—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Senior Services ↔ relates to ↔ Mental Health

29 Wikipedia bridge articles confirmed in both vertical ledgers. 240 deterministic cross-vertical edges. 6,657 external source links harvested. Every edge provenance-stamped. Every claim auditable.

29 QID Bridge Articles
240 Cross Edges
6,657 External Sources
276 Wikipedia Articles
30 🌲 Evergreen
177 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Senior Services
× Mental Health
QID Bridge Articles
29
confirmed Wikipedia overlap
Total Cross Edges
240
External Sources Harvested
6,657
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (20)
IdahoVertical integrationDementiaMedicaidSocial workDisabilityPrimary careMedicare (United States)TelehealthCenters for Medicare & Medicaid ServicesTreasure ValleyBoise State UniversityIdaho State UniversityBoise metropolitan areaHealth Insurance Portability and Accountability ActHealth insurance in the United StatesIdaho Department of Health and WelfareHealthcare in the United StatesClinical psychologyMedical education
Shared Semantics (20 tokens)
idahopopulationboisecarehealthcaremedicalresearchpublicmetropolitandifferentsocialinsuranceprogramprogramsprivatepatientssystemcensusapproximatelycapital
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:09:00 UTC
Content Hash
e44d4ab31c522653
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
29 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (25): "approximately", "around", "associated", "boise", "capital", "distinct", "divided", "early", "east", "gem", "geographic", "idaho", "isolated", "july", "national", "official", "population", "rest", "sector", "separate".... | EXACT TITLE in senior_services: "Idaho". | EXACT TITLE in mental_health: "Idaho".
approximatelyaroundassociatedboisecapitaldistinctdividedearlyeastgemgeographicidahoisolatedjulynationalofficialpopulationrestsectorseparatesuppliestechnologyuseswashingtonwestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Vertical integration
Q1571520 EXACT TITLE 1.000
QID OVERLAP: Q1571520 in senior_services (tier:evergreen) and mental_health (tier:branch). | SHARED TOKENS (22): "become", "competition", "consolidation", "described", "different", "directly", "integrated", "integration", "making", "management", "market", "need", "owned", "ownership", "position", "produce", "produces", "rather", "related", "satisfy".... | EXACT TITLE in senior_services: "Vertical integration".
becomecompetitionconsolidationdescribeddifferentdirectlyintegratedintegrationmakingmanagementmarketneedownedownershippositionproduceproducesratherrelatedsatisfysuppliesvertical
ather than buying it from suppliers). Vertical integration can be desirable because it secures supplies needed by the firm to produce its product and the market needed to sell the product, but it can become undesirable when a firm's actions become anti-competitive and impede free competition in an open marketplace. Vertical integration is one method of avoiding the hold-up problem.
Vertical expansion Vertical integration is often closely associated with vertical expansion which, in economics, is the growth of a business enterprise through the acquisition of companies that produce the intermediate goods needed by the business or help market and distribute its product. A firm may desire such expansion to secure the supplies needed by the firm to produce its product and the market needed to sell the product. Such expansion can become undesirable from a system-wide perspective when it becomes anti-competitive and impede free competition in an open marketplace. The result is a more efficient business with lower costs and more profits. On the undesirable side, when vertical expansion leads toward monopolistic control of a product or service then regulative action may be required to rectify anti-competitive behavior. Related to vertical expansion is lateral expansion, which is the growth of a business enterprise through the acquisition of similar firms, in the hope of achieving economies of scale. Vertical expansion is also known as a vertical acquisition. Vertical expansion or acquisitions can also be used to increase sales and to gain market power. The acquisition of DirecTV by News Corporation is an example of forwarding vertical expansion or acquisition. DirecTV is a satellite TV company through which News Corporation can distribute more of its media content: news, movies, and television shows. The acquisition of NBC by Comcast is an example of backward vertical integration. For example, in the United States, protecting the public from communications monopolies that can be built in this way is one of the missions of the Federal Communications Commission. Scholars' findings suggest that a reduction in inefficiencies caused by the market vertical value chains, including downstream prices or double mark-up, can be negated with vertical integration. Application in more complex environments can help firms overcome market failures (markets with high transaction costs or assets specificities). Scholars also identified potential risks and boundaries which may occur under vertical integration. This includes the potential competitor, the enhancements to horizontal collusion, and development of barriers to entry. However, it is still debated over if vertical integration expected efficiencies can lead to competitive harm to the market.
There are many problems and benefits that vertical integration brings to an economic system. Problems that can stem from vertical integration can include large capital investments needed to set up and buy factories and maintain efficient profits. Rapid technology development can increase integration difficulties and further increase costs. The requirement of different business skills venturing into new portions of the supply chain can be challenging for the firm. Another problem that may stem from vertical integration is the collapse of goals among the various firms in a supply chain. With each firm operating under different systems, integration may cause initial problems in management and production. Vertical integration also proves to be dangerous when monopolistic problems arise in a capitalistic economy. When this happens, competition is removed and a corporation has the power to control all firms in its supply chain. Large companies are more likely than smaller companies to employ vertical integration, as they have more resources to manage each stage of production (e.g. major expansion and funding). Vertical integration allows control of production from beginning to end. Vertical integration requires a company to focus not only on its core business, but also on several difficult areas such as sourcing materials and manufacturing partners, distribution, and finally selling the product. One benefit is that the implementation of vertical integration can yield increased profit margins or eliminate the leverage that other firms or buyers may have over the firm. It allows improved coordination between production and distribution firms and decreases the cost of exchange of goods between firms within a supply chain. Operational routines also become more consistent and certain as the management of these firms gradually merge. Vertically integrated firms rarely need to worry about the sufficiency in their supply of materials because they generally control the facilities that provide them. A vertically integrated company also creates high barriers of entry into their respective economy, eliminating most potential competition. Implementing vertical integration can be beneficial in that it reduces the distance that separates the suppliers and customers from the resources or information, which can then boost profits and efficiency. There are internal and external society-wide gains and losses stemming from vertical integration, which vary according to the state of technology in the industries involved, roughly corresponding to the stages of the industry lifecycle. Static technology represents the simplest case, where the gains and losses have been studied extensively.
Dementia
Q83030 EXACT TITLE 1.000
QID OVERLAP: Q83030 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (37): "ability", "affects", "approximately", "associated", "behavioral", "cases", "change", "changes", "condition", "continuum", "control", "dementia", "depression", "described", "determine", "development", "disease", "disorders", "general", "history".... | EXACT TITLE in senior_services: "Dementia". | EXACT TITLE in mental_health: "Dementia".
abilityaffectsapproximatelyassociatedbehavioralcaseschangechangesconditioncontinuumcontroldementiadepressiondescribeddeterminedevelopmentdiseasedisordersgeneralhistoryidentifyillnessindividuallanguagelifemajorperformpersonpracticesquality+7
Dementia is a syndrome, often associated with neurodegenerative diseases such as Alzheimer's, and characterized by a general decline in cognitive processes that affects the ability to perform everyday activities. This typically involves problems with memory, thinking, behavior, and motor control. Aside from memory impairment and a disruption in thought patterns, the most common symptoms of dementia include emotional problems, difficulties with language, and decreased motivation. The symptoms may be described as occurring in a continuum over several stages. Dementia is an incurable, progressive neurocognitive disorder, with varying degrees of severity (mild to major) and many forms or subtypes. The condition has a significant effect on the individual, their caregivers, and their social relationships in general. Dementia is not the same as age-related decline in cognition and memory, with no change in intelligence. The most common form of dementia is Alzheimer's. Dementia can be caused by brain injuries and stroke. It has also been described as a spectrum of disorders with subtypes of dementia based on which known disorder caused its development, such as Parkinson's disease for Parkinson's disease dementia, Huntington's disease for Huntington's disease dementia, vascular disease for vascular dementia, HIV infection causing HIV dementia, frontotemporal lobar degeneration for frontotemporal dementia, Lewy body disease for dementia with Lewy bodies, and prion diseases. Subtypes of neurodegenerative dementias may also be based on the underlying pathology of misfolded proteins, such as synucleinopathies and tauopathies. The coexistence of more than one type of dementia is known as mixed dementia. Diagnosis is usually based on history of the illness and cognitive testing with imaging. Imaging can help to determine the dementia subtype, and to exclude other causes. Blood tests are usually taken to rule out other possible reversible causes such as hypothyroidism (an underactive thyroid). Fluid biomarkers detected in cerebrospinal fluid, and in blood can identify Alzheimer's disease. PET scans can detect amyloid beta and tau, the two intrinsically disordered proteins that are the hallmark features of Alzheimer's. Although the greatest risk factor for developing dementia is aging, dementia is not a normal part of the aging process; many people aged 90 and above show no signs of dementia. Risk factors, diagnosis and caregiving practices are influenced by cultural and socio-environmental factors. Several risk factors for dementia, such as smoking and obesity, are modifiable by lifestyle changes. As of 2025, dementia is the seventh leading cause of death worldwide and has 10 million new cases reported every year (approximately one every three seconds). In the UK it is the leading cause of death. It is one of the main causes of disabilities in those aged over 65. There is no known cure for dementia. Acetylcholinesterase inhibitors such as donepezil are often used in some dementia subtypes and may be beneficial in mild to moderate stages, but the overall benefit may be minor. There are many measures that can improve the quality of life of a person with dementia and their caregivers.
Signs and symptoms The signs and symptoms of dementia may vary between individuals, and may vary according to the underlying subtype, particularly in the early stages but at the end stage of all types they are similar. Symptoms may be grouped into three areas: cognitive, neuropsychiatric (behavioral and psychological), and motor. The cognitive symptoms of dementia relate to the area of the brain affected. Typically this includes memory plus one other cognitive region affecting language (commonly), attention, problem solving or perception and orientation. Signs of dementia include wandering, and getting lost in a familiar neighborhood, using unusual words to refer to familiar objects, forgetting the name of a close family member or friend, forgetting old memories, forgetting to pay bills, and being unable to complete tasks independently. The symptoms progress at a continuous rate over several stages. Most types of dementia are slowly progressive with some deterioration of the brain well established before signs become apparent. Neuropsychiatric symptoms (NPS) are a major feature of dementia affecting more than 90% of all cases, at different stages. They often present as first or early symptoms or syndromes, as mild behavioral impairment (MBI) that may reflect the subtype of dementia at issue. For example, a study has found that the first symptoms as NPS of personality change, and disinhibition will relate to a diagnosis of frontotemporal dementia. The presence of MBI on its own is not a cognitive impairment and is not recognized as dementia but may be an indicator for the development of mild cognitive impairment, as a predementia type. It may also be seen as a transitional state in the development of dementia. The behavioral symptoms can include agitation, restlessness, inappropriate behavior, disinhibition, and verbal or physical aggression. Psychological symptoms can include depression, hallucinations, delusions, apathy, and anxiety. Also common are personality changes with the progression of dementia, such as increases in neuroticism (negativity), and a decline in conscientiousness. Motor symptoms and signs may include changes in gait, repetitive movements, parkinsonism, or seizures. Changes in gait can be responsible for falls. An inability to relax muscles, known as paratonia is an induced motor dysfunction that affects most people with dementia. Motor impairments are correlated with cognitive impairments, and are a main cause of disability and dependency. In advanced dementia paratonia may lead to fixed postures with contracted muscles, which can lead to broken skin, and infection, and also cause pain on movement.
Alzheimer's dementia is caused by Alzheimer's disease, and accounts for 60–70% of cases of dementia worldwide. Alzheimer's is often part of a mixed dementia diagnosis, typically together with vascular dementia, but also with Lewy body dementia. Mixed dementia has been acknowledged to be the most common type of dementia. A preclinical stage is described for Alzheimer's which is asymptomatic but which shows evidence of Alzheimer's pathology. This can precede the prodromal stage where symptoms become apparent. The loss of the sense of smell (anosmia) is recognized as a long prodromal stage in Alzheimer's. Symptoms may vary among individuals. Typically one of the first signs is a problem with memory. Other cognitive impairments can include difficulty in finding the right word, difficulties with visuospatial ability, and impaired reasoning and judgment. In the middle stage hallucinations may be a feature. In later stages the symptoms become more severe, and include greater confusion, and changes in behavior. A lack of insight into having a condition will become evident. The hallmark features of Alzheimer's disease are the deposits of amyloid beta in extracellular amyloid plaques, and the intracellular neurofibrillary tangles formed by hyperphosphorylated tau proteins. A protein (TREM2) malfunction can affect the microglial role of clearing cellular debris, allowing a build up of debris and plaques. Astrocytes another type of glial cell are recruited to help clear the debris but they too can become faulty as a result of the protein malfunction, and they with the microglia build up around the neurons and cause chronic inflammation that further damages the neurons. The plaques and tangles may be detected in a preclinical stage decades before the onset of symptoms that appear in the prodromal stage. Before the early 2000s, only brain tissue at autopsy could definitively diagnose Alzheimer's. Cerebrospinal fluid (CSF) analysis has since become available for detecting AD biomarkers, but blood-based biomarkers have taken the lead. Flotillin has been proposed as a potential fluid biomarker for detecting early Alzheimers in either CSF or blood. A finger-prick blood sample for the diagnosis of early AD has been developed using p-tau 217 as biomarker. Several neuroimaging techniques are also now available to help diagnose and differentiate dementia types and show their stage of progression. These include magnetic resonance imaging (MRI), CT scans, and amyloid PET scans using a tracer Pittsburgh compound B or florbetapir. Amyloid PET imaging has made possible the development of anti-amyloid immunotherapies, such as donanemab, and lecanemab, for use in mild NCI due to Alzheimer's or in mild Alzheimer's. For detecting tau protein another PET scan tracer flortaucipir was approved for use in the US and Europe in 2024. The part of the brain most affected by Alzheimer's is the medial temporal lobe which has a vital role in spatial and episodic memory. The medial temporal lobe includes the hippocampus, amygdala, and parahippocampal gyrus, and is the earliest site of atrophy and tau pathology. NODDI (neurite orientation dispersion and density imaging) is an emerging diffusion MRI technique for examining the microstructure of the grey and white matter of the brain's tissue.
Medicaid
Q1141363 EXACT TITLE 1.000
QID OVERLAP: Q1141363 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (54): "access", "adult", "adults", "annual", "become", "benefits", "care", "community-based", "costs", "court", "coverage", "disabled", "divided", "economic", "effective", "eligibility", "established", "expanded", "families", "formed".... | EXACT TITLE in senior_services: "Medicaid". | EXACT TITLE in mental_health: "Medicaid".
accessadultadultsannualbecomebenefitscarecommunity-basedcostscourtcoveragedisableddividedeconomiceffectiveeligibilityestablishedexpandedfamiliesformedfundinggeneralhealthcareincomeinsuranceledlimitedlinemanagedmedicaid+24
Medicaid is the largest source of funding for medical and health-related services for people with low income in the United States, providing taxpayer-funded health insurance to 85 million low-income and disabled people as of 2022; in 2019, the program paid for half of all U.S. births. In 2023, the total (federal and state) annual cost of Medicaid was $870 billion, with an average cost per enrollee of $7,600 for 2021. 37% of enrollees were children, but they only accounted for 15% of the spending, ($3,000 per person) while seniors and disabled persons accounted for 21% of enrollees and 52% of spending (more than $18,000 per person). In general, Medicaid recipients must be U.S. citizens or qualified non-citizens, and may include low-income adults, their children, and people with certain disabilities. Medicaid also covers long-term services and supports, including both nursing home care and home- and community-based services, for those with low incomes and minimal assets. Of the 7.7 million Americans who used long-term services and supports in 2020, about 5.6 million were covered by Medicaid. Along with Medicare, Tricare, ChampVA, and CHIP, Medicaid is one of the several Federal Government-sponsored medical insurance programs in the United States. Medicaid covers healthcare costs for people with low incomes; Medicare is a universal program providing health coverage for the elderly; and the CHIP program covers uninsured children in families with incomes that are too high to be covered by Medicaid. Medicaid offers elder care benefits not normally covered by Medicare, including nursing home care and personal care services. There are also dual health plans for people who have both Medicaid and Medicare. Research shows that existence of the Medicaid program improves health outcomes, health insurance coverage, access to health care, and recipients' financial security and provides economic benefits to states and health providers.
2025 Medicaid cuts in the second Trump administration In 2025, Republican Congressional leaders John Thune and Mike Johnson announced goals of cutting 1.5 to 2 trillion dollars of the US federal budget, with President Donald Trump stating that cuts to Medicaid would only include "abuse or waste". The 2025 budget resolution, which was passed by the House of Representatives with only Republicans votes, proposed cutting $880 billion from the Standing Committee for Energy and Commerce, which includes many areas, such as Medicaid and Medicare. On July 4, 2025, President Donald Trump signed the One Big Beautiful Bill Act, intended in part to implement this resolution. The act cut Medicaid in a number of ways: while it did not repeal the ACA's Medicaid expansion, it mandated work requirements for able-bodied Medicaid recipients. It also requires Medicaid recipients above the federal poverty line to pay more fees for coverage; adds new verification requirements; increases the number of times states need to check the eligibility of their Medicaid expansion recipients; prohibits Medicaid from funding nonprofits that provide abortion care; makes it harder for illegal immigrants to use Medicaid; bans pharmacy benefit managers from using spread pricing; and puts limits on so-called "provider taxes" that states impose on healthcare providers to fund their portion of Medicaid spending. The non-partisan Congressional Budget Office (CBO) estimated that it will reduce the number of people on Medicaid by several million.; the CBO estimates that the work requirements in particular will lead 11 million to lose their Medicaid coverage, many of whom already work or qualify for exemptions but will not be able to get through the red tape. The bill prompted claims that undocumented immigrants are on Medicaid. Undocumented immigrants are already ineligible for full Medicaid benefits, and many undocumented immigrants access state-funded health programs rather than federal Medicaid. According to a CBO analysis, the bill's provisions could lead some states to cut back those state-funded health programs, potentially causing an estimated 1.4 million people to lose state-level health coverage, including undocumented immigrants. When commenting on the Trump administration's One Big Beautiful Bill Act and the impact of the Medicaid provisions on the economy, USDA Secretary Brooke Rollins stated that 34 million able-bodied adults on Medicaid should be working.
Arizona: AHCCCS California: Medi-Cal Connecticut: HUSKY D Illinois: HealthChoice Illinois Iowa: Hawk-i Healthy and Well-Kids in Iowa Maine: MaineCare Massachusetts: MassHealth New Jersey: NJ FamilyCare Oregon: Oregon Health Plan Oklahoma: Soonercare Tennessee: TennCare Washington: Washington Apple Health Wisconsin: BadgerCare As of January 2012, Medicaid and/or CHIP funds could be obtained to help pay employer health care premiums in Alabama, Alaska, Arizona, Colorado, Florida, and Georgia. Differences by state While states have significant autonomy in implementing the Medicaid program, their flexibility is bounded by federal requirements designed to ensure a baseline of coverage and access. For example, federal law mandates that certain services, such as inpatient and outpatient hospital services, laboratory and X-ray services, and physician services, must be covered by all state Medicaid programs. Additionally, states must adhere to federal guidelines regarding beneficiary protections and quality standards.
S
Q205398 EXACT TITLE 1.000
QID OVERLAP: Q205398 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (41): "addition", "administration", "advocacy", "agencies", "assessments", "become", "change", "communities", "community", "counseling", "depression", "development", "directly", "divided", "education", "families", "family", "group", "individual", "labor".... | EXACT TITLE in senior_services: "Social work". | EXACT TITLE in mental_health: "Social work".
additionadministrationadvocacyagenciesassessmentsbecomechangecommunitiescommunitycounselingdepressiondevelopmentdirectlydividededucationfamiliesfamilygroupindividuallaborlawmanagementneedsorganizationspolicypovertypracticepressureprivateproviding+11
rking with government agencies. Starting in the 1960s, a few universities began social work management programmes, to prepare students for the management of social and human service organizations, in addition to classical social work education. The social work profession developed in the 19th century, with some of its roots in voluntary philanthropy and in grassroots organizing. However, responses to social needs had existed long before then, primarily from public almshouses, private charities and religious organizations.
group therapy or providing services for community agencies. Macro-work involves fostering change on a larger scale through advocacy, social policy, research development, non-profit and public service administration, or working with government agencies. Starting in the 1960s, a few universities began social work management programmes, to prepare students for the management of social and human service organizations, in addition to classical social work education. The social work profession developed in the 19th century, with some of its roots in voluntary philanthropy and in grassroots organizing. However, responses to social needs had existed long before then, primarily from public almshouses, private charities and religious organizations.
The practice and profession of social work has a relatively modern and scientific origin, and is generally considered to have developed out of three strands. The first was individual casework, a strategy pioneered by the Charity Organization Society in the mid-19th century, which was founded by Helen Bosanquet and Octavia Hill in London, England. Most historians identify COS as the pioneering organization of the social theory that led to the emergence of social work as a professional occupation. COS had its main focus on individual casework. The second was social administration, which included various forms of poverty relief – 'relief of paupers'. Statewide poverty relief could be said to have its roots in the English Poor Laws of the 17th century but was first systematized through the efforts of the Charity Organization Society. The third consisted of social action – rather than engaging in the resolution of immediate individual requirements, the emphasis was placed on political action working through the community and the group to improve their social conditions and thereby alleviate poverty. This approach was developed originally by the Settlement House Movement. This was accompanied by a less easily defined movement; the development of institutions to deal with the entire range of social problems. All had their most rapid growth during the nineteenth century, and laid the foundation basis for modern social work, both in theory and in practice. Professional social work originated in 19th century England, and had its roots in the social and economic upheaval wrought by the Industrial Revolution, in particular, the societal struggle to deal with the resultant mass urban-based poverty and its related problems.
D
Q12131 EXACT TITLE 1.000
QID OVERLAP: Q12131 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (49): "ability", "access", "acquired", "against", "around", "barriers", "categories", "centers", "community", "condition", "created", "defines", "developmental", "different", "disability", "disabled", "effective", "experience", "foster", "framework".... | EXACT TITLE in senior_services: "Disability". | EXACT TITLE in mental_health: "Disability".
abilityaccessacquiredagainstaroundbarrierscategoriescenterscommunityconditioncreateddefinesdevelopmentaldifferentdisabilitydisabledeffectiveexperiencefosterframeworkhistoryindividualintegrationinteractionlanguagelawlegalmakesmediamedical+19
Disability is the experience of any condition that makes it more difficult for a person to do certain activities or have equitable access within a given society. Disabilities may be cognitive, developmental, intellectual, mental, physical, sensory, or a combination of multiple factors. Disabilities can be present from birth or can be acquired during a person's lifetime. Historically, disabilities have only been recognized based on a narrow set of criteria—however, disabilities are not binary and can present uniquely depending on the individual. A disability may be easily visible, or invisible in nature.
rson's lifetime. Historically, disabilities have only been recognized based on a narrow set of criteria—however, disabilities are not binary and can present uniquely depending on the individual. A disability may be easily visible, or invisible in nature. The United Nations Convention on the Rights of Persons with Disabilities defines disability as including: long-term physical, mental, intellectual or sensory impairments which in interaction with various barriers may hinder [a person's] full and effective participation in society on an equal basis with others.Disabilities have been perceived differently throughout history, through a variety of different theoretical lenses. There are two main models that attempt to explain disability in our society: the medical model and the social model. The medical model serves as a theoretical framework that considers disability as an undesirable medical condition that requires specialized treatment. Those who ascribe to the medical model tend to focus on finding the root causes of disabilities, as well as any cures—such as assistive technology. The social model centers disability as a societally-created limitation on individuals who do not have the same ability as the majority of the population. Those who ascribe to the social model tend to focus on accessibility and social/cultural attitudes toward disability. Although the medical model and social model are the most common frames for disability, there are a multitude of other models that theorize disability. Like many social categories, the concept of "disability" is under heavy discussion amongst academia, the medical and legal worlds, and the disability community. There are many terms that explain aspects of disability. While some terms solely exist to describe phenomena pertaining to disability, others have been centered around stigmatizing and ostracizing those with disabilities. Some terms have such a negative connotation that they are considered to be slurs. A point of contention is whether it is appropriate to use person-first language (i.e. a person who is disabled) or identity-first language (i.e. a disabled person) when referring to disability and an individual. Due to the marginalization of disabled people, there have been several activist causes that push for equitable treatment and access in society. Disability activists have fought to receive equal and equitable rights under the law—though there are still political issues that enable or advance the oppression of disabled people. Although disability activism serves to dismantle ableist systems, social norms relating to the perception of disabilities are often reinforced by tropes used by the media. Since negative perceptions of disability are pervasive in modern society, disabled people have turned to self-advocacy in an attempt to push back against their marginalization. The recognition of disability as an identity that is experienced differently based on the other multi-faceted identities of the individual is one often pointed out by disabled self-advocates. The ostracization of disability from mainstream society has created the opportunity for a disability culture to emerge.
y and can present uniquely depending on the individual. A disability may be easily visible, or invisible in nature. The United Nations Convention on the Rights of Persons with Disabilities defines disability as including: long-term physical, mental, intellectual or sensory impairments which in interaction with various barriers may hinder [a person's] full and effective participation in society on an equal basis with others.Disabilities have been perceived differently throughout history, through a variety of different theoretical lenses. There are two main models that attempt to explain disability in our society: the medical model and the social model. The medical model serves as a theoretical framework that considers disability as an undesirable medical condition that requires specialized treatment. Those who ascribe to the medical model tend to focus on finding the root causes of disabilities, as well as any cures—such as assistive technology. The social model centers disability as a societally-created limitation on individuals who do not have the same ability as the majority of the population. Those who ascribe to the social model tend to focus on accessibility and social/cultural attitudes toward disability. Although the medical model and social model are the most common frames for disability, there are a multitude of other models that theorize disability. Like many social categories, the concept of "disability" is under heavy discussion amongst academia, the medical and legal worlds, and the disability community. There are many terms that explain aspects of disability. While some terms solely exist to describe phenomena pertaining to disability, others have been centered around stigmatizing and ostracizing those with disabilities. Some terms have such a negative connotation that they are considered to be slurs. A point of contention is whether it is appropriate to use person-first language (i.e. a person who is disabled) or identity-first language (i.e. a disabled person) when referring to disability and an individual. Due to the marginalization of disabled people, there have been several activist causes that push for equitable treatment and access in society. Disability activists have fought to receive equal and equitable rights under the law—though there are still political issues that enable or advance the oppression of disabled people. Although disability activism serves to dismantle ableist systems, social norms relating to the perception of disabilities are often reinforced by tropes used by the media. Since negative perceptions of disability are pervasive in modern society, disabled people have turned to self-advocacy in an attempt to push back against their marginalization. The recognition of disability as an identity that is experienced differently based on the other multi-faceted identities of the individual is one often pointed out by disabled self-advocates. The ostracization of disability from mainstream society has created the opportunity for a disability culture to emerge.
Primary care
Q3259956 EXACT TITLE 1.000
QID OVERLAP: Q3259956 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (21): "care", "clinical", "condition", "contact", "continuing", "family", "general", "healthcare", "medicine", "nurse", "patient", "patients", "physical", "physician", "primary", "principal", "professional", "provider", "receive", "registered".... | EXACT TITLE in senior_services: "Primary care". | EXACT TITLE in mental_health: "Primary care".
careclinicalconditioncontactcontinuingfamilygeneralhealthcaremedicinenursepatientpatientsphysicalphysicianprimaryprincipalprofessionalproviderreceiveregisteredsystem
Primary care is the day-to-day healthcare given by a health care provider. Typically, this provider acts as the first contact and principal point of continuing care for patients within a healthcare system, and coordinates any additional care the patient may require. Patients commonly receive primary care from professionals such as a primary care physician (general practitioner or family physician), a physician assistant, a physical therapist, or a nurse practitioner. In some localities, such a professional may be a registered nurse, a pharmacist, a clinical officer (as in parts of Africa), or an Ayurvedic or other traditional medicine professional (as in parts of Asia).
of Africa), or an Ayurvedic or other traditional medicine professional (as in parts of Asia). Depending on the nature of the health condition, patients may then be referred for secondary or tertiary care. Background The World Health Organization attributes the provision of essential primary care as an integral component of an inclusive primary healthcare strategy. The WHO identifies five core functions of primary care: providing first-contact accessibility, continuity of care, coordinated integration of various patient services, comprehensive access to a full range of services, and finally people-centred care in which individual patient feedback is received. It aims to optimise population health and reduce disparities across the groups by ensuring equitable access to services for all subgroups. Primary care involves the widest scope of healthcare, including all ages of patients, patients of all socioeconomic and geographic origins, patients seeking to maintain optimal health, and patients with all manner of acute and chronic physical, mental and social health issues, including multiple chronic diseases. Consequently, a primary care practitioner must possess a wide breadth of knowledge in many areas. Continuity is a key characteristic of primary care, as patients usually prefer to consult the same practitioner for routine check-ups and preventive care, health education, and every time they require an initial consultation about a new health problem. Collaboration among providers is a desirable characteristic of primary care. The International Classification of Primary Care (ICPC) is a standardized tool for understanding and analyzing information on interventions in primary care by the reason for the patient visit. Common chronic illnesses usually treated in primary care may include, for example: hypertension, angina, diabetes, asthma, COPD, depression and anxiety, back pain, arthritis or thyroid dysfunction. Primary care also includes many basic maternal and child health care services, such as family planning services and vaccinations. In context of global population ageing, with increasing numbers of older adults at greater risk of chronic non-communicable diseases, rapidly increasing demand for primary care services is expected around the world, in both developed and developing countries. Funding for primary care varies a great deal between different countries: general taxation, national insurance systems, private insurance and direct payment by patients are all used, sometimes in combination. The payment system for primary care physicians also varies.
Depending on the nature of the health condition, patients may then be referred for secondary or tertiary care. Background The World Health Organization attributes the provision of essential primary care as an integral component of an inclusive primary healthcare strategy. The WHO identifies five core functions of primary care: providing first-contact accessibility, continuity of care, coordinated integration of various patient services, comprehensive access to a full range of services, and finally people-centred care in which individual patient feedback is received. It aims to optimise population health and reduce disparities across the groups by ensuring equitable access to services for all subgroups. Primary care involves the widest scope of healthcare, including all ages of patients, patients of all socioeconomic and geographic origins, patients seeking to maintain optimal health, and patients with all manner of acute and chronic physical, mental and social health issues, including multiple chronic diseases. Consequently, a primary care practitioner must possess a wide breadth of knowledge in many areas. Continuity is a key characteristic of primary care, as patients usually prefer to consult the same practitioner for routine check-ups and preventive care, health education, and every time they require an initial consultation about a new health problem. Collaboration among providers is a desirable characteristic of primary care. The International Classification of Primary Care (ICPC) is a standardized tool for understanding and analyzing information on interventions in primary care by the reason for the patient visit. Common chronic illnesses usually treated in primary care may include, for example: hypertension, angina, diabetes, asthma, COPD, depression and anxiety, back pain, arthritis or thyroid dysfunction. Primary care also includes many basic maternal and child health care services, such as family planning services and vaccinations. In context of global population ageing, with increasing numbers of older adults at greater risk of chronic non-communicable diseases, rapidly increasing demand for primary care services is expected around the world, in both developed and developing countries. Funding for primary care varies a great deal between different countries: general taxation, national insurance systems, private insurance and direct payment by patients are all used, sometimes in combination. The payment system for primary care physicians also varies.
Medicare (United States)
Q559392 EXACT TITLE 1.000
QID OVERLAP: Q559392 in senior_services (tier:evergreen) and mental_health (tier:branch). | SHARED TOKENS (33): "administration", "age", "alternative", "annual", "benefits", "care", "centers", "costs", "different", "disease", "divided", "group", "healthcare", "hospital", "insurance", "limits", "medicaid", "nursing", "older", "outpatient".... | EXACT TITLE in senior_services: "Medicare (United States)".
administrationagealternativeannualbenefitscarecenterscostsdifferentdiseasedividedgrouphealthcarehospitalinsurancelimitsmedicaidnursingolderoutpatientpaidpatientsplanprivateprogramprovidereceivereportreportsresearch+3
older and younger people with disabilities, including those with end stage renal disease and amyotrophic lateral sclerosis (ALS or Lou Gehrig's disease). It started in 1965 under the Social Security Administration and is now administered by the Centers for Medicare and Medicaid Services (CMS). Medicare is divided into four parts: A, B, C, and D. Part A covers hospital, skilled nursing, and hospice services. Part B covers outpatient services. Part C is an alternative that allows patients to choose private plans with different benefit structures that provide the same services as Parts A and B, usually with additional benefits. Part D is for self-administered prescription drugs. In 2022, Medicare provided health insurance for 65.0 million individuals—more than 57 million people aged 65 and older and about 8 million younger people. According to annual Medicare Trustees reports and research by Congress' MedPAC group, Medicare covers about half of healthcare expenses of those enrolled. Enrollees cover most of the remaining costs by taking additional private insurance (medi-gap insurance), by enrolling in a Medicare Part D prescription drug plan, or by joining a private Medicare Part C (Medicare Advantage) plan. In 2022, spending by the Medicare Trustees topped $900 billion per the Trustees report Table II.B.1, of which $423 billion came from the U.S. Treasury and the rest primarily from the Part A Trust Fund (which is funded by payroll taxes) and premiums paid by beneficiaries.
Originally, the name "Medicare" in the United States referred to a program providing medical care for families of people serving in the military as part of the Dependents' Medical Care Act, which was passed in 1956. President Dwight D. Eisenhower held the first White House Conference on Aging in January 1961, in which creating a health care program for social security beneficiaries was proposed. Various attempts were made in Congress to pass a bill providing for healthcare for the elderly, all without success. In 1963, however, a bill providing for both Medicare and an increase in Social Security benefits passed the Senate by 68–20 votes. As noted by one study, this was the first time that either chamber "had passed a bill embodying the principle of federal financial responsibility for health coverage, however limited it may have been." There was uncertainty over whether this bill would pass the House, however, as White House aide Henry Wilson's tally of House members’ votes on a conference bill that included Medicare “disclosed 180 “reasonably certain votes for Medicare, 29 “probable/possible,” 222 “against,” and 4 seats vacant.” Following the 1964 elections however, pro-Medicare forces obtained 44 votes in the House and 4 in the Senate. In July 1965, under the leadership of President Lyndon Johnson, Congress enacted Medicare under Title XVIII of the Social Security Act to provide health insurance to people age 65 and older, regardless of income or medical history. Johnson signed the Social Security Amendments of 1965 into law on July 30, 1965, at the Harry S. Truman Presidential Library in Independence, Missouri. Former president Harry S. Truman and his wife, former first lady Bess Truman, became the first recipients of the program. Before Medicare was created, approximately 60% of people over the age of 65 had health insurance (as opposed to about 70% of the population younger than that), with coverage often unavailable or unaffordable to many others, because older adults paid more than three times as much for health insurance as younger people. Many of this group (about 20% of the total in 2022, 75% of whom were eligible for all Medicaid benefits) became "dual eligible" for both Medicare and Medicaid (which was created by the same 1965 law). In 1966, Medicare spurred the racial integration of thousands of waiting rooms, hospital floors, and physician practices by making payments to health care providers conditional on desegregation. Medicare has undergone several major changes since 1965; provisions have expanded to include benefits for speech, physical, and chiropractic therapy in 1972. In the 1970s the option of payments to health maintenance organizations (HMOs) was added and in 1982, hospice benefits to aid elderly people on a temporary basis, which was made permanent in 1984. In 1972, Congress expanded Medicare eligibility to younger people with permanent disabilities who receive Social Security Disability Insurance (SSDI) payments and to those with end-stage renal disease (ESRD). Congress further expanded Medicare in 2001 to cover younger people with amyotrophic lateral sclerosis (ALS, or Lou Gehrig's disease). The association with HMOs that began in the 1970s was formalized and expanded under President Bill Clinton in 1997 as Medicare Part C (although not all Part C health plans sponsors have to be HMOs, about 75% are). In 2003, under President George W. Bush, a Medicare program for covering almost all self-administered prescription drugs was passed (and went into effect in 2006) as Medicare Part D. Administration The Centers for Medicare and Medicaid Services (CMS), a component of the U.S. Department of Health and Human Services (HHS), administers Medicare, Medicaid, the Children's Health Insurance Program (CHIP), the Clinical Laboratory Improvement Amendments (CLIA), and parts of the Affordable Care Act (ACA) ("Obamacare"). Along with the U.S. Departments of Labor and Treasury, the CMS also implements the insurance reform provisions of the Health Insurance Portability and Accountability Act of 1996 (HIPAA) and most aspects of the Patient Protection and Affordable Care Act of 2010 as amended. The Social Security Administration is responsible for determining Medicare eligibility, eligibility for and payment of Extra Help/Low Income Subsidy payments related to Parts C and D of Medicare, and collecting most premium payments for the Medicare program. The Chief Actuary of the CMS must provide accounting information and cost-projections to the Medicare Board of Trustees to assist them in assessing the program's financial health. The Trustees are required by law to issue annual reports on the financial status of the Medicare Trust Funds, and those reports are required to contain a statement of actuarial opinion by the Chief Actuary. The Specialty Society Relative Value Scale Update Committee (or Relative Value Update Committee; RUC), composed of physicians associated with the American Medical Association, advises the government about pay standards for Medicare patient procedures performed by doctors and other professionals under Medicare Part B. A similar but different CMS process determines the rates paid for acute care and other hospitals—including skilled nursing facilities—under Medicare Part A. The rates paid for both Part A and Part B type services under Part C are whatever is agreed upon between the sponsor and the provider.
The Centers for Medicare and Medicaid Services (CMS), a component of the U.S. Department of Health and Human Services (HHS), administers Medicare, Medicaid, the Children's Health Insurance Program (CHIP), the Clinical Laboratory Improvement Amendments (CLIA), and parts of the Affordable Care Act (ACA) ("Obamacare"). Along with the U.S. Departments of Labor and Treasury, the CMS also implements the insurance reform provisions of the Health Insurance Portability and Accountability Act of 1996 (HIPAA) and most aspects of the Patient Protection and Affordable Care Act of 2010 as amended. The Social Security Administration is responsible for determining Medicare eligibility, eligibility for and payment of Extra Help/Low Income Subsidy payments related to Parts C and D of Medicare, and collecting most premium payments for the Medicare program. The Chief Actuary of the CMS must provide accounting information and cost-projections to the Medicare Board of Trustees to assist them in assessing the program's financial health. The Trustees are required by law to issue annual reports on the financial status of the Medicare Trust Funds, and those reports are required to contain a statement of actuarial opinion by the Chief Actuary. The Specialty Society Relative Value Scale Update Committee (or Relative Value Update Committee; RUC), composed of physicians associated with the American Medical Association, advises the government about pay standards for Medicare patient procedures performed by doctors and other professionals under Medicare Part B. A similar but different CMS process determines the rates paid for acute care and other hospitals—including skilled nursing facilities—under Medicare Part A. The rates paid for both Part A and Part B type services under Part C are whatever is agreed upon between the sponsor and the provider.
Telehealth
Q46994 EXACT TITLE 1.000
QID OVERLAP: Q46994 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (46): "access", "actually", "administration", "application", "care", "clinical", "conditions", "continuous", "data", "defines", "education", "even", "facilities", "funding", "healthcare", "higher", "information", "integration", "limited", "management".... | EXACT TITLE in senior_services: "Telehealth". | EXACT TITLE in mental_health: "Telehealth".
accessactuallyadministrationapplicationcareclinicalconditionscontinuousdatadefineseducationevenfacilitiesfundinghealthcarehigherinformationintegrationlimitedmanagementmeansmedicalmedicinepatientpatientsphysicalphysicianpracticepractitionersprofessional+16
t an intervening health care provider." When rural settings, lack of transport, a lack of mobility, conditions due to outbreaks, epidemics or pandemics, decreased funding, or a lack of staff restrict access to care, telemedicine may bridge the gap and can even improve retention in treatment as well as provide distance-learning; meetings, supervision, and presentations between practitioners; online information and health data management and healthcare system integration.
gration. EHealth encompasses a wide range of applications, including but not limited to the following: Two clinicians discussing a case via video conference; Robotic surgery performed through remote access; Physical therapy conducted using digital monitoring instruments, live feed, and application combinations; Diagnostic tests transferred between facilities for interpretation by a higher specialist; Home monitoring through continuous transmission of patient health data; Online consultations between patients and practitioners; Video remote interpretation services for clinical visits.
Telehealth versus telemedicine Telehealth is sometimes discussed interchangeably with telemedicine, the latter being more common than the former. Telehealth has been described as a disruptive innovation in healthcare because it enables medical services to be delivered remotely using communication technologies. The Health Resources and Services Administration distinguishes telehealth from telemedicine in its scope, defining telemedicine only as describing remote clinical services, such as diagnosis and monitoring, while telehealth includes preventative, promotive, and curative care delivery. This includes the above-mentioned non-clinical applications, like administration and provider education. The United States Department of Health and Human Services states that the term telehealth includes "non-clinical services, such as provider training, administrative meetings, and continuing medical education", and that the term telemedicine means "remote clinical services". The World Health Organization uses telemedicine to describe all aspects of health care including preventive care. The American Telemedicine Association uses the terms telemedicine and telehealth interchangeably, although it acknowledges that telehealth is sometimes used more broadly for remote health not involving active clinical treatments. eHealth is another related term, used particularly in the U.K. and Europe, as an umbrella term that includes telehealth, electronic medical records, and other components of health information technology. Methods and modalities Telehealth requires good Internet access by participants, usually in the form of a strong, reliable broadband connection, and broadband mobile communication technology of at least the fourth generation (4G) or long-term evolution (LTE) standard to overcome issues with video stability and bandwidth restrictions. As broadband infrastructure has improved, telehealth usage has become more widely feasible. Healthcare providers often begin telehealth with a needs assessment which assesses hardships that can be improved by telehealth such as travel time, costs or time off work. Collaborators such as technology companies can ease the transition. Delivery can come within four distinct domains: live video (synchronous), store-and-forward (asynchronous), remote patient monitoring, and mobile health. Audio-based telemedicine, primarily through telephone consultations, has been studied as a tool for managing chronic conditions.
Centers for Medicare & Medicaid Services
Q5060058 EXACT TITLE 1.000
QID OVERLAP: Q5060058 in senior_services (tier:evergreen) and mental_health (tier:branch). | SHARED TOKENS (23): "addition", "administers", "administration", "agency", "care", "centers", "certification", "clinical", "department", "facilities", "financing", "gov", "healthcare", "insurance", "medicaid", "nursing", "program", "programs", "quality", "reports".... | EXACT TITLE in senior_services: "Centers for Medicare & Medicaid Services".
additionadministersadministrationagencycarecenterscertificationclinicaldepartmentfacilitiesfinancinggovhealthcareinsurancemedicaidnursingprogramprogramsqualityreportsresponsibilitiesstandardssystem
administers the Medicare program and works in partnership with state governments to administer Medicaid, the Children's Health Insurance Program (CHIP), and health insurance portability standards. In addition to these programs, CMS has other responsibilities, including the administrative simplification standards from the Health Insurance Portability and Accountability Act of 1996 (HIPAA), quality standards in long-term care facilities (more commonly referred to as nursing homes) through its survey and certification process, clinical laboratory quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States.
rtification process, clinical laboratory quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States. This includes maintaining the 5-Star Quality Rating System. Organization The agency carries out its responsibilities from its national headquarters located in Woodlawn, Maryland, and its 10 regional offices. It is organized around six centers to support its key functions.
History Originally, the name "Medicare" in the United States referred to a program providing medical care for families of people serving in the military as part of the Dependents' Medical Care Act, which was passed in 1956. President Dwight D. Eisenhower held the first White House Conference on Aging in January 1961, in which creating a health care program for social security beneficiaries was proposed. President Lyndon B. Johnson signed the Social Security Amendments on July 30, 1965, establishing both Medicare and Medicaid. Arthur E. Hess, a deputy commissioner of the Social Security Administration, was named as first director of the Bureau of Health Insurance in 1965, placing him as the first executive in charge of the Medicare program. At the time, the program provided health insurance to 19 million Americans. The Social Security Administration (SSA) became responsible for the administration of Medicare and the Social and Rehabilitation Service (SRS) became responsible for the administration of Medicaid. Both agencies were organized under what was then known as the Department of Health, Education, and Welfare (HEW), in 1965. Since then, HEW, has been reorganized as the Department of Health and Human Services (HHS) in 1980. This consequently brought Medicare and Medicaid under the jurisdiction of the HHS. In March 1977, the Health Care Financing Administration (HCFA) was established under HEW. HCFA became responsible for the coordination of Medicare and Medicaid. The responsibility for enrolling beneficiaries into Medicare and processing premium payments remained with SSA. HCFA was renamed the Centers for Medicare & Medicaid Services on July 1, 2001. This was later codified in law by the Medicare Prescription Drug, Improvement, and Modernization Act of 2003. In 2013, a report by the inspector general found that CMS had paid $23 million in benefits to deceased beneficiaries in 2011. In April 2014, CMS released raw claims data from 2012 that gave a look into what types of doctors billed Medicare the most. In January 2018, CMS released guidelines for states to use to require Medicaid beneficiaries to continue receiving coverage. These guidelines came in response to then-President Trump's announcement that he would allow states to impose work requirements in Medicaid. In October, CMS reported a data breach of 75,000 people's personal data due to a hack. In February 2018, CMS removed a notice from its website that informed insurance companies they were not allowed to charge physicians a fee when the companies paid the doctors for their work. This has resulted in doctors being charged up to a 5% fee on their compensation, adding up to billions of dollars annually. In January 2021, CMS passed a rule that would cover "breakthrough technology" for four years after they received FDA approval. In September 2021, CMS submitted a proposal to repeal the rule based on safety concerns. On September 19, 2023, the Subcommittee on Health held a hearing titled "Examining Policies to Improve Seniors’ Access to Innovative Drugs, Medical Devices, and Technology." Dora Hughes, the acting director of the Center for Clinical Standards and Quality at the U.S. Centers for Medicare and Medicaid Services (CMS), defended the proposed Transitional Coverage for Emerging Technologies (TCET) pathway, which aims to restrict coverage for breakthrough medical devices to five reviews a year. Some lawmakers and medtech trade groups called for expanding the pathway to include diagnostics.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "idaho", "local", "metropolitan", "owyhee", "payette", "reflect", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in senior_services: "Treasure Valley". | EXACT TITLE in mental_health: "Treasure Valley".
associationboiseidaholocalmetropolitanowyheepayettereflectregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise State University
Q891082 EXACT TITLE 0.960
QID OVERLAP: Q891082 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (13): "among", "boise", "classified", "doctoral", "education", "idaho", "independent", "program", "programs", "public", "reported", "research", "university". | EXACT TITLE in senior_services: "Boise State University". | EXACT TITLE in mental_health: "Boise State University".
amongboiseclassifieddoctoraleducationidahoindependentprogramprogramspublicreportedresearchuniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho State University
Q1656608 EXACT TITLE 0.920
QID OVERLAP: Q1656608 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (11): "among", "classified", "doctoral", "idaho", "isu", "meridian", "programs", "public", "research", "students", "university". | EXACT TITLE in senior_services: "Idaho State University". | EXACT TITLE in mental_health: "Idaho State University".
amongclassifieddoctoralidahoisumeridianprogramspublicresearchstudentsuniversity
ted States. Founded in 1901 as the Academy of Idaho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
Established in 2011, the Career Path Internship (CPI) program provides students an opportunity to gain professional experience while in school. All CPI internships are paid positions that are aligned with the student's major or career goals. In 2016 the CPI program provided professional experience in approximately 1,000 internships both on and off campus. The CPI program has seen exceptional growth in past years with a 2016 budget estimated at $2.3 million. ISU offers two doctoral level nursing programs after the Idaho State Board of Education approved a doctoral degree in advanced nursing practice, which will now give ISU two doctoral-level nursing programs. The first offered is a Doctor of Philosophy (Ph.D.) degree in nursing beginning summer 2013 and the only one in the state. ISU received top designation for nuclear training and was tagged Regional Center of Excellence. The Energy Systems Technology and Education Center (ESTEC) at the ISU College of Technology will soon be coordinating the nuclear energy education and training for technicians in a nine-state region. The Nuclear Energy Institute (NEI) has designated ESTEC as the Northwest Regional Center of Excellence for Nuclear Education and Training. The top designation includes the states of Idaho, Montana, Washington, Oregon, South Dakota, North Dakota, Utah, and Nebraska. ESTEC is one of five regional NEI-designated centers in the country. ISU's new doctoral experimental psychology program, the only program of its type in Idaho, accepted its first three students fall 2011. The new experimental psychology doctoral program complements ISU's doctoral clinical psychology program, created in the early 1990s. Eventually, the experimental psychology program plans to accept six students annually. A new Idaho State University geosciences doctoral program is approved to begin in August 2013. The Center for Sports Concussion at ISU, opened in 2009, is housed within the Department of Sport Science and Physical Education. The purpose of the Center for Sports Concussion is to offer educational outreach on concussion identification and management practices to athletic administrators, coaches, and parent groups throughout Idaho in accordance with Idaho law and demonstrated need, and to facilitate baseline and post-concussion neuro-cognitive testing to athletes participating in sports programs throughout eastern Idaho. The university awards The Teaching Literature Book Award for the best book on teaching literature at the post-secondary or graduate level. The prize is conferred in odd numbered years, and the inaugural award was conferred in 2015.
Boise metropolitan area
Q4938481 QID OVERLAP 0.800
QID OVERLAP: Q4938481 in senior_services (tier:branch) and mental_health (tier:evergreen). | SHARED TOKENS (17): "ada", "anchored", "boise", "canyon", "counties", "designated", "gem", "idaho", "meridian", "metropolitan", "nampa", "owyhee", "payette", "population", "section", "treasure", "valley".
adaanchoredboisecanyoncountiesdesignatedgemidahomeridianmetropolitannampaowyheepayettepopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Health Insurance Portability and Accountability Act
Q606563 QID OVERLAP 0.800
QID OVERLAP: Q606563 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (30): "businesses", "care", "cases", "change", "confidentiality", "consent", "coverage", "entity", "families", "family", "governs", "group", "healthcare", "information", "insurance", "law", "life", "limited", "medical", "members"....
businessescarecaseschangeconfidentialityconsentcoverageentityfamiliesfamilygovernsgrouphealthcareinformationinsurancelawlifelimitedmedicalmembersnationalpatientpatientsprovidersprovisionsrequiresstandardstitletransferworkers
althcare and healthcare insurance industries should be protected from fraud and theft, and addressed some limitations on healthcare insurance coverage. It generally prohibits healthcare providers and businesses called covered entities from disclosing protected information to anyone other than a patient and the patient's authorized representatives without their consent. The law does not restrict patients from accessing their own information, except in limited cases.
As of March 2013, the United States Department of Health and Human Services (HHS) has investigated over 19,306 cases that have been resolved by requiring changes in privacy practice or by corrective action. If HHS determines noncompliance, entities must apply corrective measures. Complaints have been investigated against many different types of businesses, such as national pharmacy chains, major health care centers, insurance groups, hospital chains, and other small providers. There were 9,146 cases where the HHS investigation found that HIPAA was followed correctly.
Kassebaum Act) is a United States Act of Congress enacted by the 104th United States Congress and signed into law by President Bill Clinton on August 21, 1996. It aimed to alter the transfer of healthcare information and stipulated guidelines by which personally identifiable information maintained by the healthcare and healthcare insurance industries should be protected from fraud and theft, and addressed some limitations on healthcare insurance coverage. It generally prohibits healthcare providers and businesses called covered entities from disclosing protected information to anyone other than a patient and the patient's authorized representatives without their consent. The law does not restrict patients from accessing their own information, except in limited cases.
Health insurance in the United States
Q5691099 QID OVERLAP 0.800
QID OVERLAP: Q5691099 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (41): "addition", "against", "approximately", "associated", "benefits", "cannot", "care", "commercial", "costs", "coverage", "covering", "different", "disability", "expansion", "insurance", "major", "medicaid", "medical", "needs", "nursing"....
additionagainstapproximatelyassociatedbenefitscannotcarecommercialcostscoveragecoveringdifferentdisabilityexpansioninsurancemajormedicaidmedicalneedsnursingoverviewpaidpaypopulationpracticesprivateprogramprogramsprotectprovide+11
In a more technical sense, the term "health insurance" is used to describe any form of insurance providing protection against the costs of medical services. This usage includes both private insurance programs and social insurance programs such as Medicare, which pools resources and spreads the financial risk associated with major medical expenses across the entire population to protect everyone, as well as social welfare programs like Medicaid and the Children's Health Insurance Program, which both provide assistance to people who cannot afford health coverage. In addition to medical expense insurance, "health insurance" may also refer to insurance covering disability or long-term nursing or custodial care needs. Different health insurance provides different levels of financial protection and the scope of coverage can vary widely, with more than 40% of insured individuals reporting that their plans do not adequately meet their needs as of 2007. Major federal regulatory reforms, such as the enactment of Medicare and Medicaid in 1965 and the Affordable Care Act in 2010, have substantially reduced the number of uninsured Americans. In American politics, the Democratic Party tends to support public expansions in health insurance coverage while the Republican Party opposes it, with Republicans opposing Medicaid Expansion and supporting Affordable Care Act repeal. In 2023, it has been reported that approximately 25.3 million non-elderly Americans lacked health insurance, a decrease compared to 2019. The United States spends vastly more on health care than comparable countries, which has been attributed in large part to inefficiencies and anti-competitive practices in its health insurance system.
The rise of employer-sponsored coverage Some of the first evidence of compulsory health insurance in the United States was in 1915, through the progressive reform protecting workers against medical costs and sicknesses in industrial America. Prior to this, within the Socialist and Progressive parties, health insurance and coverage was framed as not only an economic right for workers' health, but also as an employer's responsibility and liability—healthcare was in this context centered on working-class Americans and labor unions. Employer-sponsored health insurance plans dramatically expanded as a direct result of wage controls imposed by the federal government during World War II. The labor market was tight because of the increased demand for goods and decreased supply of workers during the war. Federally imposed wage and price controls prohibited manufacturers and other employers from raising wages enough to attract workers. When the War Labor Board declared that fringe benefits, such as sick leave and health insurance, did not count as wages for the purpose of wage controls, employers responded with significantly increased offers of fringe benefits, especially health care coverage, to attract workers. The tax deduction was later codified in the Revenue Act of 1954. President Harry S. Truman proposed a system of public health insurance in his November 19, 1945, address. He envisioned a national system that would be open to all Americans, but would remain optional. Participants would pay monthly fees into the plan, which would cover the cost of any and all medical expenses that arose in a time of need. The government would pay for the cost of services rendered by any doctor who chose to join the program. In addition, the insurance plan would give cash to the policy holder to replace wages lost because of illness or injury. The proposal was quite popular with the public, but it was fiercely opposed by the Chamber of Commerce, the American Hospital Association, and the AMA, which denounced it as "socialism". Foreseeing a long and costly political battle, many labor unions chose to campaign for employer-sponsored coverage, which they saw as a less desirable but more achievable goal, and as coverage expanded, the national insurance system lost political momentum and ultimately failed to pass. Using health care and other fringe benefits to attract the best employees, private sector, white-collar employers nationwide expanded the U.S. health care system. Public sector employers followed suit in an effort to compete. Between 1940 and 1960, the total number of people enrolled in health insurance plans grew seven-fold, from 20,662,000 to 142,334,000, and by 1958, 75% of Americans had some form of health coverage.
California In 2007, 87% of Californians had some form of health insurance. Services in California range from private offerings: HMOs, PPOs to public programs: Medi-Cal, Medicare, and Healthy Families (SCHIP). Insurers can pay providers a capitation only in the case of HMOs. California is one of the few states to have an office devoted to giving people tips and resources to get the best care possible. California's Office of the Patient Advocate was established July 2000 to publish a yearly Health Care Quality Report Card on the top HMOs, PPOs, and medical groups and to create and distribute helpful tips and resources to give Californians the tools needed to get the best care. Additionally, California's Help Center assists Californians with problems with their health insurance. The Help Center is run by the Department of Managed Health Care, the government department that oversees and regulates HMOs and some PPOs. In 2024, California became the first U.S.
I
Q30253346 EXACT TITLE 0.800
QID OVERLAP: Q30253346 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (5): "agency", "department", "idaho", "public", "welfare". | EXACT TITLE in senior_services: "Idaho Department of Health and Welfare". | EXACT TITLE in mental_health: "Idaho Department of Health and Welfare".
agencydepartmentidahopublicwelfare
Idaho Department of Health and Welfare is a public health agency in the state of Idaho. History The department was founded in 1972. Functions The department provides healthcare services, records management, children and family services, food assistance programs, and healthcare services.
Healthcare in the United States
Q1358017 QID OVERLAP 0.800
QID OVERLAP: Q1358017 in senior_services (tier:evergreen) and mental_health (tier:evergreen). | SHARED TOKENS (47): "access", "address", "among", "approximately", "around", "association", "care", "construction", "costs", "coverage", "delivered", "disabled", "early", "education", "established", "expansion", "facilities", "funding", "future", "healthcare"....
accessaddressamongapproximatelyaroundassociationcareconstructioncostscoveragedelivereddisabledearlyeducationestablishedexpansionfacilitiesfundingfuturehealthcarehigherhospitalincomeinsuranceledmedicaidmedicalmodeloutcomespaid+17
gislation such as the Affordable Care Act of 2010 has sought to address some of these issues, though challenges and reform debate remain. Uninsured rates have fluctuated over time, and disparities in access to care exist based on factors such as income, race, and geographical location. The private insurance model predominates, and employer-sponsored insurance is a common way for individuals to obtain coverage. The complex nature of the system, as well as its high costs, has led to ongoing discussions about the future of healthcare in the United States. At the same time, the United States is a global leader in medical innovation, measured either in terms of revenue or the number of new drugs and medical devices introduced. The Foundation for Research on Equal Opportunity concluded that the United States dominates science and technology, which "was on full display during the COVID-19 pandemic, as the U.S. government delivered coronavirus vaccines far faster than anyone had ever done before", but lags behind in fiscal sustainability, with "government spending ... growing at an unsustainable rate." In the early 20th century, advances in medical technology and a focus on public health contributed to a shift in healthcare. The American Medical Association (AMA) worked to standardize medical education, and the introduction of employer-sponsored insurance plans marked the beginning of the modern health insurance system. More people were starting to get involved in healthcare, such as state actors, other professionals/practitioners, patients and clients, the judiciary, and business interests and employers. They had interest in medical regulations of professionals to ensure that services were provided by trained and educated people to minimize harm. The post–World War II era saw a significant expansion in healthcare where more opportunities were offered to increase accessibility of services.
sure that services were provided by trained and educated people to minimize harm. The post–World War II era saw a significant expansion in healthcare where more opportunities were offered to increase accessibility of services.
According to a statistical brief by the Healthcare Cost and Utilization Project (HCUP), there were 35.7 million hospitalizations in 2016, a significant decrease from the 38.6 million in 2011. For every 1,000 in the population, there was an average of 104.2 stays and each stay averaged $11,700 (equivalent to $15,696 in 2025), an increase from the $10,400 (equivalent to $14,585 in 2025) cost per stay in 2012. Approximately 7.6% of the population had overnight stays in 2017, each stay lasting an average of 4.6 days. A study by the National Institutes of Health reported that the lifetime per capita expenditure at birth, using the year 2000 dollars, showed a large difference between the healthcare costs of females ($361,192, equivalent to $675,272 in 2025) and males ($268,679, equivalent to $502,313 in 2025). A large portion of this cost difference is in the shorter lifespan of men, but, even after adjustment for age (assuming men live as long as women), there still is a 20% difference in lifetime healthcare expenditures. Health insurance and accessibility Unlike most developed nations, the US health system does not provide healthcare to the country's entire population. In 1977, the United States was said to be the only industrialized country not to have some form of national health insurance or direct healthcare provision to citizens through a nationalized healthcare system. A 1978 study argued that "Today every government in the world – including Red China with its squadrons of semi-trained 'barefoot doctors' – realizes it has a responsibility to keep its citizens in good physical and mental health. Unlike the U.S., nations like Scandinavia, the U.K., Ireland, Japan and others have opted for a universal health care system in which the state pays everyone's medical bills." Instead, most citizens are covered by a combination of private insurance and various federal and state programs. As of 2017, health insurance was most commonly acquired through a group plan tied to an employer, covering 150 million people. Other major sources include Medicaid, covering 70 million, Medicare, 50 million, and health insurance marketplaces created by the ACA covering around 17 million. In 2017, a study found that 73% of plans on ACA marketplaces had narrow networks, limiting access and choice in providers. Healthcare coverage is provided through a combination of private health insurance and public health coverage (e.g., Medicare, Medicaid). In 2013, 64% of health spending was paid for by the government, and funded via programs such as Medicare, Medicaid, the Children's Health Insurance Program, Tricare, and the Veterans Health Administration. People aged under 65 acquire insurance via their or a family member's employer, by purchasing health insurance on their own, getting government and/or other assistance based on income or another condition, or are uninsured. Health insurance for public sector employees is primarily provided by the government in its role as employer.
Clinical psychology
Q199906 QID OVERLAP 0.800
QID OVERLAP: Q199906 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (40): "administration", "advanced", "assessment", "behavioral", "clinic", "clinical", "consultation", "development", "different", "disorders", "educational", "family", "field", "growth", "heavily", "idaho", "integration", "knowledge", "medical", "medicine"....
administrationadvancedassessmentbehavioralclinicclinicalconsultationdevelopmentdifferentdisorderseducationalfamilyfieldgrowthheavilyidahointegrationknowledgemedicalmedicinemodelneedpracticepractitionersprimaryproceduresprogramprovidingpsychologicalregulated+10
ogical assessment, diagnosis, clinical formulation, and psychotherapy; although clinical psychologists also engage in research, teaching, consultation, forensic testimony, and program development and administration. In many countries, clinical psychology is a regulated mental health profession. The field is generally considered to have begun in 1896 with the opening of the first psychological clinic at the University of Pennsylvania by Lightner Witmer. In the first half of the 20th century, clinical psychology was focused on psychological assessment, with little attention given to treatment. This changed after the 1940s when World War II resulted in the need for a large increase in the number of trained clinicians. Since that time, three main educational models have developed in the US—the PhD Clinical Science model (heavily focused on research), the PhD science-practitioner model (integrating scientific research and practice), and the PsyD practitioner-scholar model (focusing on clinical theory and practice). In the UK and Ireland, the Clinical Psychology Doctorate falls between the latter two of these models, whilst in much of mainland Europe, the training is at the master's level and predominantly psychotherapeutic. Clinical psychologists are expert in providing psychotherapy, and generally train within four primary theoretical orientations—psychodynamic, humanistic, cognitive behavioral therapy (CBT), and systems or family therapy. Clinical psychology is different from psychiatry. Although practitioners in both fields are experts in mental health, clinical psychologists are experts in psychological assessment, including neuropsychological and psychometric assessment, and they treat mental disorders primarily through psychotherapy. Currently, eight US states (Louisiana, New Mexico, Illinois, Iowa, Idaho, Colorado, Utah and, most recently, Vermont) allow clinical psychologists with advanced specialty training to prescribe psychotropic medications. Psychiatrists are medical doctors who specialize in the treatment of mental disorders via a variety of methods, including diagnostic assessment, psychotherapy, psychoactive medications, and medical procedures such as electroconvulsive therapy (ECT) or transcranial magnetic stimulation (TMS).
World War II and the integration of treatment When World War II broke out, the military once again called upon clinical psychologists. As soldiers began to return from combat, psychologists started to notice symptoms of psychological trauma labeled "shell shock" (eventually to be termed post-traumatic stress disorder) that were best treated as soon as possible. Because physicians (including psychiatrists) were over-extended in treating bodily injuries, psychologists were called to help treat this condition. At the same time, female psychologists (who were excluded from the war effort) formed the National Council of Women Psychologists with the purpose of helping communities deal with the stresses of war and giving young mothers advice on child rearing. After the war, the Veterans Administration in the US made an enormous investment to set up programs to train doctoral-level clinical psychologists to help treat the thousands of veterans needing care. As a consequence, the US went from having no formal university programs in clinical psychology in 1946 to over half of all PhDs in psychology in 1950 being awarded in clinical psychology. WWII helped bring dramatic changes to clinical psychology, not just in America but internationally as well. Graduate education in psychology began adding psychotherapy to the science and research focus based on the 1947 scientist-practitioner model, known today as the Boulder Model, for PhD programs in clinical psychology.
Clinical psychologists engage in a wide range of activities. Some focus solely on research into the assessment, treatment, or cause of mental illness and related conditions. Some teach, whether in a medical school or hospital setting, or in an academic department (e.g., psychology department) at an institution of higher education. The majority of clinical psychologists engage in some form of clinical practice, with professional services including psychological assessment, provision of psychotherapy, development and administration of clinical programs, and forensics (e.g., providing expert testimony in a legal proceeding). In clinical practice, clinical psychologists may work with individuals, couples, families, or groups in a variety of settings, including private practices, hospitals, mental health organizations, schools, businesses, and non-profit agencies. Clinical psychologists who provide clinical services may also choose to specialize. Some specializations are codified and credentialed by regulatory agencies within the country of practice.
Medical education
Q126945 QID OVERLAP 0.800
QID OVERLAP: Q126945 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (16): "become", "continuing", "education", "educational", "field", "initial", "medical", "physician", "practice", "professional", "related", "requirements", "research", "specific", "teaching", "training".
becomecontinuingeducationeducationalfieldinitialmedicalphysicianpracticeprofessionalrelatedrequirementsresearchspecificteachingtraining
Medical education is education related to the practice of being a medical practitioner, including the initial training to become a physician (i.e., medical school and internship) and additional training thereafter (e.g., residency, fellowship, and continuing medical education). Medical education and training varies considerably across the world. Various teaching methodologies have been used in medical education, which is an active area of educational research. Medical education is also the subject-didactic academic field of educating medical doctors at all levels, including entry-level, post-graduate, and continuing medical education.
n, which is an active area of educational research. Medical education is also the subject-didactic academic field of educating medical doctors at all levels, including entry-level, post-graduate, and continuing medical education. Specific requirements such as entrustable professional activities must be met before moving on in stages of medical education. Common techniques and evidence base Medical education applies theories of pedagogy specifically in the context of medical education. Medical education has been a leader in the field of evidence-based education, through the development of evidence syntheses such as the Best Evidence Medical Education collection, formed in 1999, which aimed to "move from opinion-based education to evidence-based education". Common evidence-based techniques include the Objective structured clinical examination (OSCE) to assess clinical skills, and reliable checklist-based assessments to determine the development of soft skills such as professionalism.
Following completion of entry-level training, newly graduated doctors are often required to undertake a period of supervised practice before full registration is granted; this is most often of one-year duration and may be referred to as an "internship," "provisional registration," or "residency". Further training in a particular field of medicine may be undertaken. In the U.S., further specialized training, completed after residency is referred to as "fellowship". In some jurisdictions, this is commenced immediately following completion of entry-level training, while other jurisdictions require junior doctors to undertake generalist (non-specialty) training for a number of years before commencing specialization. Each residency and fellowship program is accredited by the Accreditation Council for Graduate Medical Education (ACGME), a non-profit organization led by physicians with the goal of enhancing educational standards among physicians. The ACGME oversees all M.D. and D.O. residency programs in the United States. As of 2019, there were approximately 11,700 ACGME accredited residencies and fellowship programs in 181 specialties and subspecialties. Education theory itself is becoming an integral part of postgraduate medical training. Formal qualifications in education are also becoming the norm for medical educators, such that there has been a rapid increase in the number of available graduate programs in medical education. Continuing medical education In most countries, continuing medical education (CME) courses are required for continued licensing. CME requirements vary by state and by country. In the US, accreditation is overseen by the Accreditation Council for Continuing Medical Education (ACCME). Physicians often attend dedicated lectures, grand rounds, conferences, and performance improvement activities in order to fulfill their requirements.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (25): "capital", "category", "changes", "control", "described", "development", "evaluations", "expansion", "financing", "firms", "general", "investment", "investor", "limited", "management", "operational", "ownership", "private", "provide", "public"....
capitalcategorychangescontroldescribeddevelopmentevaluationsexpansionfinancingfirmsgeneralinvestmentinvestorlimitedmanagementoperationalownershipprivateprovidepublicratherrolespecializedspecificstrategy
take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
e investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
r an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
T
Q7842827 QID OVERLAP 0.800
QID OVERLAP: Q7842827 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (16): "care", "clinics", "continuing", "facilities", "healthcare", "hospital", "hospitals", "idaho", "network", "operates", "operating", "outpatient", "patients", "physicians", "support", "system".
careclinicscontinuingfacilitieshealthcarehospitalhospitalsidahonetworkoperatesoperatingoutpatientpatientsphysicianssupportsystem
Trinity Health is an American not-for-profit Catholic health system operating 92 hospitals in 22 states, including 120 continuing care locations encompassing home care, hospice, PACE and senior living facilities. Based in Livonia, Michigan, Trinity Health employs more than 120,000 people including 5,300 physicians. Sponsored by Catholic Health Ministries, Trinity Health operates facilities in the US states of Alabama, California, Connecticut, Delaware, Florida, Georgia, Idaho, Illinois, Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area.
Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area. The system includes a hospital, a network of outpatient clinics, and a variety of support services. History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "census", "counties", "east", "idaho", "major", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcensuscountieseastidahomajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
S
Q7644625 QID OVERLAP 0.760
QID OVERLAP: Q7644625 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (13): "chronic", "community", "departments", "different", "disorders", "families", "funding", "homelessness", "housing", "illness", "intended", "professional", "work".
chroniccommunitydepartmentsdifferentdisordersfamiliesfundinghomelessnesshousingillnessintendedprofessionalwork
ls and families confronted with homelessness and who also have very low incomes or serious, persistent issues that may include substance use disorders (including alcoholism), mental health, HIV/AIDS, chronic illness, diverse disabilities (e.g., intellectual disabilities, mobility or sensory impairments) or other serious challenges to stable housing. Supportive housing in rehabilitation Supportive housing can be coupled with such social services as job training, life skills training, alcohol and substance use disorder treatment, community support services (e.g., child care, educational programs, coffee klatches), and case management to populations in need of assistance. Supportive housing is intended to be a pragmatic solution that helps people have better lives while reducing, to the extent feasible, the overall cost of care. As community housing, supportive housing can be developed as mixed income, scattered site housing not only through the traditional route of low income and building complexes. Supportive housing has been widely researched in the field of psychiatric disabilities and psychiatric rehabilitation, based in part on housing and support principles from studies of leading community integration organizations nationally. In addition, supportive housing has been tied to national initiatives in supportive living (usually developmental and intellectual disabilities) to cross-disability transfer and to national and international efforts on developing homes of one's own. Supported housing in the field of mental health is considered to be a critical component of a community support system which may involve supported education, supported or transitional employment, case management services, clubhouses, supported recreation and involvement of family and friends often translated into psycho-educational programs. From 2002 to 2007, an estimated 65,000 to 72,000 units of supportive housing were created in the United States. This represents about half the supply of supported housing units. Of the new units added, about half were targeted towards chronically homeless individuals, and one-fifth were for homeless families. According to the United States Department of Housing and Urban Development (HUD), the number of Permanent Supportive Housing beds in the US increased from 188,636 to 353,800 between 2007 and 2017.
Supportive housing in rehabilitation Supportive housing can be coupled with such social services as job training, life skills training, alcohol and substance use disorder treatment, community support services (e.g., child care, educational programs, coffee klatches), and case management to populations in need of assistance. Supportive housing is intended to be a pragmatic solution that helps people have better lives while reducing, to the extent feasible, the overall cost of care. As community housing, supportive housing can be developed as mixed income, scattered site housing not only through the traditional route of low income and building complexes. Supportive housing has been widely researched in the field of psychiatric disabilities and psychiatric rehabilitation, based in part on housing and support principles from studies of leading community integration organizations nationally. In addition, supportive housing has been tied to national initiatives in supportive living (usually developmental and intellectual disabilities) to cross-disability transfer and to national and international efforts on developing homes of one's own. Supported housing in the field of mental health is considered to be a critical component of a community support system which may involve supported education, supported or transitional employment, case management services, clubhouses, supported recreation and involvement of family and friends often translated into psycho-educational programs. From 2002 to 2007, an estimated 65,000 to 72,000 units of supportive housing were created in the United States. This represents about half the supply of supported housing units. Of the new units added, about half were targeted towards chronically homeless individuals, and one-fifth were for homeless families. According to the United States Department of Housing and Urban Development (HUD), the number of Permanent Supportive Housing beds in the US increased from 188,636 to 353,800 between 2007 and 2017.
Benefits of supportive housing for specific populations groups Supportive housing proposes to be a comprehensive solution to a problem rather than a band-aid fix (such as a shelter). While many of those who stay in the shelter system remain in or return to the system for extended periods of time, a much higher percentage of those who are placed in supportive housing remain housed on a more permanent basis. This idea is also referred to as the Housing First model, an approach to combating chronic homelessness by providing homes upfront and offering help for illnesses and addictions. The concept turns the traditional model, which typically requires sobriety (or prerequisites that can be used for enhanced services before a person can get housing), upside down. Research has shown that coupling permanent housing with supportive services is highly effective at maintaining housing stability, as well as helps improve health outcomes and decreases the use of publicly funded institutions. A review of the impact of these services found that they can improve health outcomes among chronically homeless individuals, including positive changes in self-reported mental health status, substance use, and overall well-being. In the Collaborative Initiative to Help End Chronic Homelessness (CICH), participants who had been homeless for an average of eight years were immediately placed into permanent housing. The CICH evaluation reported that 95% of those individuals were in independent housing after 12 months. A study of homeless people in New York City with serious mental illness found that providing supportive housing to the individuals directly resulted in a 60% decrease in emergency shelter use for clients, as well as decreases in the use of public medical and mental health services and city jails and state prisons. Another study in Seattle in 2009 found that moving "people with chronic alcoholism" into supportive housing resulted in a 33% decline in alcohol use for clients. There is significant support for the contention that supportive housing also costs less than other systems where its tenant base may reside, such as jails, hospitals, mental health facilities, and even shelters. Research on the overall costs to the taxpayer of supportive housing has consistently found the costs to the taxpayer to be about the same or lower than the alternative of a chronically homeless person sleeping in a shelter. The CICH evaluation showed that average costs for healthcare and treatment were reduced by about half, which the largest decline associated with inpatient hospital care. The use of supportive housing has been shown to be cost-effective, resulting in reductions in the use of shelter, ambulance, police/jail, health care, emergency room, behavior health, and other service costs. For example, one 2016 report identified studies documenting that these services can reduce health care costs, emergency department visits, and length of stays in psychiatric hospitals. The Denver Housing First Collaborative documented that the annual cost of supportive housing for a chronically homeless individual was $13,400. However, the per-person reduction in public services recorded by the Denver Housing First Collaborative came to $15,773 per person per year, more than compensating for the annual supportive housing costs. When paired with low-income housing (or mixed-income housing), government subsidies (such as section 8 or Housing choice vouchers) and other revenue generating operations, supportive housing residences are claimed by their supporters to be capable of supporting themselves and even turning a profit (which can be used for enhanced services and amenities for the residents by a non-profit organization).
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (13): "ada", "boise", "capital", "census", "district", "east", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "washington".
adaboisecapitalcensusdistricteastidahojurisdictionlocalmetropolitanpopulationprivatewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "census", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
boisecanyoncensusidahomeridianmetropolitannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in senior_services (tier:evergreen) and mental_health (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "census", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyoncensusidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "census", "idaho", "making", "meridian", "population".
adaamongboisecapitalcensusidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in senior_services (tier:branch) and mental_health (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "census", "east", "idaho", "metropolitan", "population".
approximatelyboisecaldwellcanyoncensuseastidahometropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
211 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP211 edges
🌲 EVERGREEN1 edges
0.650
assessmentcarecategorydirectdisablededucationhealthcareindividualjurisdictionlicensednationalnursenursingphysiciansplanpracticepractitionersprofessionalprogramprograms
SHARED TOKENS (26): "assessment", "care", "category", "direct", "disabled", "education", "healthcare", "individual", "jurisdiction", "licensed", "national", "nurse", "nursing", "physicians", "plan", "practice", "practitioners", "professional", "program", "programs".... | URL->A (1): http://www.bls.gov/ooh/Healthcare/Licensed-practical-and-licensed-vocational-nurses.htm. | EXACT TITLE in senior_services: "Licensed practical nurse".
🌿 BRANCH177 edges
0.500
Psychiatry ↗ Q7867 EXACT TITLE
assessmentassessmentsassociationclinicalcommunityconditionscontroldelivereddisordersemploymentexaminationhistoryindividualindustryinfluenceinitialmedicalmedicinenationaloccupational
SHARED TOKENS (35): "assessment", "assessments", "association", "clinical", "community", "conditions", "control", "delivered", "disorders", "employment", "examination", "history", "individual", "industry", "influence", "initial", "medical", "medicine", "national", "occupational".... | EXACT TITLE in mental_health: "Psychiatry".
0.500
abilitybenefitschangecounselingdevelopmentdifferentdirectearlyespeciallyfamiliesfamilyfieldindividualinfluenceinteractioninvolvementinvolvingmembersparticipationrelated
SHARED TOKENS (27): "ability", "benefits", "change", "counseling", "development", "different", "direct", "early", "especially", "families", "family", "field", "individual", "influence", "interaction", "involvement", "involving", "members", "participation", "related".... | EXACT TITLE in mental_health: "Family therapy".
0.500
abilityalternativearticleauthoritybenefitscapacitycasescivilclinicalcommitteeconditionsconsentdefinitionsdementiadisabilityguardianshealthcareindividualinformationinformed
SHARED TOKENS (47): "ability", "alternative", "article", "authority", "benefits", "capacity", "cases", "civil", "clinical", "committee", "conditions", "consent", "definitions", "dementia", "disability", "guardians", "healthcare", "individual", "information", "informed".... | EXACT TITLE in mental_health: "Informed consent".
0.500
agenciescarecertifieddepartmentsemergencyhospitalsleastmedicalmunicipalpaidphysicianpracticeprofessionalprovidepublicreceiveruralservingtrainingwork
SHARED TOKENS (20): "agencies", "care", "certified", "departments", "emergency", "hospitals", "least", "medical", "municipal", "paid", "physician", "practice", "professional", "provide", "public", "receive", "rural", "serving", "training", "work". | EXACT TITLE in senior_services: "Emergency medical technician".
0.500
accessacuteappointmentbecomecarecenterdepartmentdepartmentsemergencyentryfacilityhospitalhospitalsinitialmeansmedicalmedicineoperatepatientpatients
SHARED TOKENS (26): "access", "acute", "appointment", "become", "care", "center", "department", "departments", "emergency", "entry", "facility", "hospital", "hospitals", "initial", "means", "medical", "medicine", "operate", "patient", "patients".... | EXACT TITLE in mental_health: "Emergency department".
0.500
abilityaffectsamongassessmentsbroadercommunitycreatedefinesillnessindividuallifemerelyprofessionalpsychologicalratherrelationshipsrolesocialstresswork
SHARED TOKENS (20): "ability", "affects", "among", "assessments", "broader", "community", "create", "defines", "illness", "individual", "life", "merely", "professional", "psychological", "rather", "relationships", "role", "social", "stress", "work". | EXACT TITLE in mental_health: "Mental health".
0.500
Grief ↗ Q1026040 EXACT TITLE
associatedbecomebehavioralbeyondcasesconnectiondepressionevenexperiencingformedfurtherhigherindividuallifemeasuremodelpersonphysicalrelatedrelationship
SHARED TOKENS (25): "associated", "become", "behavioral", "beyond", "cases", "connection", "depression", "even", "experiencing", "formed", "further", "higher", "individual", "life", "measure", "model", "person", "physical", "related", "relationship".... | EXACT TITLE in mental_health: "Grief".
0.500
acuteamongcarecategoriescategoryclassifiedclinicalclinicscommunitiescommunitycounselingdefinesdelivereddepartmentdifferentdisabilitydiseasedistincteconomiceducation
SHARED TOKENS (63): "acute", "among", "care", "categories", "category", "classified", "clinical", "clinics", "communities", "community", "counseling", "defines", "delivered", "department", "different", "disability", "disease", "distinct", "economic", "education".... | EXACT TITLE in senior_services: "Community health". | EXACT TITLE in mental_health: "Community health".
0.500
Geriatrics ↗ Q10384 EXACT TITLE
addressingadultsagebecomebehavioralcarechronicconditionsdiseasedistinctionexperiencingfamilygeriatricillnessindividuallifemedicalmedicallymedicinemultiple
SHARED TOKENS (31): "addressing", "adults", "age", "become", "behavioral", "care", "chronic", "conditions", "disease", "distinction", "experiencing", "family", "geriatric", "illness", "individual", "life", "medical", "medically", "medicine", "multiple".... | EXACT TITLE in senior_services: "Geriatrics".
0.500
accessadultadultsagecentercenterscommunitycriticaleatingfacilityfieldfundinglimitedlocalmeansmembersmultiplemunicipalneedneeds
SHARED TOKENS (33): "access", "adult", "adults", "age", "center", "centers", "community", "critical", "eating", "facility", "field", "funding", "limited", "local", "means", "members", "multiple", "municipal", "need", "needs".... | EXACT TITLE in senior_services: "Senior center".
0.500
Gerontology ↗ Q10387 EXACT TITLE
adultsamongbehavioralcentercreateddesigndesigneddevelopmentdiseaseespeciallyfieldgeographygeriatrichousingmeansmedicineneednursingoccupationalolder
SHARED TOKENS (37): "adults", "among", "behavioral", "center", "created", "design", "designed", "development", "disease", "especially", "field", "geography", "geriatric", "housing", "means", "medicine", "need", "nursing", "occupational", "older".... | EXACT TITLE in senior_services: "Gerontology".
0.500
additionadministrationauthoritycareclinicalconsultationdisableddiseaseeducationhealthcarelifemanagementmedicalmedicationmedicinepatientpersonphysicalpracticeprevention
SHARED TOKENS (30): "addition", "administration", "authority", "care", "clinical", "consultation", "disabled", "disease", "education", "healthcare", "life", "management", "medical", "medication", "medicine", "patient", "person", "physical", "practice", "prevention".... | EXACT TITLE in senior_services: "Physical therapy".
0.500
abilityadultaffectsageagencyamongapprovedbecomecarecommunityconditionscourtcreateddatadepressiondescribeddisorderseatingespeciallyfamilies
SHARED TOKENS (48): "ability", "adult", "affects", "age", "agency", "among", "approved", "become", "care", "community", "conditions", "court", "created", "data", "depression", "described", "disorders", "eating", "especially", "families".... | EXACT TITLE in mental_health: "Foster care".
0.500
againstconditionscontroldisordersindividualinfluenceintegrationinvolvemajormeansmechanismprotectpsychologicalrepresentationstress
SHARED TOKENS (15): "against", "conditions", "control", "disorders", "individual", "influence", "integration", "involve", "major", "means", "mechanism", "protect", "psychological", "representation", "stress". | EXACT TITLE in mental_health: "Dissociative disorder".
0.500
acquiredacuteadultsaffectsapproximatelyavailabilitycannotcategorychronicconditionconditionsdiseasedisordersevenextendedillnessleastlifemajormedical
SHARED TOKENS (23): "acquired", "acute", "adults", "affects", "approximately", "availability", "cannot", "category", "chronic", "condition", "conditions", "disease", "disorders", "even", "extended", "illness", "least", "life", "major", "medical".... | EXACT TITLE in senior_services: "Chronic condition".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingdeterminedevelopmentdifferentgrowthland-uselocalplanningpolicyregulatoryresidentialrulesshapesinglesystemsuseszoning
SHARED TOKENS (17): "building", "determine", "development", "different", "growth", "land-use", "local", "planning", "policy", "regulatory", "residential", "rules", "shape", "single", "systems", "uses", "zoning". | EXACT TITLE in senior_services: "Zoning". | EXACT TITLE in mental_health: "Zoning".
0.500
addressageassociatedcannotcarechroniccommunityconditionscoordinateddisabilityfacilitiesillnessindividualizedlifemedicalmultipleneedneedsnursingolder
SHARED TOKENS (28): "address", "age", "associated", "cannot", "care", "chronic", "community", "conditions", "coordinated", "disability", "facilities", "illness", "individualized", "life", "medical", "multiple", "need", "needs", "nursing", "older".... | EXACT TITLE in senior_services: "Long-term care".
0.500
approvedaroundauthoritybecomecareclinicalconsultationcontroldeliveringdirecteducationexperienceformalgeneralhealthcareinvestmentnursingoccupationaloutcomespatient
SHARED TOKENS (40): "approved", "around", "authority", "become", "care", "clinical", "consultation", "control", "delivering", "direct", "education", "experience", "formal", "general", "healthcare", "investment", "nursing", "occupational", "outcomes", "patient".... | EXACT TITLE in mental_health: "Clinical supervision".
0.500
adultsaloneamongassociatedassociationbenefitsclinicalconditionconflictdescribeddisordersdocumentedearlyeffectiveexperienceexperiencinghigherillnessleastlife
SHARED TOKENS (37): "adults", "alone", "among", "associated", "association", "benefits", "clinical", "condition", "conflict", "described", "disorders", "documented", "early", "effective", "experience", "experiencing", "higher", "illness", "least", "life".... | EXACT TITLE in mental_health: "Post-traumatic stress disorder".
0.500
Psychosis ↗ Q170082 EXACT TITLE
acuteappearchronicconditiondependdescribeddescriptiondistinguishearlyillnessmedicalmedicationmental-healthoutcomespersonprimarypsychiatricratherrealrelated
SHARED TOKENS (26): "acute", "appear", "chronic", "condition", "depend", "described", "description", "distinguish", "early", "illness", "medical", "medication", "mental-health", "outcomes", "person", "primary", "psychiatric", "rather", "real", "related".... | EXACT TITLE in mental_health: "Psychosis".
0.500
clinicclinicaldirecteducationexperiencehospitalindividualjurisdictionknowledgelicensemedicalmedicinepharmacyphysicalphysicianphysicianspracticepracticesregisteredspecialty
SHARED TOKENS (25): "clinic", "clinical", "direct", "education", "experience", "hospital", "individual", "jurisdiction", "knowledge", "license", "medical", "medicine", "pharmacy", "physical", "physician", "physicians", "practice", "practices", "registered", "specialty".... | EXACT TITLE in senior_services: "Residency (medicine)". | EXACT TITLE in mental_health: "Residency (medicine)".
0.500
accessamongbehavioralcarecasescommunitiescommunitycontroldeliverydesigneddevelopmentdifferentdisabilitydiseaseeducationevenfieldhealthcareinformedinfrastructure
SHARED TOKENS (49): "access", "among", "behavioral", "care", "cases", "communities", "community", "control", "delivery", "designed", "development", "different", "disability", "disease", "education", "even", "field", "healthcare", "informed", "infrastructure".... | EXACT TITLE in senior_services: "Public health". | EXACT TITLE in mental_health: "Public health".
0.500
abilitycarechangesclassifiedclinicalcommunitiesdefinesdisabilityearlyexperienceformalgrouphealthcareillnesslifenationalneedneedsoccupationaloccupations
SHARED TOKENS (32): "ability", "care", "changes", "classified", "clinical", "communities", "defines", "disability", "early", "experience", "formal", "group", "healthcare", "illness", "life", "national", "need", "needs", "occupational", "occupations".... | EXACT TITLE in senior_services: "Occupational therapy".
0.500
abilityaccessbecomebehavioralcarecertifiedcliniccommunitydesignateddisordersenterformalformedinsurancemedicaidoperatingpatientpayprivateprogram
SHARED TOKENS (21): "ability", "access", "become", "behavioral", "care", "certified", "clinic", "community", "designated", "disorders", "enter", "formal", "formed", "insurance", "medicaid", "operating", "patient", "pay", "private", "program".... | EXACT TITLE in mental_health: "Certified Community Behavioral Health Clinic".
0.500
accessadvancedcannotcarecommunitiescommunitycriticalcurrentdeliveringdemanddevelopmenteducationeffectiveespeciallyformalfunctionsgrowthhospitalsinformationinvolving
SHARED TOKENS (46): "access", "advanced", "cannot", "care", "communities", "community", "critical", "current", "delivering", "demand", "development", "education", "effective", "especially", "formal", "functions", "growth", "hospitals", "information", "involving".... | EXACT TITLE in mental_health: "Community health worker".
0.500
ageamongassessmentassociatedbroadercarechronicclinicsdefinitionsdescribesearlyfamiliesfieldhealthcarehospitalsillnesslifelimitedmeansmedical
SHARED TOKENS (40): "age", "among", "assessment", "associated", "broader", "care", "chronic", "clinics", "definitions", "describes", "early", "families", "field", "healthcare", "hospitals", "illness", "life", "limited", "means", "medical".... | EXACT TITLE in senior_services: "Palliative care".
0.500
approximatelychangesconditiondefinitiondesignedemergencyexperiencefamilyhomelessnesshousingidentifyinglegalneedspersonsplacepopulationspovertyprimaryprivatepublic
SHARED TOKENS (23): "approximately", "changes", "condition", "definition", "designed", "emergency", "experience", "family", "homelessness", "housing", "identifying", "legal", "needs", "persons", "place", "populations", "poverty", "primary", "private", "public".... | EXACT TITLE in senior_services: "Homelessness". | EXACT TITLE in mental_health: "Homelessness".
0.500
alternativesassessmentassociationauthoritychangechangescommunitiescommunityconditionscostscreatingdefinitiondependdependsdesigndevelopmenteconomicfacilitiesfurtherfuture
SHARED TOKENS (38): "alternatives", "assessment", "association", "authority", "change", "changes", "communities", "community", "conditions", "costs", "creating", "definition", "depend", "depends", "design", "development", "economic", "facilities", "further", "future".... | EXACT TITLE in mental_health: "Land-use planning".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecareclassifiedclinicalcommunitydirecteffectiveinformationinstitutionallinksmedicationofficepatientpatientspharmacypracticeprimaryprofessionalprovidingrelated
SHARED TOKENS (26): "become", "care", "classified", "clinical", "community", "direct", "effective", "information", "institutional", "links", "medication", "office", "patient", "patients", "pharmacy", "practice", "primary", "professional", "providing", "related".... | EXACT TITLE in senior_services: "Pharmacy". | EXACT TITLE in mental_health: "Pharmacy".
0.500
behavioralcannotclinicclinicalcommunitycounselingdepressiondifferentdisorderseatingextensiveindividualinstitutionsjurisdictionlicensedlicensinglimitedmedicationpracticesprivate
SHARED TOKENS (32): "behavioral", "cannot", "clinic", "clinical", "community", "counseling", "depression", "different", "disorders", "eating", "extensive", "individual", "institutions", "jurisdiction", "licensed", "licensing", "limited", "medication", "practices", "private".... | EXACT TITLE in mental_health: "Psychologist".
0.500
carecontinuingcriminaldeliverededucationfieldhealthcarejurisdictionlicenselicensedlicensingnursenursingpracticeprofessionalprogramregisteredregulatedremainrequirements
SHARED TOKENS (23): "care", "continuing", "criminal", "delivered", "education", "field", "healthcare", "jurisdiction", "license", "licensed", "licensing", "nurse", "nursing", "practice", "professional", "program", "registered", "regulated", "remain", "requirements".... | EXACT TITLE in senior_services: "Registered nurse".
0.500
adultsbenefitschangeclinicalconditionconditionsdesigneddifferentdisordersevaluatingfamiliesfamilygeneralindividualindividualizedinteractioninvolveinvolvingitselfjurisdiction
SHARED TOKENS (43): "adults", "benefits", "change", "clinical", "condition", "conditions", "designed", "different", "disorders", "evaluating", "families", "family", "general", "individual", "individualized", "interaction", "involve", "involving", "itself", "jurisdiction".... | EXACT TITLE in mental_health: "Psychotherapy".
0.500
adultadultsarticlebroadercannotcarecommunitycoordinationdefinitionsdelivereddependsearlyexpansionfacilitiesfacilityfragmentedgeographicgrouphousingindustry
SHARED TOKENS (50): "adult", "adults", "article", "broader", "cannot", "care", "community", "coordination", "definitions", "delivered", "depends", "early", "expansion", "facilities", "facility", "fragmented", "geographic", "group", "housing", "industry".... | EXACT TITLE in senior_services: "Assisted living".
0.500
assessmentclinicaldeterminedisordersexaminationillnessmanagementnursingoccupationalpatientsphysicalphysiciansocialtherapiststrainingtreatworkers
SHARED TOKENS (17): "assessment", "clinical", "determine", "disorders", "examination", "illness", "management", "nursing", "occupational", "patients", "physical", "physician", "social", "therapists", "training", "treat", "workers". | EXACT TITLE in mental_health: "Psychiatrist".
0.500
adultadultsagecivilcriminaldisabilityemergencyextendillnessinvolvinglawlegallypersonphysiciansreportreportingrequiredrisk
SHARED TOKENS (18): "adult", "adults", "age", "civil", "criminal", "disability", "emergency", "extend", "illness", "involving", "law", "legally", "person", "physicians", "report", "reporting", "required", "risk". | EXACT TITLE in senior_services: "Mandated reporter".
0.500
administrationbenefitschangesdisabilityemploymentindividualinsurancelawlegallocalpaidpayprogramprogramsratherresidentssocialsystemtablewage
SHARED TOKENS (22): "administration", "benefits", "changes", "disability", "employment", "individual", "insurance", "law", "legal", "local", "paid", "pay", "program", "programs", "rather", "residents", "social", "system", "table", "wage".... | EXACT TITLE in senior_services: "Social Security (United States)".
0.500
adultadultsageagencyappointmentcaredefinitiondefinitionsdepartmentsdevelopmentalguardianshelpingillnessinitiallawlegallocalolderpersonphysical
SHARED TOKENS (24): "adult", "adults", "age", "agency", "appointment", "care", "definition", "definitions", "departments", "developmental", "guardians", "helping", "illness", "initial", "law", "legal", "local", "older", "person", "physical".... | EXACT TITLE in senior_services: "Adult Protective Services".
0.500
acuteadmissionageamongappearapproximatelyaroundassociatedassociationcasesclassifiedclinicalcommitteeconditionconditionscontactcriticaldepressiondisabilityearly
SHARED TOKENS (57): "acute", "admission", "age", "among", "appear", "approximately", "around", "associated", "association", "cases", "classified", "clinical", "committee", "condition", "conditions", "contact", "critical", "depression", "disability", "early".... | EXACT TITLE in mental_health: "Bipolar disorder".
0.500
adultageagenciesbeyondcontinuingdelivereddevelopmentdifferenteconomiceducationespeciallyformalfrequentlygeneralhelpinginitialinstitutionalintegratedintendedleast
SHARED TOKENS (33): "adult", "age", "agencies", "beyond", "continuing", "delivered", "development", "different", "economic", "education", "especially", "formal", "frequently", "general", "helping", "initial", "institutional", "integrated", "intended", "least".... | EXACT TITLE in mental_health: "Continuing education".
0.500
acuteadministrationagencycapacitycivilcommunitycourtdeterminedisordersemergencyestablishedevaluationfacilityfurtherhospitalhospitalizationindividualinterventioninvolvelegal
SHARED TOKENS (34): "acute", "administration", "agency", "capacity", "civil", "community", "court", "determine", "disorders", "emergency", "established", "evaluation", "facility", "further", "hospital", "hospitalization", "individual", "intervention", "involve", "legal".... | EXACT TITLE in mental_health: "Involuntary commitment".
0.500
Stroke ↗ Q12202 EXACT TITLE
annualappearapproximatelyassociatedcasesconditioncontroldeterminedirectlydiseaseearlyemergencymedicalmedicationmovephysicalphysiciansplacepressureprevention
SHARED TOKENS (28): "annual", "appear", "approximately", "associated", "cases", "condition", "control", "determine", "directly", "disease", "early", "emergency", "medical", "medication", "move", "physical", "physicians", "place", "pressure", "prevention".... | EXACT TITLE in senior_services: "Stroke". | EXACT TITLE in mental_health: "Stroke".
0.500
Probation ↗ Q13961 EXACT TITLE
alternativescommunityconditionscontactcourtcourtscriminaleducationaljurisdictionlawlimitedmeanspayperformpermitplaceprogrampsychologicalremainrequired
SHARED TOKENS (23): "alternatives", "community", "conditions", "contact", "court", "courts", "criminal", "educational", "jurisdiction", "law", "limited", "means", "pay", "perform", "permit", "place", "program", "psychological", "remain", "required".... | EXACT TITLE in mental_health: "Probation".
0.500
accessalternativesarrangementsassociationcompetitivecoordinationcostsdefinitiondesignateddevelopmenteconomicestatefrequentlyfundinggeneralgeographichigherindustryinfrastructureintegrated
SHARED TOKENS (51): "access", "alternatives", "arrangements", "association", "competitive", "coordination", "costs", "definition", "designated", "development", "economic", "estate", "frequently", "funding", "general", "geographic", "higher", "industry", "infrastructure", "integrated".... | EXACT TITLE in senior_services: "Public transport".
0.500
agenciesbehavioralcarecenterscertificationcertifiedclinicalcodescommunitydefiningdesignateddifferentdisordersdoctoralexaminationexperiencefamiliesfamilyfrequentlyhigher
SHARED TOKENS (42): "agencies", "behavioral", "care", "centers", "certification", "certified", "clinical", "codes", "community", "defining", "designated", "different", "disorders", "doctoral", "examination", "experience", "families", "family", "frequently", "higher".... | EXACT TITLE in mental_health: "Licensed professional counselor".
0.500
agencybuildingcommercialconnectionsconstructiondesigndevelopmentfunctionsinstitutionalintegratedmultipleneighborhoodplanningpolicyprivateresidentialsinglesitestrategyunit
SHARED TOKENS (22): "agency", "building", "commercial", "connections", "construction", "design", "development", "functions", "institutional", "integrated", "multiple", "neighborhood", "planning", "policy", "private", "residential", "single", "site", "strategy", "unit".... | EXACT TITLE in senior_services: "Mixed-use development".
0.500
adultadultsamongbecomebenefitscarechroniccommissionconsequencesdescribeddisabilitydisabledemergencyevaluationexperiencefamiliesfamilyfieldhealthcarepatient
SHARED TOKENS (40): "adult", "adults", "among", "become", "benefits", "care", "chronic", "commission", "consequences", "described", "disability", "disabled", "emergency", "evaluation", "experience", "families", "family", "field", "healthcare", "patient".... | EXACT TITLE in senior_services: "Respite care".
0.500
Caregiver ↗ Q553079 EXACT TITLE
agecannotcarecentersdisabilitydocumentationfamilyformalhealthcarehelpinghospitalsillnessnursingpaidpersonprovideprovidersrespitesupportworkers
SHARED TOKENS (20): "age", "cannot", "care", "centers", "disability", "documentation", "family", "formal", "healthcare", "helping", "hospitals", "illness", "nursing", "paid", "person", "provide", "providers", "respite", "support", "workers". | EXACT TITLE in senior_services: "Caregiver".
0.500
administrationannouncedcenterscommunitydepartmentdirectlydisabilitydisabledfamiliesmedicaidofficepolicyprincipalprogramreportsservesstrategy
SHARED TOKENS (17): "administration", "announced", "centers", "community", "department", "directly", "disability", "disabled", "families", "medicaid", "office", "policy", "principal", "program", "reports", "serves", "strategy". | EXACT TITLE in senior_services: "Administration for Community Living".
0.500
Elder abuse ↗ Q427883 EXACT TITLE
adultsagainstagenciescircumstancescommunitycriminaldefinitiondesignatedfamilygeneralmembersnetworkolderpaidpatientspersonpersonspreventionprofessionalrelated
SHARED TOKENS (23): "adults", "against", "agencies", "circumstances", "community", "criminal", "definition", "designated", "family", "general", "members", "network", "older", "paid", "patients", "person", "persons", "prevention", "professional", "related".... | EXACT TITLE in senior_services: "Elder abuse".
0.500
ageassociationcaredementiadifferentdisabledemergencyfacilitiesfacilitygrouphospitalillnessinstitutionsinsurancemedicalneedneedsnursingoccupationalolder
SHARED TOKENS (30): "age", "association", "care", "dementia", "different", "disabled", "emergency", "facilities", "facility", "group", "hospital", "illness", "institutions", "insurance", "medical", "need", "needs", "nursing", "occupational", "older".... | EXACT TITLE in senior_services: "Nursing home".
0.500
abilityaccessagenciesbarrierscarecentercenterscertificationclinicclinicalclinicscommunitiescommunitycommunity-basedconsumercoveragedefiningfacilitiesfederallygoverning
SHARED TOKENS (53): "ability", "access", "agencies", "barriers", "care", "center", "centers", "certification", "clinic", "clinical", "clinics", "communities", "community", "community-based", "consumer", "coverage", "defining", "facilities", "federally", "governing".... | EXACT TITLE in mental_health: "Federally Qualified Health Center".
0.500
annualapproximatelyblsbureaubusinessesdocumentedemploymentlaboroccupationaloesofficeofficesregionalstatisticswagewashington
SHARED TOKENS (16): "annual", "approximately", "bls", "bureau", "businesses", "documented", "employment", "labor", "occupational", "oes", "office", "offices", "regional", "statistics", "wage", "washington". | EXACT TITLE in mental_health: "Occupational Employment and Wage Statistics".
0.500
addressescounselingdischargedisorderseducationaleffectivefacilitiesfacilityfamilygrouphospitalindividualintensiveoperatesoutpatientparticipationpatientsprogramprogrammingprograms
SHARED TOKENS (30): "addresses", "counseling", "discharge", "disorders", "educational", "effective", "facilities", "facility", "family", "group", "hospital", "individual", "intensive", "operates", "outpatient", "participation", "patients", "program", "programming", "programs".... | EXACT TITLE in mental_health: "Intensive outpatient program".
0.500
Franchising ↗ Q171947 EXACT TITLE
alternativebrandcapitalcircumstancesconditionscorporatedirecteconomicentityespeciallyexpansionexplicitlygrowthindividualinvestmentinvolvelegallicensingmarketmeans
SHARED TOKENS (33): "alternative", "brand", "capital", "circumstances", "conditions", "corporate", "direct", "economic", "entity", "especially", "expansion", "explicitly", "growth", "individual", "investment", "involve", "legal", "licensing", "market", "means".... | EXACT TITLE in senior_services: "Franchising".
0.500
accessassessmentsbeyondcarechangechangescommunitiescommunitycommunity-basedcreatingcurrentdelivereddesigneddirectevaluationsfamiliesgeneralillnessindividuallife
SHARED TOKENS (39): "access", "assessments", "beyond", "care", "change", "changes", "communities", "community", "community-based", "creating", "current", "delivered", "designed", "direct", "evaluations", "families", "general", "illness", "individual", "life".... | EXACT TITLE in mental_health: "Suicide prevention".
0.500
administrationadultsagenciescommunity-basedcreateddiseaseeffectivefamilyfundingjulylawlocalmarchnationalnetworkolderpopulationpreventionprogramprograms
SHARED TOKENS (24): "administration", "adults", "agencies", "community-based", "created", "disease", "effective", "family", "funding", "july", "law", "local", "march", "national", "network", "older", "population", "prevention", "program", "programs".... | EXACT TITLE in senior_services: "Older Americans Act of 1965".
0.500
assessmentassociationbehavioralbroaderclinicaldefinesdisordersfamilygrouphealthcareillnessindividualknowledgemental-healthnationalpracticepreventionprovidingsocialspecialty
SHARED TOKENS (24): "assessment", "association", "behavioral", "broader", "clinical", "defines", "disorders", "family", "group", "healthcare", "illness", "individual", "knowledge", "mental-health", "national", "practice", "prevention", "providing", "social", "specialty".... | EXACT TITLE in mental_health: "Clinical social work".
0.500
abilityacquiredaffectingbecomecasescategoryclassifiedconditionconditionsdefinesdementiadependdevelopmentaldifferentdiseasedisordersearlyfunctionslanguagelife
SHARED TOKENS (26): "ability", "acquired", "affecting", "become", "cases", "category", "classified", "condition", "conditions", "defines", "dementia", "depend", "developmental", "different", "disease", "disorders", "early", "functions", "language", "life".... | EXACT TITLE in mental_health: "Neurocognitive disorder".
0.500
Delirium ↗ Q160796 EXACT TITLE
acuteadultsaffectingaffectsamongbehavioralcarecaseschangeschronicconditionconditionscriticaldementiadepressiondirectdisabilitydiseasedisorderseven
SHARED TOKENS (48): "acute", "adults", "affecting", "affects", "among", "behavioral", "care", "cases", "changes", "chronic", "condition", "conditions", "critical", "dementia", "depression", "direct", "disability", "disease", "disorders", "even".... | EXACT TITLE in mental_health: "Delirium".
0.500
adaadultboisecanyoncommunitycountiesdevelopmenteducationidahonampapopulationprimaryprogramspublicreportedresidentssouthweststudentsthroughouttransfer
SHARED TOKENS (24): "ada", "adult", "boise", "canyon", "community", "counties", "development", "education", "idaho", "nampa", "population", "primary", "programs", "public", "reported", "residents", "southwest", "students", "throughout", "transfer".... | EXACT TITLE in senior_services: "College of Western Idaho".
0.500
adultadultsamongassociatedcircumstancesdepressiondisordersexperiencefamilyhealthcarelifeplanplanningpopulationpreparationprovidereportedresponserisksystems
SHARED TOKENS (21): "adult", "adults", "among", "associated", "circumstances", "depression", "disorders", "experience", "family", "healthcare", "life", "plan", "planning", "population", "preparation", "provide", "reported", "response", "risk", "systems".... | EXACT TITLE in mental_health: "Suicidal ideation".
0.500
associatedauthoritycodesconsequencescourtscriminalenforcementgoverninginstitutionsjusticelawlegallifemembersoperateorganizationspersonpreventionpublicrecord
SHARED TOKENS (24): "associated", "authority", "codes", "consequences", "courts", "criminal", "enforcement", "governing", "institutions", "justice", "law", "legal", "life", "members", "operate", "organizations", "person", "prevention", "public", "record".... | EXACT TITLE in mental_health: "Law enforcement".
0.500
affectsageamonganalysisappearapproximatelyassociatedcarecasescounselingdepressiondisordersearlyeatingeffectiveestimatesexperiencefoodgrouphospitalization
SHARED TOKENS (33): "affects", "age", "among", "analysis", "appear", "approximately", "associated", "care", "cases", "counseling", "depression", "disorders", "early", "eating", "effective", "estimates", "experience", "food", "group", "hospitalization".... | EXACT TITLE in mental_health: "Eating disorder".
0.500
Retirement ↗ Q946865 EXACT TITLE
accessagearrangementsbenefitsbeyondconditionscoverageemploymentespeciallyfamilyhigherillnessindustrylifemarchnationalpersonplanpositionprivate
SHARED TOKENS (29): "access", "age", "arrangements", "benefits", "beyond", "conditions", "coverage", "employment", "especially", "family", "higher", "illness", "industry", "life", "march", "national", "person", "plan", "position", "private".... | EXACT TITLE in senior_services: "Retirement".
0.500
accessadditionagenciesalternativebeyondcasescommunitydesigneddischargeeconomicformalincomeindividualizedlocalmetropolitanoperateoperatesoperatorsorganizationsprivate
SHARED TOKENS (30): "access", "addition", "agencies", "alternative", "beyond", "cases", "community", "designed", "discharge", "economic", "formal", "income", "individualized", "local", "metropolitan", "operate", "operates", "operators", "organizations", "private".... | EXACT TITLE in senior_services: "Paratransit".
0.480
carecommunitycoordinationcourtsdisabledfirmsgenerallawlegalmanagementmedicalspecificsystemtreatment
SHARED TOKENS (14): "care", "community", "coordination", "courts", "disabled", "firms", "general", "law", "legal", "management", "medical", "specific", "system", "treatment". | EXACT TITLE in mental_health: "Case management".
0.480
advancedcarecoordinationdiseasemedicalneedsnursepatientpracticepreventionproviderregisteredtrainingtreatment
SHARED TOKENS (14): "advanced", "care", "coordination", "disease", "medical", "needs", "nurse", "patient", "practice", "prevention", "provider", "registered", "training", "treatment". | EXACT TITLE in senior_services: "Nurse practitioner". | EXACT TITLE in mental_health: "Nurse practitioner".
0.480
amongbehavioralconditionsdisorderseatingfacilityhospitalinstitutionsmajormedicalpatientspsychiatricspecializedtreatment
SHARED TOKENS (14): "among", "behavioral", "conditions", "disorders", "eating", "facility", "hospital", "institutions", "major", "medical", "patients", "psychiatric", "specialized", "treatment". | EXACT TITLE in mental_health: "Psychiatric hospital".
0.460
Parole ↗ Q5357120 EXACT TITLE
associatedbehavioralcomplianceconditionsdesignatedearlyoutsideplaceratherservingsupervisedsupervisionsystem
SHARED TOKENS (13): "associated", "behavioral", "compliance", "conditions", "designated", "early", "outside", "place", "rather", "serving", "supervised", "supervision", "system". | EXACT TITLE in mental_health: "Parole".
0.460
Probate ↗ Q6500369 EXACT TITLE
approvalclaimscourtcourtsdocumentestatejudicialjurisdictionlawlegalnecessarypersonpublic
SHARED TOKENS (13): "approval", "claims", "court", "courts", "document", "estate", "judicial", "jurisdiction", "law", "legal", "necessary", "person", "public". | EXACT TITLE in senior_services: "Probate".
0.460
actuallyamongcommunity-basedfoodhospitalslifeneednursingprogramprogramspurchasequalityresearch
SHARED TOKENS (13): "actually", "among", "community-based", "food", "hospitals", "life", "need", "nursing", "program", "programs", "purchase", "quality", "research". | EXACT TITLE in senior_services: "Meals on Wheels".
0.460
caldwellcounselingdirectorsfamiliesfundingidahooperatesoperatingprogramprogramsservetherapythroughout
SHARED TOKENS (13): "caldwell", "counseling", "directors", "families", "funding", "idaho", "operates", "operating", "program", "programs", "serve", "therapy", "throughout". | EXACT TITLE in mental_health: "Idaho Youth Ranch".
0.450
Elder rights ↗ Q22908078 KW CROSS HIGH
abilityaccessadultsagebenefitscapacitydefinitiondisabilityincomelifemedicalolderphysicalprotectprovidingpsychologicalrightssocialtechnologyyet
SHARED TOKENS (20): "ability", "access", "adults", "age", "benefits", "capacity", "definition", "disability", "income", "life", "medical", "older", "physical", "protect", "providing", "psychological", "rights", "social", "technology", "yet". | URL->A (1): https://acl.gov/about-acl/administration-aging.
0.440
communityeducationemergencygroupindividuallabormedicineprovideresponsespecializedtrainingwork
SHARED TOKENS (12): "community", "education", "emergency", "group", "individual", "labor", "medicine", "provide", "response", "specialized", "training", "work". | EXACT TITLE in senior_services: "Volunteering".
0.440
directoriesdirectoryfamilyinsurancemediamedicalprofessionalreportedsocialtherapiststherapyworkers
SHARED TOKENS (12): "directories", "directory", "family", "insurance", "media", "medical", "professional", "reported", "social", "therapists", "therapy", "workers". | EXACT TITLE in mental_health: "Psychology Today".
0.440
adultageappointmentarrangementsauthorityestatehealthcarelawlegalorganizationspersonphysical
SHARED TOKENS (12): "adult", "age", "appointment", "arrangements", "authority", "estate", "healthcare", "law", "legal", "organizations", "person", "physical". | EXACT TITLE in senior_services: "Conservatorship".
0.430
administrationagencycommunitydepartment
SHARED TOKENS (4): "administration", "agency", "community", "department". | URL->A (2): https://www.acl.gov/about-acl/authorizing-statutes/older-americans-act, https://acl.gov/about-acl/administration-aging. | EXACT TITLE in senior_services: "Administration on Aging".
0.420
changesevaluationfieldfunctionsinteractionlifepsychologicalsitesspecificstudysystem
SHARED TOKENS (11): "changes", "evaluation", "field", "functions", "interaction", "life", "psychological", "sites", "specific", "study", "system". | EXACT TITLE in mental_health: "Psychopharmacology".
0.420
Home care ↗ Q1642542 EXACT TITLE
carecommunitydisabledindividuallocalmarketnationalorganizationspatientprofessionalsocial
SHARED TOKENS (11): "care", "community", "disabled", "individual", "local", "market", "national", "organizations", "patient", "professional", "social". | EXACT TITLE in senior_services: "Home care".
0.420
amongcriminaleducationemploymenthistoryindividualnecessarypersonplacerecordsearch
SHARED TOKENS (11): "among", "criminal", "education", "employment", "history", "individual", "necessary", "person", "place", "record", "search". | EXACT TITLE in senior_services: "Background check".
0.400
Criminal justice ↗ EXACT TITLE
agenciescourtscriminaldeliveryinstitutionsjusticeprimaryrehabilitationsupportsystem
SHARED TOKENS (10): "agencies", "courts", "criminal", "delivery", "institutions", "justice", "primary", "rehabilitation", "support", "system". | EXACT TITLE in senior_services: "Criminal justice". | EXACT TITLE in mental_health: "Criminal justice".
0.400
abilityagecenterscommunitycontroldefinesdiseaseincomeplaceprevention
SHARED TOKENS (10): "ability", "age", "centers", "community", "control", "defines", "disease", "income", "place", "prevention". | EXACT TITLE in senior_services: "Aging in place".
0.400
Phlebotomy ↗ Q3595842 EXACT TITLE
adultdisordersinvolvingitselfmakingmedicalpersontherapytreatmentunit
SHARED TOKENS (10): "adult", "disorders", "involving", "itself", "making", "medical", "person", "therapy", "treatment", "unit". | EXACT TITLE in senior_services: "Phlebotomy".
0.400
certifiedcounselingeducationguidancelicensedprofessionalprogramprovidestudentssupport
SHARED TOKENS (10): "certified", "counseling", "education", "guidance", "licensed", "professional", "program", "provide", "students", "support". | EXACT TITLE in mental_health: "School counselor".
0.360
agenciescarehealthcarelabormanagedorganizationspopulationsspecialty
SHARED TOKENS (8): "agencies", "care", "healthcare", "labor", "managed", "organizations", "populations", "specialty". | EXACT TITLE in mental_health: "Magellan Health".
0.360
agecontactfamilygroupindividualisolationsocialtemporary
SHARED TOKENS (8): "age", "contact", "family", "group", "individual", "isolation", "social", "temporary". | EXACT TITLE in mental_health: "Social isolation".
0.360
Fraud ↗ Q28813 EXACT TITLE
benefitscasescivilcriminaldocumentitselflawlegal
SHARED TOKENS (8): "benefits", "cases", "civil", "criminal", "document", "itself", "law", "legal". | EXACT TITLE in senior_services: "Fraud".
0.320
clinicaldepressionidentifyingmodelpreventiontreatment
SHARED TOKENS (6): "clinical", "depression", "identifying", "model", "prevention", "treatment". | EXACT TITLE in mental_health: "Relapse prevention".
0.300
buildingcapitalcasescenterscommercialdevelopmentdistinctestatefinancinggoverninghospitalshousingindustryinstitutionalinvestmentmajormarketsofficeoperatesoperation
SHARED TOKENS (29): "building", "capital", "cases", "centers", "commercial", "development", "distinct", "estate", "financing", "governing", "hospitals", "housing", "industry", "institutional", "investment", "major", "markets", "office", "operates", "operation"....
0.300
againstagenciesbusinessescommissioncompetitioncomplaintsconsentconsumerdirecteconomiceducationenforcementestablishedevenfoodgeneralinformationinformedintendedlaw
SHARED TOKENS (32): "against", "agencies", "businesses", "commission", "competition", "complaints", "consent", "consumer", "direct", "economic", "education", "enforcement", "established", "even", "food", "general", "information", "informed", "intended", "law"....
0.300
behavioralbroaderchangecontextdeliveredexplicitlygrouphelpingmanagementmechanismplacerelationshipssocialspecializedsupporttherapiststherapytrainingtreattreatment
SHARED TOKENS (20): "behavioral", "broader", "change", "context", "delivered", "explicitly", "group", "helping", "management", "mechanism", "place", "relationships", "social", "specialized", "support", "therapists", "therapy", "training", "treat", "treatment".
0.300
adultsaroundassessmentbureaucarecensuscenterdebtdefinesdefinitiondepartmentdepartmentsdepressioneconomiceducationfamiliesfamilyfoodgrowthhousing
SHARED TOKENS (45): "adults", "around", "assessment", "bureau", "care", "census", "center", "debt", "defines", "definition", "department", "departments", "depression", "economic", "education", "families", "family", "food", "growth", "housing"....
0.300
buildingcarecommunitycorecriticaldevelopmentdirectevaluationfacilityfieldfurtheridentifiedinformationmanagementmedicalnursingoutcomespatientperformancephysicians
SHARED TOKENS (41): "building", "care", "community", "core", "critical", "development", "direct", "evaluation", "facility", "field", "further", "identified", "information", "management", "medical", "nursing", "outcomes", "patient", "performance", "physicians"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectsaroundassociatedbehavioralcaseschangesclinicalclinicscommunityconditioncontextdementiadepressiondevelopmentaldifferentdisabilitydisordersearlyfunctionshospitals
SHARED TOKENS (38): "affects", "around", "associated", "behavioral", "cases", "changes", "clinical", "clinics", "community", "condition", "context", "dementia", "depression", "developmental", "different", "disability", "disorders", "early", "functions", "hospitals"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcommercialconsequencescorecostsdescribeddevelopmentexpansiongeographicgrowthhigherhousinginfrastructuremeasureplanningpopulationprivate
SHARED TOKENS (30): "agency", "associated", "become", "building", "commercial", "consequences", "core", "costs", "described", "development", "expansion", "geographic", "growth", "higher", "housing", "infrastructure", "measure", "planning", "population", "private"....
0.300
carecenterscommunitycomplianceconsumerdevelopmentdisordersearlyeffectivefacilitygeneralhospitalhospitalizationhospitalshousingillnesslegallocalmedicalorganizations
SHARED TOKENS (38): "care", "centers", "community", "compliance", "consumer", "development", "disorders", "early", "effective", "facility", "general", "hospital", "hospitalization", "hospitals", "housing", "illness", "legal", "local", "medical", "organizations"....
0.300
analysisassessmentbehavioralbenefitscodescommunityconsultationcounselingcreatecreatingdevelopmentaldifferenteducationalfamiliesfieldinterventionlegalmembersneedsprevention
SHARED TOKENS (26): "analysis", "assessment", "behavioral", "benefits", "codes", "community", "consultation", "counseling", "create", "creating", "developmental", "different", "educational", "families", "field", "intervention", "legal", "members", "needs", "prevention"....
0.300
adultsageagenciesalternativecarechangesdifferentfacilitiesfacilityfamilyformalfuturehealthcarehospitalhospitalizationillnessindependentindividualinsurancelanguage
SHARED TOKENS (51): "adults", "age", "agencies", "alternative", "care", "changes", "different", "facilities", "facility", "family", "formal", "future", "healthcare", "hospital", "hospitalization", "illness", "independent", "individual", "insurance", "language"....
0.300
associatedcaseschangeconditionscontextcontinuousdisordersdistinctearlyeffectiveindividuallifemajormanagementmultipleperformanceprofessionalqualityrelatedrelationship
SHARED TOKENS (25): "associated", "cases", "change", "conditions", "context", "continuous", "disorders", "distinct", "early", "effective", "individual", "life", "major", "management", "multiple", "performance", "professional", "quality", "related", "relationship"....
0.300
behavioralconditionsconsequencescounselingdelivereddisordersgenerallegalmedicalparticipationpatientpsychiatricpsychologicalrecoveryrehabilitationsocialstreettreatment
SHARED TOKENS (18): "behavioral", "conditions", "consequences", "counseling", "delivered", "disorders", "general", "legal", "medical", "participation", "patient", "psychiatric", "psychological", "recovery", "rehabilitation", "social", "street", "treatment".
0.300
advancedassessmentscarecertifieddisordersemergencyfamilieslicensedlimitsmedicalmedicationnursepatientpatientsphysicalphysicianpracticepractitionersprovidepsychiatric
SHARED TOKENS (29): "advanced", "assessments", "care", "certified", "disorders", "emergency", "families", "licensed", "limits", "medical", "medication", "nurse", "patient", "patients", "physical", "physician", "practice", "practitioners", "provide", "psychiatric"....
0.300
accessassociatedcarecategoriescommunitiescommunityconditionconditionsdefinesdefinitiondifferentdirecteffectiveemergencyexperiencefamilygrowthhigherinfrastructurelabor
SHARED TOKENS (30): "access", "associated", "care", "categories", "communities", "community", "condition", "conditions", "defines", "definition", "different", "direct", "effective", "emergency", "experience", "family", "growth", "higher", "infrastructure", "labor"....
0.300
accessadministrationapprovalassessmentscarechangescivilconditionsconsumercreatedevelopmenteducationestablishedexpandingfederallygeneralheavilyhigherhistoryinvolvement
SHARED TOKENS (36): "access", "administration", "approval", "assessments", "care", "changes", "civil", "conditions", "consumer", "create", "development", "education", "established", "expanding", "federally", "general", "heavily", "higher", "history", "involvement"....
0.300
applicationarticleauthoritycivildifferentemploymentfebruaryhistoryjulylaborlawnationalprotectpublicrequirementsrightssection
SHARED TOKENS (17): "application", "article", "authority", "civil", "different", "employment", "february", "history", "july", "labor", "law", "national", "protect", "public", "requirements", "rights", "section".
0.300
creatingdemanddisabilityfunctionsmedicalmobileneedsnetworkolderprivateprogramsprovidepublicratherrelevantruralsocialtechnologytransport
SHARED TOKENS (19): "creating", "demand", "disability", "functions", "medical", "mobile", "needs", "network", "older", "private", "programs", "provide", "public", "rather", "relevant", "rural", "social", "technology", "transport".
0.300
carecommunityemergencyexperiencefamilyfieldformalhealthcareindividualmedicalnurseoccupationalperformpharmacyphysicalphysicianprofessionalproviderpublicregistered
SHARED TOKENS (23): "care", "community", "emergency", "experience", "family", "field", "formal", "healthcare", "individual", "medical", "nurse", "occupational", "perform", "pharmacy", "physical", "physician", "professional", "provider", "public", "registered"....
0.300
Mobile Crisis ↗ Q6886838 KW CROSS HIGH
agenciesagencyassessmentcommunitydisabilityemergencyevaluationshospitalindividualinvolvingleastlegallocalmobilenursingpersonprovidingservesupporttreatment
SHARED TOKENS (20): "agencies", "agency", "assessment", "community", "disability", "emergency", "evaluations", "hospital", "individual", "involving", "least", "legal", "local", "mobile", "nursing", "person", "providing", "serve", "support", "treatment".
0.300
ageassociationbeginbehavioralconditioncurrentdifferentdisordersfamilygrouphistoryindividualmedicalmedicationphysicalprofessionalprogramspsychiatricpsychologicalreported
SHARED TOKENS (28): "age", "association", "begin", "behavioral", "condition", "current", "different", "disorders", "family", "group", "history", "individual", "medical", "medication", "physical", "professional", "programs", "psychiatric", "psychological", "reported"....
0.300
alonecategoryconditiondepressiondisordersgrouphomelessnesshospitalizationillnessitselfmakingnecessaryneedspersonprimarypsychiatricratessinglesurrounding
SHARED TOKENS (19): "alone", "category", "condition", "depression", "disorders", "group", "homelessness", "hospitalization", "illness", "itself", "making", "necessary", "needs", "person", "primary", "psychiatric", "rates", "single", "surrounding".
0.300
additionbusinessescenterschangescoredemographicdevelopmenteasteconomicexpansiongrowthmodeloutcomespopulationpopulationsresidentsruralshiftsocialsuburban
SHARED TOKENS (20): "addition", "businesses", "centers", "changes", "core", "demographic", "development", "east", "economic", "expansion", "growth", "model", "outcomes", "population", "populations", "residents", "rural", "shift", "social", "suburban".
0.300
careconsequencescreatingeducationexpandingframeworkhelpinginformationintegratedlawmedicinemodelneedorganizationspracticeratherrelationshiprelationshipssafetysingle
SHARED TOKENS (21): "care", "consequences", "creating", "education", "expanding", "framework", "helping", "information", "integrated", "law", "medicine", "model", "need", "organizations", "practice", "rather", "relationship", "relationships", "safety", "single"....
0.300
administrationadultadultsagenciesapplicationappointmentbenefitscreateddisabledeligibilitygeneralincomeintendedolderprogramprogramsrequirementssocialtitle
SHARED TOKENS (19): "administration", "adult", "adults", "agencies", "application", "appointment", "benefits", "created", "disabled", "eligibility", "general", "income", "intended", "older", "program", "programs", "requirements", "social", "title".
0.300
accessadditionagenciesarticlebeyondcommunitycoordinationcreatecreatingdefinesdelivereddesigneddevelopmenteconomiceducationeffectiveespeciallyevenextendfamilies
SHARED TOKENS (57): "access", "addition", "agencies", "article", "beyond", "community", "coordination", "create", "creating", "defines", "delivered", "designed", "development", "economic", "education", "effective", "especially", "even", "extend", "families"....
0.300
advocacyassociationcontinuingeducationgeneralguidanceinformationinsurancemembersnationalprofessionalresearchresourcessocialworkers
SHARED TOKENS (15): "advocacy", "association", "continuing", "education", "general", "guidance", "information", "insurance", "members", "national", "professional", "research", "resources", "social", "workers".
0.300
agenciesalternativeassociatedbarriersbusinessescapacitycasescompetitioncompetitiveconsequencesdetermineeconomicemploymententryfirmshigherindustrylawmarketmeasure
SHARED TOKENS (30): "agencies", "alternative", "associated", "barriers", "businesses", "capacity", "cases", "competition", "competitive", "consequences", "determine", "economic", "employment", "entry", "firms", "higher", "industry", "law", "market", "measure"....
0.300
abilityagecarecertifiedclinicaldefinitiondisabilityexpandedfacilitiesgrouphealthcarehospitalslicenselicensedneedneedsnursenursingoccupationspatient
SHARED TOKENS (38): "ability", "age", "care", "certified", "clinical", "definition", "disability", "expanded", "facilities", "group", "healthcare", "hospitals", "license", "licensed", "need", "needs", "nurse", "nursing", "occupations", "patient"....
0.300
Patient advocacy ↗ KW CROSS HIGH
abilityadvocacycarecommunitiesconfidentialityconsentdirectlydisorderseducationeducationalemploymentextendfunctionsgrouphealthcarehospitalsindependentindividualinformedlimited
SHARED TOKENS (39): "ability", "advocacy", "care", "communities", "confidentiality", "consent", "directly", "disorders", "education", "educational", "employment", "extend", "functions", "group", "healthcare", "hospitals", "independent", "individual", "informed", "limited"....
0.300
abilitycarecentersconditionconsentconsolidatedcostsdefinesdepartmentdepartmentsdirectlydischargeemergencyexaminationhospitalhospitalsinformedlaborlawlegal
SHARED TOKENS (33): "ability", "care", "centers", "condition", "consent", "consolidated", "costs", "defines", "department", "departments", "directly", "discharge", "emergency", "examination", "hospital", "hospitals", "informed", "labor", "law", "legal"....
0.300
administrationdepartmentdescribeseducationemergencyenforcementgoverninghealthcarejurisdictionlawlicenselicensinglimitsmedicalnationalpracticepractitionersprofessionalrequirementssafety
SHARED TOKENS (22): "administration", "department", "describes", "education", "emergency", "enforcement", "governing", "healthcare", "jurisdiction", "law", "license", "licensing", "limits", "medical", "national", "practice", "practitioners", "professional", "requirements", "safety"....
0.300
accessassociatedcarechangesconditionseffectiveemergencymakingmental-healthnecessarypovertypsychiatricrepresentresearchrisktechnologytelemedicine
SHARED TOKENS (17): "access", "associated", "care", "changes", "conditions", "effective", "emergency", "making", "mental-health", "necessary", "poverty", "psychiatric", "represent", "research", "risk", "technology", "telemedicine".
0.300
abilityadultsaloneassociatedcaseschronicclinicalcontemporarydescribedgeneralindividualinvolvingleastlifemanagedneedpatientsperformpreventionquality
SHARED TOKENS (24): "ability", "adults", "alone", "associated", "cases", "chronic", "clinical", "contemporary", "described", "general", "individual", "involving", "least", "life", "managed", "need", "patients", "perform", "prevention", "quality"....
0.300
additionaddressingconsentcreateddepartmenteducationfundinggeneralhealthcareledmedicalmissionprimaryprivateprovidingpublicseparatesystemwelfare
SHARED TOKENS (19): "addition", "addressing", "consent", "created", "department", "education", "funding", "general", "healthcare", "led", "medical", "mission", "primary", "private", "providing", "public", "separate", "system", "welfare".
0.300
agencyassociationauthorityclinicaldocumentationlegallylicensemedicalmedicineoccupationalpersonphysicianpracticeprofessionalreceiverequiredrequires
SHARED TOKENS (17): "agency", "association", "authority", "clinical", "documentation", "legally", "license", "medical", "medicine", "occupational", "person", "physician", "practice", "professional", "receive", "required", "requires".
0.300
absorbaccessadministrationagencyannouncedassociationcapacitycenterschangescontroldepartmentdesigneddisabilitydiseaseeducationalespeciallyfebruaryfoodinformationinstitutional
SHARED TOKENS (35): "absorb", "access", "administration", "agency", "announced", "association", "capacity", "centers", "changes", "control", "department", "designed", "disability", "disease", "educational", "especially", "february", "food", "information", "institutional"....
0.300
Schizophrenia ↗ Q41112 KW CROSS HIGH
agebegincasescounselingdescribeddisorderseffectiveespeciallyexperienceformalfurthergeneralhigherhistoryhomelessnesshospitalhospitalizationhospitalsinitialleast
SHARED TOKENS (36): "age", "begin", "cases", "counseling", "described", "disorders", "effective", "especially", "experience", "formal", "further", "general", "higher", "history", "homelessness", "hospital", "hospitalization", "hospitals", "initial", "least"....
0.300
accesscarecentercentersclinicclinicscommunityexpandedfamilygeneralgrouphealthcarelocalmedicinenetworkpharmacyplanningpracticepractitionersprimary
SHARED TOKENS (21): "access", "care", "center", "centers", "clinic", "clinics", "community", "expanded", "family", "general", "group", "healthcare", "local", "medicine", "network", "pharmacy", "planning", "practice", "practitioners", "primary"....
0.300
accessconfidentialityinformationlimitsrules
SHARED TOKENS (5): "access", "confidentiality", "information", "limits", "rules". | EXACT TITLE in senior_services: "Confidentiality". | EXACT TITLE in mental_health: "Confidentiality".
0.300
administrationcarecentersclinicalclinicscommunitycompliancedepartmentevaluationshealthcarehospitalsintegratedleastledmedicalnursingofficeoperationoutpatientoutside
SHARED TOKENS (36): "administration", "care", "centers", "clinical", "clinics", "community", "compliance", "department", "evaluations", "healthcare", "hospitals", "integrated", "least", "led", "medical", "nursing", "office", "operation", "outpatient", "outside"....
0.300
carechronicconditionsdiseasedocumentationeducationespeciallyfollow-uphelpingindividualinterventionmanagementmedicalmedicationmedicinemultipleolderoutcomesplanproviding
SHARED TOKENS (25): "care", "chronic", "conditions", "disease", "documentation", "education", "especially", "follow-up", "helping", "individual", "intervention", "management", "medical", "medication", "medicine", "multiple", "older", "outcomes", "plan", "providing"....
0.300
ageapplicantsbenefitscannotcarechangesconditionsconstraincostscourtcoveragedeliverydemographiceducationeligibilityestimatesexpandedexpansionfundinghealthcare
SHARED TOKENS (48): "age", "applicants", "benefits", "cannot", "care", "changes", "conditions", "constrain", "costs", "court", "coverage", "delivery", "demographic", "education", "eligibility", "estimates", "expanded", "expansion", "funding", "healthcare"....
0.300
Juvenile court ↗ Q468501 KW CROSS HIGH
adultadultsageauthoritycapacitychangescontextcourtcourtscreatecriminaldatadevelopmentearlyfurthergeneralincreasesinterventioninvolvejurisdiction
SHARED TOKENS (36): "adult", "adults", "age", "authority", "capacity", "changes", "context", "court", "courts", "create", "criminal", "data", "development", "early", "further", "general", "increases", "intervention", "involve", "jurisdiction"....
0.300
abilityaddressingaffectingappearbecomebehavioralchangeschronicconditioncriticaldiseaseeffectiveexaminationfurtheridentifiedinitiallifemedicalratherregion
SHARED TOKENS (28): "ability", "addressing", "affecting", "appear", "become", "behavioral", "changes", "chronic", "condition", "critical", "disease", "effective", "examination", "further", "identified", "initial", "life", "medical", "rather", "region"....
0.300
adultagenciescarecategorycommunitycounselingdisorderseducationemploymentfamilyfieldfosterhospitalshousingindividualmedicationmodelofficeorganizationsphysicians
SHARED TOKENS (35): "adult", "agencies", "care", "category", "community", "counseling", "disorders", "education", "employment", "family", "field", "foster", "hospitals", "housing", "individual", "medication", "model", "office", "organizations", "physicians"....
0.300
addresscarecategoriescommunitiescontemporarycurrenteconomicfurtherhealthcareindustryintegrationmedicalpatientspersonpreventiverequirementssectorsystemtreat
SHARED TOKENS (19): "address", "care", "categories", "communities", "contemporary", "current", "economic", "further", "healthcare", "industry", "integration", "medical", "patients", "person", "preventive", "requirements", "sector", "system", "treat".
0.300
acquisitioncapitalcommissioncompetitioncompetitiveconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentityjusticelawlegalmanagementmarketoperating
SHARED TOKENS (29): "acquisition", "capital", "commission", "competition", "competitive", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entity", "justice", "law", "legal", "management", "market", "operating"....
0.300
adultscannotclinicaldepressiondisordersdistincteffectiveexperiencingfunctionsgeneralgroupidentifiedillnessindividuallifemedicaloccupationalpersonphysicalpopulation
SHARED TOKENS (25): "adults", "cannot", "clinical", "depression", "disorders", "distinct", "effective", "experiencing", "functions", "general", "group", "identified", "illness", "individual", "life", "medical", "occupational", "person", "physical", "population"....
0.300
additionaddressesarticlebehavioralcompetitiondefinitioneducationexperiencehelpinginfluenceknowledgelifemajormultipleparticipationperformancephysicalprofessionalprogrampsychological
SHARED TOKENS (30): "addition", "addresses", "article", "behavioral", "competition", "definition", "education", "experience", "helping", "influence", "knowledge", "life", "major", "multiple", "participation", "performance", "physical", "professional", "program", "psychological"....
0.300
addressassessmentscommunitiescommunitycommunity-basedcourtcourtscriminalillnessindividualizedintendedinterventionjudicialjusticeneedsprogramspublicsafetyspecializedsystem
SHARED TOKENS (21): "address", "assessments", "communities", "community", "community-based", "court", "courts", "criminal", "illness", "individualized", "intended", "intervention", "judicial", "justice", "needs", "programs", "public", "safety", "specialized", "system"....
0.300
additionadministersadministrationagencybenefitscenterscreatedcurrentdisabilityestablishedfieldincomeindependentinsurancelocalnationalneedofficeofficesoperates
SHARED TOKENS (27): "addition", "administers", "administration", "agency", "benefits", "centers", "created", "current", "disability", "established", "field", "income", "independent", "insurance", "local", "national", "need", "office", "offices", "operates"....
0.300
assessmentassociatedcasescategorychangesclinicalconditioncontextdeliverydepressiondevelopmentdisordersemergencyespeciallyfamilyfrequentlyhistoryhospitalizationillnessindividual
SHARED TOKENS (37): "assessment", "associated", "cases", "category", "changes", "clinical", "condition", "context", "delivery", "depression", "development", "disorders", "emergency", "especially", "family", "frequently", "history", "hospitalization", "illness", "individual"....
0.300
centercenterscertificationcontinuingcontinuumcostsdepartmenteducationformalfundinghospitalhospital-basedhospitalslicensuremedicaidmedicalmedicinephysicianphysicianspractice
SHARED TOKENS (26): "center", "centers", "certification", "continuing", "continuum", "costs", "department", "education", "formal", "funding", "hospital", "hospital-based", "hospitals", "licensure", "medicaid", "medical", "medicine", "physician", "physicians", "practice"....
0.300
ageagenciesconsumercontextdemographicdifferentearlyestimatesformalhigherindividuallifemeasuremedicinemembersnationalolderorganizationspersonpopulation
SHARED TOKENS (27): "age", "agencies", "consumer", "context", "demographic", "different", "early", "estimates", "formal", "higher", "individual", "life", "measure", "medicine", "members", "national", "older", "organizations", "person", "population"....
0.300
addressassociatedassociationbehavioralconditionconditionsdepressiondesigneddevelopmentdisorderseatingeffectiveespeciallyhelpingidentifiedindividuallimitedlinemedicalnational
SHARED TOKENS (33): "address", "associated", "association", "behavioral", "condition", "conditions", "depression", "designed", "development", "disorders", "eating", "effective", "especially", "helping", "identified", "individual", "limited", "line", "medical", "national"....
0.300
advocacyaroundcommunitycorporateeducationfamiliesfamilyfundinggroupidentifiesillnessindividuallocalmembersmissionnationalnonprofitprovidingpublicpublishes
SHARED TOKENS (22): "advocacy", "around", "community", "corporate", "education", "families", "family", "funding", "group", "identifies", "illness", "individual", "local", "members", "mission", "national", "nonprofit", "providing", "public", "publishes"....
0.300
againstagebenefitscivilconditionsemploymentexplicitlygeneralinformationlaborlawleastneedsolderpublicrequiresrightsstandardstitleworkers
SHARED TOKENS (20): "against", "age", "benefits", "civil", "conditions", "employment", "explicitly", "general", "information", "labor", "law", "least", "needs", "older", "public", "requires", "rights", "standards", "title", "workers".
0.300
administrationagencybenefitscentersclinicscostsdepartmentdisabilityeducationemergencyestablishedexpandedfacilitiesfamilyfuturehealthcareinsurancelifemedicalmembers
SHARED TOKENS (29): "administration", "agency", "benefits", "centers", "clinics", "costs", "department", "disability", "education", "emergency", "established", "expanded", "facilities", "family", "future", "healthcare", "insurance", "life", "medical", "members"....
0.300
addressingagenciesamongbroadercapacitychangechangescommissioncontroldescribeddifferentdiseasegrouplifemajormedicinemerelyoutcomesphysicalpopulation
SHARED TOKENS (25): "addressing", "agencies", "among", "broader", "capacity", "change", "changes", "commission", "control", "described", "different", "disease", "group", "life", "major", "medicine", "merely", "outcomes", "physical", "population"....
0.300
addressagenciesassessmentscounselingemergencyevenfollow-uphelpingneedsorganizationsoutsideprogramprogramsreferralsresponserolesupportwork
SHARED TOKENS (18): "address", "agencies", "assessments", "counseling", "emergency", "even", "follow-up", "helping", "needs", "organizations", "outside", "program", "programs", "referrals", "response", "role", "support", "work".
0.300
civilcodedevelopmentdifferentenforcementexpandedfamiliesfamilyfinancingfollow-upfundinghousinglawmakesnationalprivateprogramsprovisionsrightssection
SHARED TOKENS (21): "civil", "code", "development", "different", "enforcement", "expanded", "families", "family", "financing", "follow-up", "funding", "housing", "law", "makes", "national", "private", "programs", "provisions", "rights", "section"....
0.300
administrationagenciesauthorizationcontractorscoordinationcreateddepartmentdisabilityeducationemploymentestablishextendlawpracticesprincipalprogramsreceivingrehabilitationrequiresresearch
SHARED TOKENS (25): "administration", "agencies", "authorization", "contractors", "coordination", "created", "department", "disability", "education", "employment", "establish", "extend", "law", "practices", "principal", "programs", "receiving", "rehabilitation", "requires", "research"....
0.300
adultadultsageassessmentcarecenterdemanddementiadischargefacilitiesfacilitygeneralgroupguidancehospitalillnesslifemedicalmodelneed
SHARED TOKENS (30): "adult", "adults", "age", "assessment", "care", "center", "demand", "dementia", "discharge", "facilities", "facility", "general", "group", "guidance", "hospital", "illness", "life", "medical", "model", "need"....
0.300
adaadditionagainstchangescivilcostsdisabilityeffectivejulylawnationalprovidepublicrequirementsrequiresrights
SHARED TOKENS (16): "ada", "addition", "against", "changes", "civil", "costs", "disability", "effective", "july", "law", "national", "provide", "public", "requirements", "requires", "rights".
0.300
Alcoholism ↗ Q15326 KW CROSS HIGH
affectsamongassociatedbehavioralclinicalconsequencescontextcostsdefinitionsdementiadevelopmentdirectlydisordersespeciallyfurthergrouphigherillnessincreasesindividual
SHARED TOKENS (41): "affects", "among", "associated", "behavioral", "clinical", "consequences", "context", "costs", "definitions", "dementia", "development", "directly", "disorders", "especially", "further", "group", "higher", "illness", "increases", "individual"....
0.300
amongbecomebenefitscarecodeshealthcareinformationlawlegalmedicalpatientpatientspersonsprotectprovidereceivereceivingrightssupporttreatment
SHARED TOKENS (20): "among", "become", "benefits", "care", "codes", "healthcare", "information", "law", "legal", "medical", "patient", "patients", "persons", "protect", "provide", "receive", "receiving", "rights", "support", "treatment".
0.300
careconsentdependsdocumentdocumentsespeciallyguidancehealthcareillnessincapacityitselfjurisdictionlegallegallymedicalpersonprovidesinglespecifictreatment
SHARED TOKENS (20): "care", "consent", "depends", "document", "documents", "especially", "guidance", "healthcare", "illness", "incapacity", "itself", "jurisdiction", "legal", "legally", "medical", "person", "provide", "single", "specific", "treatment".
0.300
additionadultsagebroadercommunitiescontinuingfamiliesgeriatricillnesslifeneedsnursingolderpopulationpopulationsqualityratesseniorsspecialtysupport
SHARED TOKENS (22): "addition", "adults", "age", "broader", "communities", "continuing", "families", "geriatric", "illness", "life", "needs", "nursing", "older", "population", "populations", "quality", "rates", "seniors", "specialty", "support"....
0.300
accessalternativebehavioralcommunitydesigneddevelopmentaldifferentdisorderseducationeducationalgeneralhigherindividualintegrationmaterialsneedsphysicalpracticeproceduresprovide
SHARED TOKENS (28): "access", "alternative", "behavioral", "community", "designed", "developmental", "different", "disorders", "education", "educational", "general", "higher", "individual", "integration", "materials", "needs", "physical", "practice", "procedures", "provide"....
0.300
additionassociatedcontinuumdemandeconomicemergencyformalhomelessnesshousingincomeincreasesindexlocalmarketsnationalownershippsychologicalresponsesocial
SHARED TOKENS (19): "addition", "associated", "continuum", "demand", "economic", "emergency", "formal", "homelessness", "housing", "income", "increases", "index", "local", "markets", "national", "ownership", "psychological", "response", "social".
0.300
buildingcarechangecommunitiescommunitycontinuingcontinuumdifferentindependentlifemodelmoveneedsnursingplanresidentssettingsingle
SHARED TOKENS (18): "building", "care", "change", "communities", "community", "continuing", "continuum", "different", "independent", "life", "model", "move", "needs", "nursing", "plan", "residents", "setting", "single".
0.300
adultadultsagenciesaroundarticlebuildingcarecommunitiescommunitycontinuingcreatedesignedestablishedestatehousingincomeindependentleastmajormobile
SHARED TOKENS (37): "adult", "adults", "agencies", "around", "article", "building", "care", "communities", "community", "continuing", "create", "designed", "established", "estate", "housing", "income", "independent", "least", "major", "mobile"....
0.300
additioncarecentercenterscodecounselingemergencyjulylinelocalnationalnetworkoperationpreventionprovidereferralsupports
SHARED TOKENS (17): "addition", "care", "center", "centers", "code", "counseling", "emergency", "july", "line", "local", "national", "network", "operation", "prevention", "provide", "referral", "supports".
0.300
carechangesclinicalconditiondepressiondevelopmentearlyeconomicevenexperienceexperiencingfamilyhistoryinvolvelifemedicalpatientplaceproviderstress
SHARED TOKENS (21): "care", "changes", "clinical", "condition", "depression", "development", "early", "economic", "even", "experience", "experiencing", "family", "history", "involve", "life", "medical", "patient", "place", "provider", "stress"....
0.300
adultsagebehavioralcategoriescategorychronicconsequencesdirectdirectlydisordersindividualoperatingphysicalrelatedsubstantial
SHARED TOKENS (15): "adults", "age", "behavioral", "categories", "category", "chronic", "consequences", "direct", "directly", "disorders", "individual", "operating", "physical", "related", "substantial".
0.300
Loneliness ↗ Q223270 KW CROSS HIGH
actualageamongaroundbecomechroniccommunityconnectedconnectionscoveragedepressiondescribeddiseaseexperiencegeneralgroupinteractionisolationlifemechanism
SHARED TOKENS (32): "actual", "age", "among", "around", "become", "chronic", "community", "connected", "connections", "coverage", "depression", "described", "disease", "experience", "general", "group", "interaction", "isolation", "life", "mechanism"....
0.300
approximatelyassociatedassociationbecomecaseschangeschronicclinicalconditionconditionsdepressiondisabilitydisorderseatingeducationexaminationfamilygeneralgrouphistory
SHARED TOKENS (38): "approximately", "associated", "association", "become", "cases", "changes", "chronic", "clinical", "condition", "conditions", "depression", "disability", "disorders", "eating", "education", "examination", "family", "general", "group", "history"....
0.300
Food security ↗ Q1229911 KW CROSS HIGH
accessadditionaffectsageagencyavailabilitybeyondchangechroniccreatedevelopmentdiseaseearlyeconomicestimatesevenfamilyfoodfuturegrowth
SHARED TOKENS (37): "access", "addition", "affects", "age", "agency", "availability", "beyond", "change", "chronic", "create", "development", "disease", "early", "economic", "estimates", "even", "family", "food", "future", "growth"....
0.300
accessagecarecertifiedchangecircumstancesconditioncontinuouscoveragedesignateddischargeevaluationexpandedextensivefacilityfamiliesgeneralhospitalillnessinsurance
SHARED TOKENS (50): "access", "age", "care", "certified", "change", "circumstances", "condition", "continuous", "coverage", "designated", "discharge", "evaluation", "expanded", "extensive", "facility", "families", "general", "hospital", "illness", "insurance"....
0.300
acuteadministrationbecomebuildingcarecommunitydifferentdisorderseatingexperiencingintensivemedicalmedicationnursenursingpositionprogrampsychiatricpsychologicalreceive
SHARED TOKENS (24): "acute", "administration", "become", "building", "care", "community", "different", "disorders", "eating", "experiencing", "intensive", "medical", "medication", "nurse", "nursing", "position", "program", "psychiatric", "psychological", "receive"....
0.300
caredefinesdepartmentfacilityindividualinsurancelicensedmedicalmedicationpaidpersonprofessionalprovideproviderprovidersreceivetreatment
SHARED TOKENS (17): "care", "defines", "department", "facility", "individual", "insurance", "licensed", "medical", "medication", "paid", "person", "professional", "provide", "provider", "providers", "receive", "treatment".
0.300
agencybecomecentersclinicalcurrentdepartmentdiscoveryestablishedexperiencefosterfurtherillnessinstitutionslawmissionnationalorganizationspreventionprimaryrecovery
SHARED TOKENS (23): "agency", "become", "centers", "clinical", "current", "department", "discovery", "established", "experience", "foster", "further", "illness", "institutions", "law", "mission", "national", "organizations", "prevention", "primary", "recovery"....
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessaroundarticlebenefitsconsequencesdatadefinitiondocumentsespeciallyevenidentifyingindividualinformationinvolvinglegallylicensemajornecessaryofficeoperate
SHARED TOKENS (33): "access", "around", "article", "benefits", "consequences", "data", "definition", "documents", "especially", "even", "identifying", "individual", "information", "involving", "legally", "license", "major", "necessary", "office", "operate"....
0.300
advancedalternativearoundcannotcreatedifferententerentryevenexperienceinfluenceitselflinereachrestsmallerstresstoward
SHARED TOKENS (18): "advanced", "alternative", "around", "cannot", "create", "different", "enter", "entry", "even", "experience", "influence", "itself", "line", "reach", "rest", "smaller", "stress", "toward".
0.300
addressaffectsageannualapproximatelyaroundassociatedbecomebehavioralburdencasesclinicalconditionconnectionsdementiadepressiondescribeddevelopmentdiseaseearly
SHARED TOKENS (50): "address", "affects", "age", "annual", "approximately", "around", "associated", "become", "behavioral", "burden", "cases", "clinical", "condition", "connections", "dementia", "depression", "described", "development", "disease", "early"....
0.300
adultassessmentsbuildingcarecentercommunitydepressiondiseasedisordersfamiliesgeriatricgrouphospitalhospitalizationillnessindividualintendedlocalpatientpatients
SHARED TOKENS (30): "adult", "assessments", "building", "care", "center", "community", "depression", "disease", "disorders", "families", "geriatric", "group", "hospital", "hospitalization", "illness", "individual", "intended", "local", "patient", "patients"....
0.300
againstamongcasescommitteecourtcreatedcreatingdepressiondirectearlyestablishedfamilieshealthcareinsurancelaborlawledmajormedicaidnational
SHARED TOKENS (31): "against", "among", "cases", "committee", "court", "created", "creating", "depression", "direct", "early", "established", "families", "healthcare", "insurance", "labor", "law", "led", "major", "medicaid", "national"....
0.300
adaadmissionboisebuildingcapitalconstructiondepartmentdesigndistrictidahojulylistsmaterialsnationaltable
SHARED TOKENS (15): "ada", "admission", "boise", "building", "capital", "construction", "department", "design", "district", "idaho", "july", "lists", "materials", "national", "table".
0.300
aroundbecomecenterscommunitycompetitivedevelopmentaldirectdirectlydisabledemploymentexperiencefoodindependentindividualintegratedintegrationleastmedicationneedsnurse
SHARED TOKENS (25): "around", "become", "centers", "community", "competitive", "developmental", "direct", "directly", "disabled", "employment", "experience", "food", "independent", "individual", "integrated", "integration", "least", "medication", "needs", "nurse"....
🫐 BERRY33 edges
0.280
addressesageassociatedbarrierscreatecreatingdesigndifferentdisabilityknowledgemeasureparticipationrelevantstrategy
SHARED TOKENS (14): "addresses", "age", "associated", "barriers", "create", "creating", "design", "different", "disability", "knowledge", "measure", "participation", "relevant", "strategy".
0.280
adaadamsboisecanyoncountiesgemidahometropolitanowyheepayetteregiontreasurevalleywashington
SHARED TOKENS (14): "ada", "adams", "boise", "canyon", "counties", "gem", "idaho", "metropolitan", "owyhee", "payette", "region", "treasure", "valley", "washington".
0.280
healthcarehospitalmanagementreported
SHARED TOKENS (4): "healthcare", "hospital", "management", "reported". | EXACT TITLE in mental_health: "Universal Health Services".
0.280
approximatelyboisecensusdatadistrictdividedevenidaholimitsmemberspopulationresidentssinglewashington
SHARED TOKENS (14): "approximately", "boise", "census", "data", "district", "divided", "even", "idaho", "limits", "members", "population", "residents", "single", "washington".
0.280
agechangedemographicdesignatedfuturegeriatrichistorypolicypopulationpopulationsratesreachsinglesystems
SHARED TOKENS (14): "age", "change", "demographic", "designated", "future", "geriatric", "history", "policy", "population", "populations", "rates", "reach", "single", "systems".
0.280
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidahowestern
SHARED TOKENS (4): "approximately", "boise", "idaho", "western". | EXACT TITLE in senior_services: "Boise River".
0.260
associationcarecertifiedcreatehealthcareintendednursingpatientspreventiveprofessionalprovidequalityspecialty
SHARED TOKENS (13): "association", "care", "certified", "create", "healthcare", "intended", "nursing", "patients", "preventive", "professional", "provide", "quality", "specialty".
0.260
carefacilitieshealthcarehospitalhospitalsinstitutionsmedicalneedsnetworkpublicregionresourcessystem
SHARED TOKENS (13): "care", "facilities", "healthcare", "hospital", "hospitals", "institutions", "medical", "needs", "network", "public", "region", "resources", "system".
0.260
abilityaffectingageamongexplicitlyfundinggrouphousingmarketperformpersonplacetreatment
SHARED TOKENS (13): "ability", "affecting", "age", "among", "explicitly", "funding", "group", "housing", "market", "perform", "person", "place", "treatment".
0.260
administrationannouncedavailabilitybuildingdepartmentdirectlydisabilityillnessintegratedoutsidequalityreportstreatment
SHARED TOKENS (13): "administration", "announced", "availability", "building", "department", "directly", "disability", "illness", "integrated", "outside", "quality", "reports", "treatment".
0.240
associationconditionsdisordersmemberspatientspopulationpracticeprofessionalpsychiatricpublishesresearchwashington
SHARED TOKENS (12): "association", "conditions", "disorders", "members", "patients", "population", "practice", "professional", "psychiatric", "publishes", "research", "washington".
0.240
NNN lease ↗ Q6954788 KW CROSS HIGH
additionarrangementscommercialestateinsurancelawownershippaidratherrealrelatedsingle
SHARED TOKENS (12): "addition", "arrangements", "commercial", "estate", "insurance", "law", "ownership", "paid", "rather", "real", "related", "single".
0.240
againstageamongcontrolcurrentdefineseconomicmedicalphysicalpsychologicalrelationshipreport
SHARED TOKENS (12): "against", "age", "among", "control", "current", "defines", "economic", "medical", "physical", "psychological", "relationship", "report".
0.220
arrangementscarecoordinateddeliveryfragmentedhealthcareintegratedmodelresponsesocialsystems
SHARED TOKENS (11): "arrangements", "care", "coordinated", "delivery", "fragmented", "healthcare", "integrated", "model", "response", "social", "systems".
0.220
circumstancescounselingdisorderseatingemergencyexpandedidentifyleastmajoroperateproviding
SHARED TOKENS (11): "circumstances", "counseling", "disorders", "eating", "emergency", "expanded", "identify", "least", "major", "operate", "providing".
0.210
rehabilitation
SHARED TOKENS (1): "rehabilitation". | EXACT TITLE in senior_services: "Rehabilitation". | EXACT TITLE in mental_health: "Rehabilitation".
0.200
careeducationeducationalgeneralmedicalnursenursingprofessionalspecializedtraining
SHARED TOKENS (10): "care", "education", "educational", "general", "medical", "nurse", "nursing", "professional", "specialized", "training".
0.200
associationcounselingdevelopmentlicensedlifemissionpracticeprofessionalqualitystudents
SHARED TOKENS (10): "association", "counseling", "development", "licensed", "life", "mission", "practice", "professional", "quality", "students".
0.180
accesscapacitycontroldependeconomicpersonrelatedresourcessupport
SHARED TOKENS (9): "access", "capacity", "control", "depend", "economic", "person", "related", "resources", "support".
0.180
adaboisecensusidahometropolitanmunicipalpopulationseparatestreet
SHARED TOKENS (9): "ada", "boise", "census", "idaho", "metropolitan", "municipal", "population", "separate", "street".
0.180
Star, Idaho ↗ KW CROSS HIGH
adaboisecanyoncensusdistricteastidahometropolitanpopulation
SHARED TOKENS (9): "ada", "boise", "canyon", "census", "district", "east", "idaho", "metropolitan", "population".
0.180
authorizationlawlegalneedpersonprincipalprivaterepresentwelfare
SHARED TOKENS (9): "authorization", "law", "legal", "need", "person", "principal", "private", "represent", "welfare".
0.140
boisecanyoncensusidahometropolitannampapopulation
SHARED TOKENS (7): "boise", "canyon", "census", "idaho", "metropolitan", "nampa", "population".
0.140
disordersinvolvephysicalresourcesreviewtherapytreatment
SHARED TOKENS (7): "disorders", "involve", "physical", "resources", "review", "therapy", "treatment".
0.140
annualassociationdifferentmembersprofessionalpsychologicalstudents
SHARED TOKENS (7): "annual", "association", "different", "members", "professional", "psychological", "students".
0.140
evaluationexperienceinformedprofessionalreviewreviewssites
SHARED TOKENS (7): "evaluation", "experience", "informed", "professional", "review", "reviews", "sites".
0.140
agencycertificationeducationalperformpersonprofessionalpublic
SHARED TOKENS (7): "agency", "certification", "educational", "perform", "person", "professional", "public".
0.140
adultsdemographicmakingmultipleolderpreventionsettings
SHARED TOKENS (7): "adults", "demographic", "making", "multiple", "older", "prevention", "settings".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboisecensusidahometropolitanpopulation
SHARED TOKENS (6): "ada", "boise", "census", "idaho", "metropolitan", "population".
0.120
counselingeducationeducationalhigherprogramsrelated
SHARED TOKENS (6): "counseling", "education", "educational", "higher", "programs", "related".
0.100
buildingcourtcourtsidahojustice
SHARED TOKENS (5): "building", "court", "courts", "idaho", "justice".
0.100
boisecasesfebruaryidahomarch
SHARED TOKENS (5): "boise", "cases", "february", "idaho", "march".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboisecensusidahopopulation
SHARED TOKENS (5): "ada", "boise", "census", "idaho", "population".
◈ Frequently Asked Questions
Senior Services × Mental Health — Treasure Valley
HAIKU · HIGH GATE
How do Medicare and Medicaid coverage affect mental health access for seniors in the Boise metropolitan area?
Medicare and Medicaid in Idaho cover mental health services through the Centers for Medicare & Medicaid Services, which determines reimbursement rates for primary care providers and specialists across the Treasure Valley. Seniors in the Boise metropolitan area qualify for different mental health benefits depending on whether they are covered by Medicare alone, Medicaid, or both programs, affecting their access to therapy and psychiatric care.
What role do Idaho State University and Boise State University play in training social workers for senior mental health services in the Treasure Valley?
Boise State University and Idaho State University operate social work and healthcare research programs that prepare clinicians to serve seniors with mental health and dementia needs across the Treasure Valley. These universities conduct research on disability and aging to inform public health programs and clinical practice in the Boise metropolitan area.
How does telehealth expand mental health care options for seniors receiving services in rural parts of the Treasure Valley?
Telehealth delivery through primary care networks and Centers for Medicare & Medicaid Services-compliant providers allows seniors across the Treasure Valley to access mental health services without traveling to Boise. HIPAA regulations govern how these telehealth programs handle patient data for seniors with dementia and other conditions requiring remote psychiatric or social work intervention.
How does vertical integration of senior services and mental health programs in Idaho improve care coordination in the Boise metropolitan area?
Healthcare organizations in the Boise metropolitan area integrate primary care, social work, and mental health services through single insurance networks, allowing Medicaid and Medicare patients to receive coordinated dementia care and disability support. This vertical integration reduces gaps in mental health referrals for seniors served by senior services agencies across the Treasure Valley.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Senior Services × Mental Health 29 QID bridges 240 edges 6,657 ext links 2026-07-17 23:09:00 UTC a01e791efc0b3e95
Senior Services corridor ↗ Mental Health corridor ↗ Mental Health × Senior Services ↗ boisestandard.org/standard ↗
Parent Corridors
Senior Services × All Other Verticals