmentgrowthimprovelandlegallocalmaintainmarketneeds
SHARED TOKENS (33): "agriculture", "compliance", "conservation", "creates", "details", "development", "entity", "established", "estate", "example", "federal", "government", "growth", "improve", "land", "legal", "local", "maintain", "market", "needs"....
0.300
Farm-to-table ↗ Q5435464 KW CROSS HIGH
agriculturecannotchangesdistributioneconomicsfarmsfoodformgrowinglesslocallocallymarketmodelneedrelationshipsafetyservingshippedsmall
SHARED TOKENS (22): "agriculture", "cannot", "changes", "distribution", "economics", "farms", "food", "form", "growing", "less", "local", "locally", "market", "model", "need", "relationship", "safety", "serving", "shipped", "small"....
0.300
Cold chain ↗ KW CROSS HIGH
agriculturalchainschemicalscolddistributionequipmentfoodlogisticsmaintainmanagementproductionproductsqualityrequiressafetystoragesupply
SHARED TOKENS (17): "agricultural", "chains", "chemicals", "cold", "distribution", "equipment", "food", "logistics", "maintain", "management", "production", "products", "quality", "requires", "safety", "storage", "supply".
0.300
anotherbehaviorbettercentercomplexconstructioncreatedatadiseaseessentialexampleexternalfieldfunctionincreasinglyisolatedknowledgelarge-scalemeansmodel
SHARED TOKENS (32): "another", "behavior", "better", "center", "complex", "construction", "create", "data", "disease", "essential", "example", "external", "field", "function", "increasingly", "isolated", "knowledge", "large-scale", "means", "model"....
0.300
Technology transfer ↗ KW CROSS HIGH
academicanothercapacitycommercialconnectingcontrolcoredevelopmentenvironmentglobalgovernmentimportantindustrialinstitutionsknowledgelevelslicensingmarketmeansprivate
SHARED TOKENS (31): "academic", "another", "capacity", "commercial", "connecting", "control", "core", "development", "environment", "global", "government", "important", "industrial", "institutions", "knowledge", "levels", "licensing", "market", "means", "private"....
0.300
communitycontinuitycurrentdevelopmentearlyentiregrowthimportantindividuallandlargemasterplanplanningpolicyproductprovidepublicregionregional
SHARED TOKENS (21): "community", "continuity", "current", "development", "early", "entire", "growth", "important", "individual", "land", "large", "master", "plan", "planning", "policy", "product", "provide", "public", "region", "regional"....
0.300
backbetterdecisionsdevelopmentdiseaseengineeringhealthindividualleastmodelnationaloptimalpeoplepracticesproductsproviderelatedrisksystemstreatment
SHARED TOKENS (20): "back", "better", "decisions", "development", "disease", "engineering", "health", "individual", "least", "model", "national", "optimal", "people", "practices", "products", "provide", "related", "risk", "systems", "treatment".
0.300
agriculturalbestboardcenterconservationdatafarmlandinformationlandlocalnationaloperatespolicypracticesprotectionregionalremainsresearchersresourcessupport
SHARED TOKENS (24): "agricultural", "best", "board", "center", "conservation", "data", "farmland", "information", "land", "local", "national", "operates", "policy", "practices", "protection", "regional", "remains", "researchers", "resources", "support"....
🫐 BERRY40 edges
0.280
Serology ↗ Q502159 EXACT TITLE
againstbodydiseaseexample
SHARED TOKENS (4): "against", "body", "disease", "example". | EXACT TITLE in biotech_life_sciences: "Serology".
0.280
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsidebodychemicalchemicalsdistributionfieldfunctionhealthprocessesresearchrolesciencespecificallysystems
SHARED TOKENS (14): "alongside", "body", "chemical", "chemicals", "distribution", "field", "function", "health", "processes", "research", "role", "science", "specifically", "systems".
0.260
authoritydesignateddistrictsentitygovernmentirrigationlargelocalobtainorderprojectspublicwater
SHARED TOKENS (13): "authority", "designated", "districts", "entity", "government", "irrigation", "large", "local", "obtain", "order", "projects", "public", "water".
0.260
Snap pea ↗ Q12097128 KW CROSS HIGH
describedfallsfoundgrowthidaholessoptimalrequiredresearcherssupportsystemtwinvarieties
SHARED TOKENS (13): "described", "falls", "found", "growth", "idaho", "less", "optimal", "required", "researchers", "support", "system", "twin", "varieties".
0.260
Phlebotomy ↗ Q3595842 EXACT TITLE
makingtreatmentvolume
SHARED TOKENS (3): "making", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.260
beyondbusinessbusinessesdevelopingearlyexternalgrowinggrowthlargemodelprivateprojectpublic
SHARED TOKENS (13): "beyond", "business", "businesses", "developing", "early", "external", "growing", "growth", "large", "model", "private", "project", "public".
0.260
agricultureanotherexamplefoodhealthinformationlifemajorphysicalqualityscalesciencestandard
SHARED TOKENS (13): "agriculture", "another", "example", "food", "health", "information", "life", "major", "physical", "quality", "scale", "science", "standard".
0.260
Biomarker ↗ EXACT TITLE
fieldsprocessestissues
SHARED TOKENS (3): "fields", "processes", "tissues". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.240
Water quality ↗ Q625376 KW CROSS HIGH
againstcharacteristicschemicalcompliancehealthphysicalqualitysafetystandardssupplytreatmentwater
SHARED TOKENS (12): "against", "characteristics", "chemical", "compliance", "health", "physical", "quality", "safety", "standards", "supply", "treatment", "water".
0.240
agencyagriculturalagricultureconservationdepartmenthomenationalnetworkpolicyproductionprogramsreports
SHARED TOKENS (12): "agency", "agricultural", "agriculture", "conservation", "department", "home", "national", "network", "policy", "production", "programs", "reports".
0.220
Nematology ↗ Q2355208 EXACT TITLE
backeven
SHARED TOKENS (2): "back", "even". | EXACT TITLE in agriculture: "Nematology".
0.220
consumerinformationmultipleneedsonlineproductproductionproductsproviderssellsingle
SHARED TOKENS (11): "consumer", "information", "multiple", "needs", "online", "product", "production", "products", "providers", "sell", "single".
0.220
Cover crop ↗ Q3001783 KW CROSS HIGH
agriculturecropcropsharvestedincreasequalityratherreducesoilsystemwater
SHARED TOKENS (11): "agriculture", "crop", "crops", "harvested", "increase", "quality", "rather", "reduce", "soil", "system", "water".
0.220
appliedemphasisengineeringfieldimprovemaintainmaterialsrequiresupportsystemtissues
SHARED TOKENS (11): "applied", "emphasis", "engineering", "field", "improve", "maintain", "materials", "require", "support", "system", "tissues".
0.220
coldstorage
SHARED TOKENS (2): "cold", "storage". | EXACT TITLE in biotech_life_sciences: "Cold storage". | EXACT TITLE in agriculture: "Cold storage".
0.210
research
SHARED TOKENS (1): "research". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.210
Biophysics ↗ Q7100 EXACT TITLE
science
SHARED TOKENS (1): "science". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.200
FFA ↗ Q299952 EXACT TITLE
EXACT TITLE in biotech_life_sciences: "FFA".
0.200
Barley ↗ Q11577 KW CROSS HIGH
feedlessmajormakingmaterialmillionproductionrolesoilsource
SHARED TOKENS (10): "feed", "less", "major", "making", "material", "million", "production", "role", "soil", "source".
0.200
Mint ↗ Q369531 EXACT TITLE
EXACT TITLE in agriculture: "Mint".
0.200
annualboisecapitalearlyeasternfallsidaholargesouthwestwestern
SHARED TOKENS (10): "annual", "boise", "capital", "early", "eastern", "falls", "idaho", "large", "southwest", "western".
0.200
Drupe ↗ Q14712 KW CROSS HIGH
appliedformindividualinsidelayermembersseedsinglesmallstructure
SHARED TOKENS (10): "applied", "form", "individual", "inside", "layer", "members", "seed", "single", "small", "structure".
0.200
facilitieshealthhomeidahonetworkoperatesoperatingpeoplesupportsystem
SHARED TOKENS (10): "facilities", "health", "home", "idaho", "network", "operates", "operating", "people", "support", "system".
0.180
backbecomediagnosisengineeredmultiplepossiblesitesspecificallytreatment
SHARED TOKENS (9): "back", "become", "diagnosis", "engineered", "multiple", "possible", "sites", "specifically", "treatment".
0.160
chemicalenvironmentenvironmentalformmicrobiologyrelationshiprelationshipsroles
SHARED TOKENS (8): "chemical", "environment", "environmental", "form", "microbiology", "relationship", "relationships", "roles".
0.160
Select agent ↗ KW CROSS HIGH
agriculturecontrolleddepartmenthealthlawpublicsafetyusda
SHARED TOKENS (8): "agriculture", "controlled", "department", "health", "law", "public", "safety", "usda".
0.160
allowingdirectlyirrigationnetworksoilsystemsystemswater
SHARED TOKENS (8): "allowing", "directly", "irrigation", "network", "soil", "system", "systems", "water".
0.160
agriculturalindustriallegalmerelyrightssourcesystemwater
SHARED TOKENS (8): "agricultural", "industrial", "legal", "merely", "rights", "source", "system", "water".
0.160
foodinternationalmeansprimarilyprogramregulationsregulatorytrials
SHARED TOKENS (8): "food", "international", "means", "primarily", "program", "regulations", "regulatory", "trials".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahonampapopulationwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "eastern", "idaho", "nampa", "population", "western".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyongrowingidahopopulationrapidlyshared
SHARED TOKENS (8): "ada", "boise", "canyon", "growing", "idaho", "population", "rapidly", "shared".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahonearlypercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "nearly", "percent", "population".
0.140
chemicalcomplexemphasisexamplemodelplacesrelationships
SHARED TOKENS (7): "chemical", "complex", "emphasis", "example", "model", "places", "relationships".
0.140
developedfieldimprovementlaboratoryprogramresearchsingle
SHARED TOKENS (7): "developed", "field", "improvement", "laboratory", "program", "research", "single".
0.140
boisecenterfederallyidahopopulationsidevalley
SHARED TOKENS (7): "boise", "center", "federally", "idaho", "population", "side", "valley".
0.140
bodychemicalemphasisfoodplacespointrelationship
SHARED TOKENS (7): "body", "chemical", "emphasis", "food", "places", "point", "relationship".
0.120
Medical test ↗ Q2671652 KW CROSS HIGH
chemicaldiseasephysicalprocessessettingtreatment
SHARED TOKENS (6): "chemical", "disease", "physical", "processes", "setting", "treatment".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
agriculturalagriculturediagnosisequipmentoperate
SHARED TOKENS (5): "agricultural", "agriculture", "diagnosis", "equipment", "operate".
0.100
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
◈ Frequently Asked Questions
Biotech Life Sciences × Agriculture — Treasure Valley
HAIKU · HIGH GATE
How does the University of Idaho support both biotech research and agricultural innovation in the Treasure Valley?
The University of Idaho operates research programs in plant pathology and veterinary medicine that directly serve Treasure Valley farmers in Ada County, Canyon County, and surrounding areas. These departments conduct seed testing and disease research that strengthen dairy farming and alfalfa production across the region's agricultural economy.
What role does plant pathology research play in Treasure Valley agriculture and biotech development?
Plant pathology specialists at University of Idaho work on diseases affecting alfalfa and other crops grown throughout Ada County and Canyon County, generating biotech applications for pest and disease management. This research directly improves yield and quality for agricultural operations in Boise, Nampa, Caldwell, and Meridian.
How do biotech companies in Boise and Nampa connect to the Treasure Valley's dairy farming sector?
Biotech firms in Boise and Nampa develop animal health solutions and veterinary medicine applications that support the region's substantial dairy farming operations. These companies conduct research on livestock health and feed crop optimization using alfalfa and other plants grown throughout the Treasure Valley.
Why is seed testing a bridge between Treasure Valley biotech research and agricultural production?
Seed testing facilities in the Treasure Valley verify crop viability and quality for alfalfa and other plants grown in Ada County and Canyon County. Biotech researchers use seed testing data to develop improved varieties and disease-resistant strains that increase yields for Treasure Valley farmers.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Biotech Life Sciences × Agriculture 14 QID bridges 219 edges 5,918 ext links 2026-07-17 19:43:15 UTC 2200b836a5d3789c
Biotech Life Sciences corridor ↗ Agriculture corridor ↗ Agriculture × Biotech Life Sciences ↗ boisestandard.org/standard ↗
Parent Corridors
Biotech Life Sciences × All Other Verticals