—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Senior Services ↔ relates to ↔ Transportation Infrastructure

23 Wikipedia bridge articles confirmed in both vertical ledgers. 239 deterministic cross-vertical edges. 6,630 external source links harvested. Every edge provenance-stamped. Every claim auditable.

23 QID Bridge Articles
239 Cross Edges
6,630 External Sources
272 Wikipedia Articles
27 🌲 Evergreen
181 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Senior Services
× Transportation Infrastructure
QID Bridge Articles
23
confirmed Wikipedia overlap
Total Cross Edges
239
External Sources Harvested
6,630
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  32 shared tokens
QID Bridge Titles (20)
IdahoZoningTreasure ValleyPublic transportBoise State UniversityCollege of Western IdahoParatransitUrban sprawlDemand-responsive transportSuburbanizationLand-use planningAmericans with Disabilities Act of 1990Boise, IdahoNampa, IdahoStar, IdahoAda County, IdahoCaldwell, IdahoGarden City, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanadaeastdevelopmentpubliccanyonlandpeoplewestlocalurbanprivatetransportcitiessecondcapitalwestern
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:10:49 UTC
Content Hash
494eed0ed1f41c56
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
23 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (32): "agricultural", "approximately", "associated", "boise", "capital", "contains", "distinct", "divided", "early", "east", "idaho", "land", "linked", "million", "mountain", "national", "official", "people", "population", "products".... | EXACT TITLE in senior_services: "Idaho". | EXACT TITLE in transportation_infrastructure: "Idaho".
agriculturalapproximatelyassociatedboisecapitalcontainsdistinctdividedearlyeastidaholandlinkedmillionmountainnationalofficialpeoplepopulationproductsriversectorseparatesmallsouthsuppliestechnologyterritoryuseswest+2
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (25): "building", "buildings", "determine", "development", "different", "form", "growth", "land", "land-use", "local", "planning", "policy", "property", "regulations", "regulatory", "residential", "rules", "shape", "single", "size".... | EXACT TITLE in senior_services: "Zoning". | EXACT TITLE in transportation_infrastructure: "Zoning".
buildingbuildingsdeterminedevelopmentdifferentformgrowthlandland-uselocalplanningpolicypropertyregulationsregulatoryresidentialrulesshapesinglesizesystemsurbanuseszonezoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
(e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
pment may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (15): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in senior_services: "Treasure Valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitanregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Public transport
Q178512 EXACT TITLE 1.000
QID OVERLAP: Q178512 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (54): "access", "alternatives", "arrangements", "association", "competitive", "coordination", "costs", "designated", "development", "economic", "estate", "financial", "fixed", "frequently", "funding", "general", "historical", "industry", "infrastructure", "integrated".... | EXACT TITLE in senior_services: "Public transport". | EXACT TITLE in transportation_infrastructure: "Public transport".
accessalternativesarrangementsassociationcompetitivecoordinationcostsdesignateddevelopmenteconomicestatefinancialfixedfrequentlyfundinggeneralhistoricalindustryinfrastructureintegratedintendedinvestmentlocalmodelmunicipalnetworkoperateoperatingoperationaloperations+24
t use of infrastructure. High-frequency services often prioritize regular headways over exact departure times. However, many trips involve multimodal travel, such as walking or feeder bus services to access rail stations, highlighting the importance of network coordination and cost-effective planning. In some regions, share taxis and other demand-responsive services provide flexible alternatives to fixed-route transit, either competing with or complementing traditional systems. Paratransit services are typically reserved for low-demand areas or passengers requiring door-to-door transportation, often at higher per-trip costs. Public transport systems vary significantly by region due to historical, geographic, and economic factors. In Japan, many urban transit networks are operated by profit-oriented private companies, often integrated with real estate development, a model frequently cited for its financial sustainability and operational efficiency. In North America, mass transit is most commonly operated by municipal or regional transit authorities, typically funded through a combination of fares, local taxes, and government subsidies. In Europe, both state-owned enterprises and private operators participate in transit provision, often under competitive contracting arrangements. For geographic and economic reasons, levels of public transport use and investment differ widely across countries.
Light rail transit Light rail transit (LRT) is a term coined in 1972 and uses mainly tram technology. Light rail has mostly dedicated right-of-ways and less sections shared with other traffic and usually step-free access. A light rail line is generally traversed with increased speed compared to a tram line. Light rail lines are, thus, essentially modernized interurbans. Unlike trams, light rail trains are often longer and have one to four cars per train.
Personal rapid transit (PRT) is an automated cab service that runs on rails or a guideway. This is an uncommon mode of transportation (excluding elevators) due to the complexity of automation. A fully implemented system might provide most of the convenience of individual automobiles with the efficiency of public transit. The crucial innovation is that the automated vehicles carry just a few passengers, turn off the guideway to pick up passengers (permitting other PRT vehicles to continue at full speed), and drop them off to the location of their choice (rather than at a stop). Conventional transit simulations show that PRT might attract many auto users in problematic medium-density urban areas. A number of experimental systems are in progress. One might compare personal rapid transit to the more labor-intensive taxi or paratransit modes of transportation, or to the (by now automated) elevators common in many publicly accessible areas. Automated people mover (APM) are a special term for grade-separated rail which uses vehicles that are smaller and shorter in size.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "college", "compete", "economics", "education", "health", "high", "idaho", "independent", "million", "mountain", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in senior_services: "Boise State University". | EXACT TITLE in transportation_infrastructure: "Boise State University".
activityamongboisecollegecompeteeconomicseducationhealthhighidahoindependentmillionmountainprogramprogramspublicreportedresearchuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (28): "ada", "boise", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "reported", "residents".... | EXACT TITLE in senior_services: "College of Western Idaho". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
adaboisecanyoncollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicreportedresidentssouthweststudentsthroughouttransfertreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Paratransit
Q2564783 EXACT TITLE 1.000
QID OVERLAP: Q2564783 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (40): "access", "agencies", "beyond", "cities", "community", "designed", "disabilities", "discharge", "drivers", "economic", "extends", "fixed", "form", "formal", "income", "local", "metropolitan", "mobility", "operate", "operates".... | EXACT TITLE in senior_services: "Paratransit". | EXACT TITLE in transportation_infrastructure: "Paratransit".
accessagenciesbeyondcitiescommunitydesigneddisabilitiesdischargedriverseconomicextendsfixedformformalincomelocalmetropolitanmobilityoperateoperatesoperatorsorganizationsparatransitpeopleprivateprovideprovidingpublicregulationroutes+10
ily income, which supports their livelihoods. Typically, minibuses are used to provide paratransit service in USA. Most paratransit vehicles are equipped with wheelchair lifts or ramps to facilitate access. In the United States, private transportation companies often provide paratransit service in cities and metropolitan areas under contract to local public transportation agencies. Terminology The use of "paratransit" ("para transit", "para-transit") has evolved and taken on two somewhat separate broad sets of meaning and application in North America; the term is rarely used in the rest of the world. The more general meaning includes any transit service operating alongside conventional fixed-route services, including airport limousines and carpools. Since the early 1980s, particularly in North America, the term began to be used increasingly to describe the second meaning: special transport services for people with disabilities. In this respect, paratransit has become a subsector and business in its own right. The term paratransit is rarely used outside of North America. Projects in the broader sense were documented by the Urban Institute in the 1974 book Para-transit: Neglected options for urban mobility, followed a year later by the first international overview, Paratransit: Survey of International Experience and Prospects. Robert Cervero's 1997 book, Paratransit in America: Redefining Mass Transportation, embraced this wider definition of paratransit, arguing that America's mass transit sector should enlarge to include micro-vehicles, minibuses, and shared-taxi services found in many developing cities.
Diversion to taxis and ride-hailing services Some paratransit systems have begun subsidizing private taxi or ride-hailing trips as an alternative to the government-run or government-contracted system. For example, in 2010, Solano County, California dissolved Solano Paratransit and allowed paratransit-eligible passengers to buy $100 worth of taxi scrip for $15. This eliminated the need for passengers to book a week in advance, and reduced the cost to the county from $81 to about $30. In 2016, the Massachusetts Bay Transportation Authority began a pilot program which has subsidized paratransit passengers on Uber, Lyft, and Curb, up to a cap of $42 per ride. This retained the ability to book by phone, lowered the fare for riders, eliminated the need to book the trip a day in advance, eliminated shared trips, reduced in-transit time, and reduced the pickup wait time from 30 minutes to as low as 5 minutes in the urban core. With the subsidy cap initially set at $13, the MBTA reduced the average cost of a paratransit trip from $35 to $9. Pilot participants on average substantially increased the number of trips they took, but still at a lower overall cost to the agency. Availability of wheelchair-accessible vehicles remained an occasional problem, but these were only needed by about 20% of paratransit riders. In the United States Rehabilitation Act of 1973 Before passage of the Americans with Disabilities Act of 1990 (ADA), paratransit was provided by not-for-profit human service agencies and public transit agencies in response to the requirements in Section 504 of the Rehabilitation Act of 1973. Section 504 prohibited the exclusion of disabled people from "any program or activity receiving federal financial assistance". In Title 49 Part 37 (49 CFR 37) of the Code of Federal Regulations, the Federal Transit Administration defined requirements for making buses accessible or providing complementary paratransit services within public transit service areas. Most transit agencies did not see fixed route accessibility as desirable and opted for a flexible system of small paratransit vehicles operating parallel to a system of larger, fixed-route buses. The expectation was that the paratransit services would not be heavily used, making a flexible system of small vehicles a less expensive alternative for accessibility than options with larger, fixed-route vehicles. This however ended up not being the case. Often paratransit services were being filled up to their capacity.
Rehabilitation Act of 1973 Before passage of the Americans with Disabilities Act of 1990 (ADA), paratransit was provided by not-for-profit human service agencies and public transit agencies in response to the requirements in Section 504 of the Rehabilitation Act of 1973. Section 504 prohibited the exclusion of disabled people from "any program or activity receiving federal financial assistance". In Title 49 Part 37 (49 CFR 37) of the Code of Federal Regulations, the Federal Transit Administration defined requirements for making buses accessible or providing complementary paratransit services within public transit service areas. Most transit agencies did not see fixed route accessibility as desirable and opted for a flexible system of small paratransit vehicles operating parallel to a system of larger, fixed-route buses. The expectation was that the paratransit services would not be heavily used, making a flexible system of small vehicles a less expensive alternative for accessibility than options with larger, fixed-route vehicles. This however ended up not being the case. Often paratransit services were being filled up to their capacity.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (38): "agency", "associated", "become", "building", "cities", "commercial", "costs", "dense", "described", "development", "environment", "environmental", "existing", "expansion", "form", "growth", "housing", "infrastructure", "land", "large"....
agencyassociatedbecomebuildingcitiescommercialcostsdensedescribeddevelopmentenvironmentenvironmentalexistingexpansionformgrowthhousinginfrastructurelandlargemeasurepeopleplanningpopulationprivatepropertyratesrequireresidentialsupport+8
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Another prominent form of retail development in areas characterized by sprawl is the shopping mall. Unlike the strip mall, this is usually composed of a single building surrounded by a parking lot that contains multiple shops, usually "anchored" by one or more department stores. The function and size is also distinct from the strip mall. The focus is almost exclusively on recreational shopping rather than daily goods. Shopping malls also tend to serve a wider (regional) public and require higher-order infrastructure such as highway access and can have floorspaces in excess of 1 million sq ft (93,000 m2). Shopping malls are often detrimental to downtown shopping centres of nearby cities since the shopping malls act as a surrogate for the city centre. Some downtowns have responded to this challenge by building shopping centres of their own. Fast food chains are often built early in areas with low property values where the population is expected to boom and where large traffic is predicted, and set a precedent for future development. Eric Schlosser, in his book Fast Food Nation, argues that fast food chains accelerate suburban sprawl and help set its tone with their expansive parking lots, flashy signs, and plastic architecture (65). Duany Plater Zyberk & Company believe that this reinforces a destructive pattern of growth in an endless quest to move away from the sprawl that only results in creating more of it. Effects Environmental One of the major environmental problems associated with urban sprawl is land consumption, habitat loss, land pollution, subsequent reduction in biodiversity and destruction of local ecosystems. A review by Brian Czech and colleagues, finds that urbanization endangers more species and is more geographically ubiquitous in the mainland United States than any other human activity. Urban sprawl is disruptive to native flora & fauna and introduces invasive plants into their environments, which are considered to be harmful to local biomes. Although the effects can be mitigated through careful maintenance of native vegetation, the process of ecological succession and public education, sprawl represents one of the primary threats to biodiversity. Regions with high birth rates and immigration are therefore faced with environmental problems due to unplanned urban growth and emerging megacities such as Kolkata, Shenzen, and Chongqing. Unregulated urban sprawl in these areas contributes to severe pollution, resource depletion, and ecosystem degradation. For instance, Kolkata's expansion has led to extensive deforestation and wetland destruction, endangering biodiversity and increasing flood risks. Additionally, Chongqing, as one of China's fastest-growing urban centers. struggles with severe air pollution due to its reliance on coal-powered industries, with particulate matter (PM2.5) levels often exceeding World Health Organization safety limits. The rapid expansion of urban infrastructure in such megacities increases greenhouse gas emissions, with transportation and construction sectors contributing significantly to climate change.
Demand-responsive transport
QID OVERLAP 0.800
QID OVERLAP: Q293849 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (25): "creating", "demand", "disability", "fixed", "form", "functions", "medical", "mobile", "needs", "network", "older", "paratransit", "people", "private", "programs", "provide", "public", "rather", "relevant", "routes"....
creatingdemanddisabilityfixedformfunctionsmedicalmobileneedsnetworkolderparatransitpeopleprivateprogramsprovidepublicratherrelevantroutesruralsharedtechnologytransittransport
s of passengers. One example is the paratransit programs for people with a disability. The provision of public transport in this manner emphasises one of its functions as a social service rather than creating a viable movement network. Definition DRT can be used to refer to many different types of transport. When taxicabs were first introduced to many cities, they were hailed as an innovative form of DRT. They are still referred to as DRT in some jurisdictions around the world as their very nature is to take people from point-to-point based on their needs. More recently, DRT generally refers to a type of public transport. They are distinct from fixed-route services as they do not always operate to a specific timetable or route. While specific operations vary widely, generally a particular area is designated for service by DRT. Once a certain number of people have requested a trip, the most efficient route will then be calculated depending on the origins and destinations of passengers. Share taxis are another form of DRT. They are usually operated on an ad hoc basis but also do not have fixed routes or times and change their route and frequency depending on demand. Some DRT systems operate as a service that can deviate from a fixed route.
Demand-responsive transport (DRT), also known as demand-responsive transit, demand-responsive service, Dial-a-Ride transit (sometimes DART), flexible transport services, Microtransit, Non-Emergency Medical Transport (NEMT), Carpool or On-demand bus service is a form of shared private or quasi-public transport for groups traveling where vehicles alter their routes each journey based on particular transport demand without using a fixed route or timetabled journeys. These vehicles typically pick-up and drop-off passengers in locations according to passengers needs and can include taxis, buses or other vehicles. Passengers can typically summon the service with a mobile phone app or by telephone; telephone is particularly relevant to older users who may not be conversant with technology. One of the most widespread types of demand-responsive transport (DRT) is to provide a public transport service in areas of low passenger demand where a regular bus service is not considered to be financially viable, such as rural and peri-urban areas. Services may also be provided for particular types of passengers. One example is the paratransit programs for people with a disability.
nsport (NEMT), Carpool or On-demand bus service is a form of shared private or quasi-public transport for groups traveling where vehicles alter their routes each journey based on particular transport demand without using a fixed route or timetabled journeys. These vehicles typically pick-up and drop-off passengers in locations according to passengers needs and can include taxis, buses or other vehicles. Passengers can typically summon the service with a mobile phone app or by telephone; telephone is particularly relevant to older users who may not be conversant with technology. One of the most widespread types of demand-responsive transport (DRT) is to provide a public transport service in areas of low passenger demand where a regular bus service is not considered to be financially viable, such as rural and peri-urban areas. Services may also be provided for particular types of passengers. One example is the paratransit programs for people with a disability.
Suburbanization
Q1091971 QID OVERLAP 0.800
QID OVERLAP: Q1091971 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (26): "american", "built", "businesses", "centers", "changes", "cities", "demographic", "development", "drive", "east", "economic", "environmental", "expansion", "growing", "growth", "model", "planned", "population", "populations", "process"....
americanbuiltbusinessescenterschangescitiesdemographicdevelopmentdriveeasteconomicenvironmentalexpansiongrowinggrowthmodelplannedpopulationpopulationsprocessresidentsruralshiftsouthurbanzone
Suburbanization (American English), also spelled suburbanisation (British English), is a population shift from historic core cities or rural areas into suburbs. Most suburbs are built in a formation of (sub)urban sprawl. As a consequence of the movement of households and businesses away from city centers, low-density, peripheral urban areas grow. Proponents of curbing suburbanization argue that sprawl leads to urban decay and a concentration of lower-income residents in the inner city, in addition to environmental harm. Suburbanization can be a progressive process in which growing populations, technological innovations, and economic changes drive settlement outward, following the concentric zone model. Suburban growth takes many forms globally including planned satellite towns in Europe, rail-oriented suburbs in East Asia, Canadian high-rises, and the expansion of informal peri-urban areas in the Global South.
Drug abuse Pre-existing disparities in the demographic composition of suburbs pose problems in drug consumption and abuse. This is due to the disconnection created between drug addiction and the biased outward perception of suburban health and safety. In the United States, the combination of demographic and economic features created as a result of suburbanization has increased the risk of drug abuse in suburban communities. Heroin in suburban communities has increased in incidence as new heroin users in the United States are predominantly white suburban men and women in their early twenties. Adolescents and young adults are at an increased risk of drug abuse in suburban spaces due to the enclosed social and economic enclaves that surburbanization propagates. The New England Study of Suburban Youth found that the upper middle class suburban cohorts displayed an increased drug use when compared to the natural average. The shift in demographics and economic statuses related to suburbanization has increased the risk of drug abuse in affluent American communities and changed the approach to drug abuse public health initiatives. When addressing public health concerns of drug abuse with patients directly, suburban health care providers and medical practitioners have the advantage of treating a demographic of drug abuse patients that are better educated and equipped with resources to recover from addiction and overdose. The disparity of treatment and initiatives between suburban and urban environments in regard to drug abuse and overdose is a public health concern. Although suburban healthcare providers may have more resources to address drug addiction, abuse, and overdose, preconceived ideas about suburban lifestyles may prevent them from providing proper treatment to patients. Considering the increasing incidence of drug abuse in suburban environments, the contextual factors that affect certain demographics must also be considered to better understand the prevalence of drug abuse in suburbs.
The economic impacts of suburbanization have become very evident since the trend began in the 1950s. Changes in infrastructure, industry, real estate development costs, fiscal policies, and diversity of cities have been easily apparent, as "making it to the suburbs", mainly in order to own a home and escape the chaos of urban centers, have become the goals of many American citizens. These impacts have many benefits as well as side effects and are becoming increasingly important in the planning and revitalization of modern cities. Impact on urban industry The days of industry dominating the urban cores of cities are diminishing as population decentralization of urban centers increases. Companies increasingly look to build industrial parks in less populated areas, largely for more modern buildings and ample parking, as well as to appease the popular desire to work in less congested areas. Government economic policies that provide incentives for companies to build new structures and lack of incentives to build on Brownfield land, also contribute to the flight of industrial development from major cities to surrounding suburban areas. As suburban industrial development becomes increasingly more profitable, it becomes less financially attractive to build in high-density areas. Another impact of industry leaving the city is the reduction of buffer zones separating metropolitan areas, industrial parks and surrounding suburban residential areas.
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (54): "act", "alternatives", "american", "association", "authority", "changes", "cities", "communities", "community", "comprehensive", "conditions", "costs", "creating", "depend", "depends", "design", "development", "economic", "environmental", "exposure"....
actalternativesamericanassociationauthoritychangescitiescommunitiescommunitycomprehensiveconditionscostscreatingdependdependsdesigndevelopmenteconomicenvironmentalexposurefacilitiesfunctionfurtherfuturegoalhealthlandland-usemanagemeans+24
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.800
QID OVERLAP: Q1111004 in senior_services (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (20): "act", "ada", "against", "americans", "changes", "civil", "costs", "disabilities", "disability", "effective", "employers", "final", "law", "national", "protections", "provide", "public", "requirements", "requires", "rights".
actadaagainstamericanschangescivilcostsdisabilitiesdisabilityeffectiveemployersfinallawnationalprotectionsprovidepublicrequirementsrequiresrights
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (18): "ada", "annual", "boise", "capital", "counties", "east", "employers", "home", "idaho", "level", "locally", "major", "metropolitan", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountieseastemployershomeidaholevellocallymajormetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "second", "university", "west", "western".
boisecanyoncollegehomeidahomeridianmetropolitannampapopulationprincipalseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Star, Idaho
QID OVERLAP 0.760
QID OVERLAP: Q1516815 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (13): "ada", "boise", "canyon", "district", "east", "growing", "idaho", "metropolitan", "middleton", "population", "shared", "star", "west".
adaboisecanyondistricteastgrowingidahometropolitanmiddletonpopulationsharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in senior_services (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "east", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "second".
adaboisecapitaldistricteasthomeidahojurisdictionlocalmetropolitanpopulationprivatesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Garden City, Idaho
Q1516892 QID OVERLAP 0.700
QID OVERLAP: Q1516892 in senior_services (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "garden", "idaho", "metropolitan", "municipal", "population", "second", "separate", "street".
adaboisegardenidahometropolitanmunicipalpopulationsecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in senior_services (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "population".
adaadditionalboiseidahokunametropolitanpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Middleton, Idaho
Q1517595 QID OVERLAP 0.640
QID OVERLAP: Q1517595 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
boisecanyonidahometropolitanmiddletonnampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in senior_services (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
216 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP216 edges
🌲 EVERGREEN4 edges
0.650
acquisitionagencycommissionconstructioncreatedeconomicfederalindependentindustryjurisdictionmattersoversightpowerspreviouslyregulationregulatoryrelevantservessubjecttransportation
SHARED TOKENS (21): "acquisition", "agency", "commission", "construction", "created", "economic", "federal", "independent", "industry", "jurisdiction", "matters", "oversight", "powers", "previously", "regulation", "regulatory", "relevant", "serves", "subject", "transportation".... | URL->B (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
carecategorydirecteducationhealthcareindividualjurisdictionlicensednationalpeopleplanpracticepractitionersprofessionalprogramprogramsprovidingregisteredrequireresponsible
SHARED TOKENS (24): "care", "category", "direct", "education", "healthcare", "individual", "jurisdiction", "licensed", "national", "people", "plan", "practice", "practitioners", "professional", "program", "programs", "providing", "registered", "require", "responsible".... | URL->A (1): http://www.bls.gov/ooh/Healthcare/Licensed-practical-and-licensed-vocational-nurses.htm. | EXACT TITLE in senior_services: "Licensed practical nurse".
0.650
acquisitionadministrationamericancommercialcostsfederalfundinggeneralgrantlandmanagedplanningprogramprojectspublicsafetysizetaxestrust
SHARED TOKENS (19): "acquisition", "administration", "american", "commercial", "costs", "federal", "funding", "general", "grant", "land", "managed", "planning", "program", "projects", "public", "safety", "size", "taxes", "trust". | URL->B (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamongauthorityboisecanyoncapacitycapitalcentercitiescostcostsdemanddistrictdriverseagleearlyemployersenvironmental
SHARED TOKENS (78): "ada", "additional", "agencies", "among", "authority", "boise", "canyon", "capacity", "capital", "center", "cities", "cost", "costs", "demand", "district", "drivers", "eagle", "early", "employers", "environmental".... | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH181 edges
0.590
agencycreatedcreatingdepartmentenforcementidaholawmunicipalorganizationpolicepublicstatewide
SHARED TOKENS (12): "agency", "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "public", "statewide". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
associatedbuildingbuildingsbuiltconstructioncontributesdesigndevelopmenteconomicexpandextendfacilitiesfinancingindustryinfrastructuremaintenanceplanningprocessproductswork
SHARED TOKENS (20): "associated", "building", "buildings", "built", "construction", "contributes", "design", "development", "economic", "expand", "extend", "facilities", "financing", "industry", "infrastructure", "maintenance", "planning", "process", "products", "work". | EXACT TITLE in senior_services: "Construction". | EXACT TITLE in transportation_infrastructure: "Construction".
0.500
Culvert ↗ Q4168092 EXACT TITLE
designedembeddedfrequentlyitselfmaterialneedperformanceplacingpracticeprocessrequirementsroadselectionshapestructurevehiclewater
SHARED TOKENS (17): "designed", "embedded", "frequently", "itself", "material", "need", "performance", "placing", "practice", "process", "requirements", "road", "selection", "shape", "structure", "vehicle", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
additionalagenciesalongsideambulancecaredepartmentsemergencyhospitalsmedicalmunicipalpracticeprofessionalprovidepublicreceiverequireruralservingtechniciantraining
SHARED TOKENS (21): "additional", "agencies", "alongside", "ambulance", "care", "departments", "emergency", "hospitals", "medical", "municipal", "practice", "professional", "provide", "public", "receive", "require", "rural", "serving", "technician", "training".... | EXACT TITLE in senior_services: "Emergency medical technician".
0.500
associationcreatedenvironmentalespeciallyfrequentlylandmobilitymultipleparkspeoplerightsruralserveservesurbanutility
SHARED TOKENS (16): "association", "created", "environmental", "especially", "frequently", "land", "mobility", "multiple", "parks", "people", "rights", "rural", "serve", "serves", "urban", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
canyoncivilconstructionemergencygeneralhomeidahointegratedmilitarymissionmountainmunicipalnampanationalplanprivatepublicriversystemstraining
SHARED TOKENS (20): "canyon", "civil", "construction", "emergency", "general", "home", "idaho", "integrated", "military", "mission", "mountain", "municipal", "nampa", "national", "plan", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
amongcarecategoryclinicalcommunitiescommunitydefinesdepartmentdifferentdisabilitydistincteconomiceducationentryenvironmentenvironmentaleventsfieldformalgroup
SHARED TOKENS (57): "among", "care", "category", "clinical", "communities", "community", "defines", "department", "different", "disability", "distinct", "economic", "education", "entry", "environment", "environmental", "events", "field", "formal", "group".... | EXACT TITLE in senior_services: "Community health".
0.500
Geriatrics ↗ Q10384 EXACT TITLE
addressingadultsagebecomebehavioralcarecomplexconditionsdecisiondistinctionenvironmentalfocusedfunctionhealthindividualmanagemedicalmultipleneedsolder
SHARED TOKENS (30): "addressing", "adults", "age", "become", "behavioral", "care", "complex", "conditions", "decision", "distinction", "environmental", "focused", "function", "health", "individual", "manage", "medical", "multiple", "needs", "older".... | EXACT TITLE in senior_services: "Geriatrics".
0.500
accessadultsageassistancecentercenterscitiescommunitycriticaleventsfacilityfederalfieldfinancialfundinggenerationlimitedlocalmeansmultiple
SHARED TOKENS (35): "access", "adults", "age", "assistance", "center", "centers", "cities", "community", "critical", "events", "facility", "federal", "field", "financial", "funding", "generation", "limited", "local", "means", "multiple".... | EXACT TITLE in senior_services: "Senior center".
0.500
Gerontology ↗ Q10387 EXACT TITLE
adultsamongarchitecturebehavioralcentercreateddesigndesigneddevelopmenteconomicsespeciallyexistingfieldgeographyhealthhomehousinglivingmeansneed
SHARED TOKENS (39): "adults", "among", "architecture", "behavioral", "center", "created", "design", "designed", "development", "economics", "especially", "existing", "field", "geography", "health", "home", "housing", "living", "means", "need".... | EXACT TITLE in senior_services: "Gerontology".
0.500
administrationauthoritycareclinicaleducationfunctionhealthhealthcaremanagementmedicalpatientphysicalpracticeprimaryprivateprovideprovidingpublicresearchtrained
SHARED TOKENS (20): "administration", "authority", "care", "clinical", "education", "function", "health", "healthcare", "management", "medical", "patient", "physical", "practice", "primary", "private", "provide", "providing", "public", "research", "trained". | EXACT TITLE in senior_services: "Physical therapy".
0.500
buildingcentercenterscommercialdedicateddeliverydemanddestinationsdirectlyequipmentfacilityfirmsfunctionhandlinglaborlargelogisticsmarketnetworkoperate
SHARED TOKENS (33): "building", "center", "centers", "commercial", "dedicated", "delivery", "demand", "destinations", "directly", "equipment", "facility", "firms", "function", "handling", "labor", "large", "logistics", "market", "network", "operate".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
acquiredadultsaffectsapproximatelyavailabilitycannotcategoryconditionconditionsconstituteevenextendedhealthmajormedicalmillionorganizationpeopletreatment
SHARED TOKENS (19): "acquired", "adults", "affects", "approximately", "availability", "cannot", "category", "condition", "conditions", "constitute", "even", "extended", "health", "major", "medical", "million", "organization", "people", "treatment". | EXACT TITLE in senior_services: "Chronic condition".
0.500
ageassistedassociatedcannotcarecommunityconditionscoordinateddisabilityfacilitiesfocusedhomelevellivinglong-termmedicalmultipleneedneedsolder
SHARED TOKENS (30): "age", "assisted", "associated", "cannot", "care", "community", "conditions", "coordinated", "disability", "facilities", "focused", "home", "level", "living", "long-term", "medical", "multiple", "need", "needs", "older".... | EXACT TITLE in senior_services: "Long-term care".
0.500
accessactcomprehensivecontinuingcreatedexistingfederalfederallyfundingfuturegovernedlawlocalmetropolitanorganizationparticipationplanningpopulationprocessprograms
SHARED TOKENS (26): "access", "act", "comprehensive", "continuing", "created", "existing", "federal", "federally", "funding", "future", "governed", "law", "local", "metropolitan", "organization", "participation", "planning", "population", "process", "programs".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Broadband ↗ Q194163 EXACT TITLE
accessbroadbandcontextdatadifferentdigitalhighintegratedlevelnetworkplannedproviderequirementstechnologytelecommunicationstransferuses
SHARED TOKENS (17): "access", "broadband", "context", "data", "different", "digital", "high", "integrated", "level", "network", "planned", "provide", "requirements", "technology", "telecommunications", "transfer", "uses". | EXACT TITLE in senior_services: "Broadband". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
broadercitiescomprehensivecoveringdevelopmenteconomicenvironmentalfocusgrowthindividualinfrastructurelandland-uselargerlawslevelmanagemanagementmilitarynational
SHARED TOKENS (37): "broader", "cities", "comprehensive", "covering", "development", "economic", "environmental", "focus", "growth", "individual", "infrastructure", "land", "land-use", "larger", "laws", "level", "manage", "management", "military", "national".... | EXACT TITLE in senior_services: "Regional planning". | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
arrangementbecomechaincomplexconsolidationdescribeddifferentdirectlyfinalintegratedintegrationlargemakingmanagementmarketneedownedownershipportionsposition
SHARED TOKENS (30): "arrangement", "become", "chain", "complex", "consolidation", "described", "different", "directly", "final", "integrated", "integration", "large", "making", "management", "market", "need", "owned", "ownership", "portions", "position".... | EXACT TITLE in senior_services: "Vertical integration".
0.500
accessagenciesbroadbandcommunityconditionscreateddevelopmentdifferentdistincteconomicemergencyenforcementenvironmentenvironmentalespeciallyfacilitiesfirmsfocusfocusedfrequently
SHARED TOKENS (52): "access", "agencies", "broadband", "community", "conditions", "created", "development", "different", "distinct", "economic", "emergency", "enforcement", "environment", "environmental", "especially", "facilities", "firms", "focus", "focused", "frequently".... | EXACT TITLE in senior_services: "Infrastructure". | EXACT TITLE in transportation_infrastructure: "Infrastructure".
0.500
Dementia ↗ Q83030 EXACT TITLE
abilityaffectsapproximatelyassociatedbehavioralbodieschangesconditioncontroldescribeddeterminedevelopmentdisabilitiesfeaturesformgeneralhistoryidentifyindividualintelligence
SHARED TOKENS (31): "ability", "affects", "approximately", "associated", "behavioral", "bodies", "changes", "condition", "control", "described", "determine", "development", "disabilities", "features", "form", "general", "history", "identify", "individual", "intelligence".... | EXACT TITLE in senior_services: "Dementia".
0.500
abilitycarechangesclinicalcommunitiesdefinesdisabilityearlyenvironmentequipmentformformalfunctiongoalgrouphealthhealthcareinterdisciplinarynationalneed
SHARED TOKENS (33): "ability", "care", "changes", "clinical", "communities", "defines", "disability", "early", "environment", "equipment", "form", "formal", "function", "goal", "group", "health", "healthcare", "interdisciplinary", "national", "need".... | EXACT TITLE in senior_services: "Occupational therapy".
0.500
agriculturalalongsideconcentrateddemographicdevelopmentdirectenvironmentenvironmentalestimatesfocusedgroupgrowinggrowthhighincreaseindividuallimitedlivingmedicalmillion
SHARED TOKENS (33): "agricultural", "alongside", "concentrated", "demographic", "development", "direct", "environment", "environmental", "estimates", "focused", "group", "growing", "growth", "high", "increase", "individual", "limited", "living", "medical", "million".... | EXACT TITLE in senior_services: "Population growth". | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
ageamongassociatedbroadercarecomplexdefinitionsdescribesearlyfailfieldgoalhealthhealthcarehomehospitalsincreaseinterdisciplinarylimitedmeans
SHARED TOKENS (37): "age", "among", "associated", "broader", "care", "complex", "definitions", "describes", "early", "fail", "field", "goal", "health", "healthcare", "home", "hospitals", "increase", "interdisciplinary", "limited", "means".... | EXACT TITLE in senior_services: "Palliative care".
0.500
certificationcontinuedextendfieldformallaborlevellicensepeopleplacementpracticepractitionersprofessionalreachregulatedstudysystemtraining
SHARED TOKENS (18): "certification", "continued", "extend", "field", "formal", "labor", "level", "license", "people", "placement", "practice", "practitioners", "professional", "reach", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
communitydescribesdevelopmenteconomiceconomicsespeciallyfocusedfrequentlygrowthhistoricallyincreasesindividualinfrastructurelocalmarketpeoplepoliciespolicyprocessquality
SHARED TOKENS (24): "community", "describes", "development", "economic", "economics", "especially", "focused", "frequently", "growth", "historically", "increases", "individual", "infrastructure", "local", "market", "people", "policies", "policy", "process", "quality".... | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecareclinicalcommunitydirecteffectivehealthinformationinstitutionallinksmanagemanufacturedmonitoringofficepatientpharmacypracticeprimaryproducingproducts
SHARED TOKENS (29): "become", "care", "clinical", "community", "direct", "effective", "health", "information", "institutional", "links", "manage", "manufactured", "monitoring", "office", "patient", "pharmacy", "practice", "primary", "producing", "products".... | EXACT TITLE in senior_services: "Pharmacy". | EXACT TITLE in transportation_infrastructure: "Pharmacy".
0.500
articlechaincomplexconsumerconvertcreatingdirectdirectlyfacilitiesindependentlinkedlogisticsmanagementmaterialsnetworkproductsstructuresupplysystemsystems
SHARED TOKENS (21): "article", "chain", "complex", "consumer", "convert", "creating", "direct", "directly", "facilities", "independent", "linked", "logistics", "management", "materials", "network", "products", "structure", "supply", "system", "systems".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyassetsauthoritycertificationcivilcommercialcontrolcreateddepartmentfederalorganizationpowersregulatessettingstandardssurroundingtransportation
SHARED TOKENS (18): "administration", "agency", "assets", "authority", "certification", "civil", "commercial", "control", "created", "department", "federal", "organization", "powers", "regulates", "setting", "standards", "surrounding", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
carecontinuingdeterminededucationfieldhealthcarejurisdictionlicenselicensedlicensingpracticeprofessionalprogramregisteredregulatedremainrequirerequirementrequirementsresponsible
SHARED TOKENS (22): "care", "continuing", "determined", "education", "field", "healthcare", "jurisdiction", "license", "licensed", "licensing", "practice", "professional", "program", "registered", "regulated", "remain", "require", "requirement", "requirements", "responsible".... | EXACT TITLE in senior_services: "Registered nurse".
0.500
acquiredacquisitionsadditionalbranddestinationsextendsformhistoryindependentmajornetworkoperatesoperatingprincipalregionalstarthroughout
SHARED TOKENS (17): "acquired", "acquisitions", "additional", "brand", "destinations", "extends", "form", "history", "independent", "major", "network", "operates", "operating", "principal", "regional", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
adultsarticleassistanceassistedbroadercannotcarecommunitycoordinationdefinitionsdependsdisabilitiesearlyenvironmentexpansionfacilitiesfacilityfederalfragmentedgroup
SHARED TOKENS (59): "adults", "article", "assistance", "assisted", "broader", "cannot", "care", "community", "coordination", "definitions", "depends", "disabilities", "early", "environment", "expansion", "facilities", "facility", "federal", "fragmented", "group".... | EXACT TITLE in senior_services: "Assisted living".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultsamericanamericansannualassetsbecomecarecostcostscoveragedecisiondisabilitiesdividedeconomiceffectiveeligibilityestablishedexpand
SHARED TOKENS (59): "access", "act", "adults", "american", "americans", "annual", "assets", "become", "care", "cost", "costs", "coverage", "decision", "disabilities", "divided", "economic", "effective", "eligibility", "established", "expand".... | EXACT TITLE in senior_services: "Medicaid". | EXACT TITLE in transportation_infrastructure: "Medicaid".
0.500
Social work ↗ Q205398 EXACT TITLE
administrationadvocacyagenciesbecomecommunitiescommunitydevelopmentdirectlydividedeconomicseducationgrouphealthindividualinterdisciplinarylaborlargerlawmanagementneeds
SHARED TOKENS (38): "administration", "advocacy", "agencies", "become", "communities", "community", "development", "directly", "divided", "economics", "education", "group", "health", "individual", "interdisciplinary", "labor", "larger", "law", "management", "needs".... | EXACT TITLE in senior_services: "Social work".
0.500
adultsagecivildisabilityemergencyextendinvolvinglawlawslegallypeoplepolicereportreportingsubject
SHARED TOKENS (15): "adults", "age", "civil", "disability", "emergency", "extend", "involving", "law", "laws", "legally", "people", "police", "report", "reporting", "subject". | EXACT TITLE in senior_services: "Mandated reporter".
0.500
actadministrationamericanchangescostdetermineddisabilityemploymentexistingfederalgenerationindividualinsurancelargelawlegallevellocalmillionprogram
SHARED TOKENS (32): "act", "administration", "american", "changes", "cost", "determined", "disability", "employment", "existing", "federal", "generation", "individual", "insurance", "large", "law", "legal", "level", "local", "million", "program".... | EXACT TITLE in senior_services: "Social Security (United States)".
0.500
adultsageagencyamericancaredefinitionsdepartmentsdisabilitiesfinancialhealthinvestigateslawlegallocalolderphysicalprovideregulatoryresponsibilityserve
SHARED TOKENS (20): "adults", "age", "agency", "american", "care", "definitions", "departments", "disabilities", "financial", "health", "investigates", "law", "legal", "local", "older", "physical", "provide", "regulatory", "responsibility", "serve". | EXACT TITLE in senior_services: "Adult Protective Services".
0.500
Disability ↗ Q12131 EXACT TITLE
abilityaccessacquiredactivityagainstcenterscommunityconditioncreateddefinesdifferentdisabilitiesdisabilityeffectivefocusframeworkhistoricallyhistoryindividualintegration
SHARED TOKENS (49): "ability", "access", "acquired", "activity", "against", "centers", "community", "condition", "created", "defines", "different", "disabilities", "disability", "effective", "focus", "framework", "historically", "history", "individual", "integration".... | EXACT TITLE in senior_services: "Disability". | EXACT TITLE in transportation_infrastructure: "Disability".
0.500
administrationagencyapproximatelyauthoritycombinedconnectingcreateddatadepartmentenforcementfacilitiesfederallawlocalmissionpoliciesprimaryproceduresregulationsregulatory
SHARED TOKENS (32): "administration", "agency", "approximately", "authority", "combined", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "law", "local", "mission", "policies", "primary", "procedures", "regulations", "regulatory".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
chaincivilcollectioncostsdedicateddeliveriesequipmentfacilityfieldfoodinformationlogisticsmanagedmanagementmaterialmaterialsmilitarymodelneedsoperational
SHARED TOKENS (31): "chain", "civil", "collection", "costs", "dedicated", "deliveries", "equipment", "facility", "field", "food", "information", "logistics", "managed", "management", "material", "materials", "military", "model", "needs", "operational".... | EXACT TITLE in senior_services: "Logistics". | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictexistingfederalfinancialfunctionslocalofficeoperateoperatorsoverseespeopleprogramsprovidersprovidingpublic
SHARED TOKENS (29): "administration", "agencies", "agency", "assistance", "department", "district", "existing", "federal", "financial", "functions", "local", "office", "operate", "operators", "oversees", "people", "programs", "providers", "providing", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbroaderbuildingscapitalcategorycommunityconstructiondirectlyeconomicemploymentenvironmentalfacilitieshealthhospitalsinfrastructurelong-termmunicipaloperatorparksphysical
SHARED TOKENS (32): "assets", "broader", "buildings", "capital", "category", "community", "construction", "directly", "economic", "employment", "environmental", "facilities", "health", "hospitals", "infrastructure", "long-term", "municipal", "operator", "parks", "physical".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
Stroke ↗ Q12202 EXACT TITLE
annualappearapproximatelyassociatedconditioncontroldeterminedirectlyearlyemergencyfunctionhighlong-termmedicalmillionmovepeoplephysicalplacepressure
SHARED TOKENS (32): "annual", "appear", "approximately", "associated", "condition", "control", "determine", "directly", "early", "emergency", "function", "high", "long-term", "medical", "million", "move", "people", "physical", "place", "pressure".... | EXACT TITLE in senior_services: "Stroke".
0.500
additionalcareclinicalconditioncontactcontinuinggeneralhealthhealthcarepatientphysicalprimaryprincipalprofessionalproviderreceiveregisteredrequiresystem
SHARED TOKENS (19): "additional", "care", "clinical", "condition", "contact", "continuing", "general", "health", "healthcare", "patient", "physical", "primary", "principal", "professional", "provider", "receive", "registered", "require", "system". | EXACT TITLE in senior_services: "Primary care".
0.500
constructioncontextcontroldescribeddesignedequipmentfrequentlyfunctionsinformationinvolvinglaborlargemobileoperationspeoplepowerprimarysourcestructuresystems
SHARED TOKENS (21): "construction", "context", "control", "described", "designed", "equipment", "frequently", "functions", "information", "involving", "labor", "large", "mobile", "operations", "people", "power", "primary", "source", "structure", "systems".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcitiescreatingdesignateddrivingearlyhistoricallymobilitynetworkpeopleprofessionalrecordruralsafetysidewalktransporturban
SHARED TOKENS (18): "american", "associated", "cities", "creating", "designated", "driving", "early", "historically", "mobility", "network", "people", "professional", "record", "rural", "safety", "sidewalk", "transport", "urban". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.500
approveddepartmentfacilitiesfederalfocusidentifiedindividuallocalmajormetropolitanmilitarynationalnetworkorganizationspipelineplanningsafetyservingsystemtransport
SHARED TOKENS (21): "approved", "department", "facilities", "federal", "focus", "identified", "individual", "local", "major", "metropolitan", "military", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "system", "transport".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
agencybuildingcommercialcompletedconnectionsconstructiondesigndeveloperdevelopmentexistingfunctionsinstitutionalintegratedmultipleneighborhoodplanningpolicyprivateprojectsresidential
SHARED TOKENS (27): "agency", "building", "commercial", "completed", "connections", "construction", "design", "developer", "development", "existing", "functions", "institutional", "integrated", "multiple", "neighborhood", "planning", "policy", "private", "projects", "residential".... | EXACT TITLE in senior_services: "Mixed-use development".
0.500
americanauthoritycitiescivilconcentratedconsolidatedcountiesdifferentdistrictdividedentitiesexistingformfurtherindependentlawlegallylevellocallocally
SHARED TOKENS (32): "american", "authority", "cities", "civil", "concentrated", "consolidated", "counties", "different", "district", "divided", "entities", "existing", "form", "further", "independent", "law", "legally", "level", "local", "locally".... | EXACT TITLE in senior_services: "County (United States)". | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
adultsamongavoidbecomecarecommissiondescribeddisabilitiesdisabilityemergencyfieldfinancialhealthhealthcarehomelong-termpatientphysicalplannedprimary
SHARED TOKENS (31): "adults", "among", "avoid", "become", "care", "commission", "described", "disabilities", "disability", "emergency", "field", "financial", "health", "healthcare", "home", "long-term", "patient", "physical", "planned", "primary".... | EXACT TITLE in senior_services: "Respite care".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscivilconstructiondesignateddevelopmentdigitalenvironmentequipmentestablishfeatureshistorylandlawlegalownershipplanningpointsprofessionalpropertyresearch
SHARED TOKENS (24): "analysis", "civil", "construction", "designated", "development", "digital", "environment", "equipment", "establish", "features", "history", "land", "law", "legal", "ownership", "planning", "points", "professional", "property", "research".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
additionaladministrationageannualcarecenterscostsdifferentdisabilitiesdividedfederalgrouphealthhealthcarehospitalinsurancelimitslong-termmedicaidmillion
SHARED TOKENS (35): "additional", "administration", "age", "annual", "care", "centers", "costs", "different", "disabilities", "divided", "federal", "group", "health", "healthcare", "hospital", "insurance", "limits", "long-term", "medicaid", "million".... | EXACT TITLE in senior_services: "Medicare (United States)".
0.500
adaboisecentercombinedcommercialcommissiondepartmentfacilityfallsfieldfunctionsgeneralidahoincreasemilitarymillionnationaloperatesreceiverequiring
SHARED TOKENS (25): "ada", "boise", "center", "combined", "commercial", "commission", "department", "facility", "falls", "field", "functions", "general", "idaho", "increase", "military", "million", "national", "operates", "receive", "requiring".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
administrationanalysisarchitecturebroaderbuildingsbuiltcapitalcategorycitiescivilcodescommunitiescommunitycreatingdesigndevelopmentdifferentearlyeconomicenvironment
SHARED TOKENS (65): "administration", "analysis", "architecture", "broader", "buildings", "built", "capital", "category", "cities", "civil", "codes", "communities", "community", "creating", "design", "development", "different", "early", "economic", "environment".... | EXACT TITLE in senior_services: "Urban planning".
0.500
Caregiver ↗ Q553079 EXACT TITLE
agecannotcarecentersdisabilitydocumentationformalhealthcarehomehospitalslivinglong-termpeopleprovideproviderssupporttrainedworkers
SHARED TOKENS (18): "age", "cannot", "care", "centers", "disability", "documentation", "formal", "healthcare", "home", "hospitals", "living", "long-term", "people", "provide", "providers", "support", "trained", "workers". | EXACT TITLE in senior_services: "Caregiver".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationcareclinicalconditionscontinuousdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcarehomeinformationintegrationlimited
SHARED TOKENS (42): "access", "administration", "application", "care", "clinical", "conditions", "continuous", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "healthcare", "home", "information", "integration", "limited".... | EXACT TITLE in senior_services: "Telehealth".
0.500
actadministrationagenciesagencyassistancecivilcreateddepartmentdevelopmentfederalfinancialmanagementnationaloperatespolicyprogramsprovidepublicregulationsrehabilitation
SHARED TOKENS (25): "act", "administration", "agencies", "agency", "assistance", "civil", "created", "department", "development", "federal", "financial", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations", "rehabilitation".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actaddressingagencyassistancechangescodifiedcontrolcoordinationdirectlyenvironmentalfederalformfundinggoverninginvolvinglawlawsmajorownedphysical
SHARED TOKENS (33): "act", "addressing", "agency", "assistance", "changes", "codified", "control", "coordination", "directly", "environmental", "federal", "form", "funding", "governing", "involving", "law", "laws", "major", "owned", "physical".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
builtcommunitycomplexconnectingconnectionconstructioncreatedesigndesigneddeterminedearlyenvironmentfrequentlyimpactsintendedlocalmajornetworkpermittedphysical
SHARED TOKENS (35): "built", "community", "complex", "connecting", "connection", "construction", "create", "design", "designed", "determined", "early", "environment", "frequently", "impacts", "intended", "local", "major", "network", "permitted", "physical".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
actadministersadministrationagencycarecenterscertificationclinicaldepartmentfacilitiesfederalfinancinggovhealthhealthcarehomeinsurancelong-termmedicaidoversight
SHARED TOKENS (31): "act", "administers", "administration", "agency", "care", "centers", "certification", "clinical", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "home", "insurance", "long-term", "medicaid", "oversight".... | EXACT TITLE in senior_services: "Centers for Medicare & Medicaid Services".
0.500
administrationannouncedcenterscommunitydepartmentdirectlydisabilityexistinghealthlivingmedicaidofficepeopleplannedpolicyprincipalprogramreportsseniorserves
SHARED TOKENS (21): "administration", "announced", "centers", "community", "department", "directly", "disability", "existing", "health", "living", "medicaid", "office", "people", "planned", "policy", "principal", "program", "reports", "senior", "serves".... | EXACT TITLE in senior_services: "Administration for Community Living".
0.500
Elder abuse ↗ Q427883 EXACT TITLE
adultsagainstagenciescircumstancescommunitydesignatedeventsgeneralhealthhomeincreasinglawsnetworkolderorganizationpeopleproblemprofessionalpropertyrelationship
SHARED TOKENS (21): "adults", "against", "agencies", "circumstances", "community", "designated", "events", "general", "health", "home", "increasing", "laws", "network", "older", "organization", "people", "problem", "professional", "property", "relationship".... | EXACT TITLE in senior_services: "Elder abuse".
0.500
ageamericanassistedassociationcaredifferentemergencyfacilitiesfacilitygrouphomehospitalinstitutionsinsurancelivinglong-termmedicalneedneedsoccupational
SHARED TOKENS (33): "age", "american", "assisted", "association", "care", "different", "emergency", "facilities", "facility", "group", "home", "hospital", "institutions", "insurance", "living", "long-term", "medical", "need", "needs", "occupational".... | EXACT TITLE in senior_services: "Nursing home".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalapplicationchangescollectionconditionsconsolidationcontroldirectlydischargedistributedenvironmentalfieldformgrowthhighlandmanagementnetworkoperationoperations
SHARED TOKENS (37): "agricultural", "application", "changes", "collection", "conditions", "consolidation", "control", "directly", "discharge", "distributed", "environmental", "field", "form", "growth", "high", "land", "management", "network", "operation", "operations".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
accessdatadevelopersdevelopmentdigitaldividedearlyformfurtherindependentindividualinformationlong-distancemeansmediaphysicalpowersingletechnologytelecommunications
SHARED TOKENS (20): "access", "data", "developers", "development", "digital", "divided", "early", "form", "further", "independent", "individual", "information", "long-distance", "means", "media", "physical", "power", "single", "technology", "telecommunications". | EXACT TITLE in senior_services: "Telecommunications". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Franchising ↗ Q171947 EXACT TITLE
agreementarrangementbrandcapitalchaincircumstancescompeteconditionscorporatedirecteconomicentityespeciallyexpansionexplicitlyfinancialfranchisegrowthindividualinvestment
SHARED TOKENS (44): "agreement", "arrangement", "brand", "capital", "chain", "circumstances", "compete", "conditions", "corporate", "direct", "economic", "entity", "especially", "expansion", "explicitly", "financial", "franchise", "growth", "individual", "investment".... | EXACT TITLE in senior_services: "Franchising".
0.500
actadministrationadultsagenciesamericanamericanscomprehensivecreatedeffectivefederalfundinghealthhomelawlevellocalnationalnetworkolderpopulation
SHARED TOKENS (26): "act", "administration", "adults", "agencies", "american", "americans", "comprehensive", "created", "effective", "federal", "funding", "health", "home", "law", "level", "local", "national", "network", "older", "population".... | EXACT TITLE in senior_services: "Older Americans Act of 1965".
0.500
capitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancialfinancingfirmsgeneralinvestmentlimitedlong-termmanagementoperationalownershipprivateproducts
SHARED TOKENS (28): "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financial", "financing", "firms", "general", "investment", "limited", "long-term", "management", "operational", "ownership", "private", "products".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
agenciesbuildingsbuiltcivilconstructiondepartmentsdesigndistinguishenvironmentfirmsfocusedinfrastructurelocallymaintenancemilitarymunicipalnationalphysicalplaceprivate
SHARED TOKENS (25): "agencies", "buildings", "built", "civil", "construction", "departments", "design", "distinguish", "environment", "firms", "focused", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical", "place", "private".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelydirectlyfederallimitedmanagedmetropolitanmillionnationalnetworkoperateoperatesoperatororganizationownedreportingroutesservesouth
SHARED TOKENS (25): "additional", "american", "approximately", "directly", "federal", "limited", "managed", "metropolitan", "million", "national", "network", "operate", "operates", "operator", "organization", "owned", "reporting", "routes", "serve", "south".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
ageapplyarrangementsauthorityestatefinancialhealthcarelawlegallivingmanagemillionorganizationspeoplephysical
SHARED TOKENS (15): "age", "apply", "arrangements", "authority", "estate", "financial", "healthcare", "law", "legal", "living", "manage", "million", "organizations", "people", "physical". | EXACT TITLE in senior_services: "Conservatorship".
0.500
agenciesalternativesapplybusinessescomprehensivedesigndestinationsfacilitiesfutureimpactsinfluencemoveneedspeopleplanningpoliciesprivateprocesspublicsiting
SHARED TOKENS (23): "agencies", "alternatives", "apply", "businesses", "comprehensive", "design", "destinations", "facilities", "future", "impacts", "influence", "move", "needs", "people", "planning", "policies", "private", "process", "public", "siting".... | EXACT TITLE in senior_services: "Transportation planning". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Retirement ↗ Q946865 EXACT TITLE
accessagearrangementsbeyondconcerningconditionscontinuedcoverageemployersemploymentespeciallyhealthincreasingindustrynationalpeopleplanpositionpreviouslyprivate
SHARED TOKENS (29): "access", "age", "arrangements", "beyond", "concerning", "conditions", "continued", "coverage", "employers", "employment", "especially", "health", "increasing", "industry", "national", "people", "plan", "position", "previously", "private".... | EXACT TITLE in senior_services: "Retirement".
0.480
advancedcarecoordinationhealthinterpretmedicalneedspatientpracticeproviderregisteredtrainedtrainingtreatment
SHARED TOKENS (14): "advanced", "care", "coordination", "health", "interpret", "medical", "needs", "patient", "practice", "provider", "registered", "trained", "training", "treatment". | EXACT TITLE in senior_services: "Nurse practitioner".
0.480
Floodplain ↗ Q193110 EXACT TITLE
adjacentagriculturalbankscontroldischargefrequentlyhighincreasinglandnearriverurbanvalleywater
SHARED TOKENS (14): "adjacent", "agricultural", "banks", "control", "discharge", "frequently", "high", "increasing", "land", "near", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.480
Home care ↗ Q1642542 EXACT TITLE
assistancecarecommunityhealthhomeindividuallivinglocalmarketnationalorganizationspatientpeopleprofessional
SHARED TOKENS (14): "assistance", "care", "community", "health", "home", "individual", "living", "local", "market", "national", "organizations", "patient", "people", "professional". | EXACT TITLE in senior_services: "Home care".
0.480
Probate ↗ Q6500369 EXACT TITLE
applyapprovalassetsbecomesdocumentestatejurisdictionlawlawslegalpowerprocesspropertypublic
SHARED TOKENS (14): "apply", "approval", "assets", "becomes", "document", "estate", "jurisdiction", "law", "laws", "legal", "power", "process", "property", "public". | EXACT TITLE in senior_services: "Probate".
0.480
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingbuildingsbusinessescitiesdesigneddirectlyfacilityfunctionlargematerialsparksstandardtransport
SHARED TOKENS (14): "associated", "building", "buildings", "businesses", "cities", "designed", "directly", "facility", "function", "large", "materials", "parks", "standard", "transport". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.470
administrationagencycommunitydepartmenthealthliving
SHARED TOKENS (6): "administration", "agency", "community", "department", "health", "living". | URL->A (2): https://www.acl.gov/about-acl/authorizing-statutes/older-americans-act, https://acl.gov/about-acl/administration-aging. | EXACT TITLE in senior_services: "Administration on Aging".
0.460
Road ↗ Q34442 EXACT TITLE
accessdesigndistinctionfeatureslandlocalplaceprimaryprivatepublicroadstreeturban
SHARED TOKENS (13): "access", "design", "distinction", "features", "land", "local", "place", "primary", "private", "public", "road", "street", "urban". | EXACT TITLE in senior_services: "Road". | EXACT TITLE in transportation_infrastructure: "Road".
0.460
amongdrivefoodhomehospitalsneedorganizationprogramprogramsqualityreduceresearchshows
SHARED TOKENS (13): "among", "drive", "food", "home", "hospitals", "need", "organization", "program", "programs", "quality", "reduce", "research", "shows". | EXACT TITLE in senior_services: "Meals on Wheels".
0.460
administrationagencydepartmentfederalmajorofficepreviouslyprogramprogramspublicroadroletransportation
SHARED TOKENS (13): "administration", "agency", "department", "federal", "major", "office", "previously", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.450
Elder rights ↗ Q22908078 KW CROSS HIGH
abilityaccessactadultsagecapacitydisabilityfederalfinancialincomemedicalolderphysicalprotectedprovidingrightssecuritysocietytechnologyyet
SHARED TOKENS (20): "ability", "access", "act", "adults", "age", "capacity", "disability", "federal", "financial", "income", "medical", "older", "physical", "protected", "providing", "rights", "security", "society", "technology", "yet". | URL->A (1): https://acl.gov/about-acl/administration-aging.
0.440
Utility ↗ Q466707 EXACT TITLE
amongcontextdecisiondistincteconomicsfunctionfunctionsgoalmeasurerelationshipsourceutility
SHARED TOKENS (12): "among", "context", "decision", "distinct", "economics", "function", "functions", "goal", "measure", "relationship", "source", "utility". | EXACT TITLE in senior_services: "Utility". | EXACT TITLE in transportation_infrastructure: "Utility".
0.440
actcommunityeducationemergencygroupindividuallaborprovideresponsespecializedtrainingwork
SHARED TOKENS (12): "act", "community", "education", "emergency", "group", "individual", "labor", "provide", "response", "specialized", "training", "work". | EXACT TITLE in senior_services: "Volunteering".
0.440
activityamongenrollmentfallshighidahomeridianprogramspublicresearchstudentsuniversity
SHARED TOKENS (12): "activity", "among", "enrollment", "falls", "high", "idaho", "meridian", "programs", "public", "research", "students", "university". | EXACT TITLE in senior_services: "Idaho State University". | EXACT TITLE in transportation_infrastructure: "Idaho State University".
0.440
Sidewalk ↗ Q177749 EXACT TITLE
adjacentamericanbuildingsdesignedlandmobilityprivateroadsidewalksouthstreetvehicle
SHARED TOKENS (12): "adjacent", "american", "buildings", "designed", "land", "mobility", "private", "road", "sidewalk", "south", "street", "vehicle". | EXACT TITLE in senior_services: "Sidewalk". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.420
abilityagecenterscommunitycontroldefineshomeincomelevelplacesafely
SHARED TOKENS (11): "ability", "age", "centers", "community", "control", "defines", "home", "income", "level", "place", "safely". | EXACT TITLE in senior_services: "Aging in place".
0.420
americanfieldfreewaypermitroadroutesstandardsystemthoughtransportuses
SHARED TOKENS (11): "american", "field", "freeway", "permit", "road", "routes", "standard", "system", "though", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.420
amongcomprehensiveeducationemploymenthistoryindividualplaceprocessrecordsearchsecurity
SHARED TOKENS (11): "among", "comprehensive", "education", "employment", "history", "individual", "place", "process", "record", "search", "security". | EXACT TITLE in senior_services: "Background check".
0.380
articlecontrolsdesigndifferentmajorpracticeroadseparateuses
SHARED TOKENS (9): "article", "controls", "design", "different", "major", "practice", "road", "separate", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.380
Snowplow ↗ Q14976 EXACT TITLE
especiallyfrequentlyintendedlargereceiveservingspecifictransportationvehicle
SHARED TOKENS (9): "especially", "frequently", "intended", "large", "receive", "serving", "specific", "transportation", "vehicle". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.360
Phlebotomy ↗ Q3595842 EXACT TITLE
involvingitselfmakingmedicalprocesstechnicianstreatmentunit
SHARED TOKENS (8): "involving", "itself", "making", "medical", "process", "technicians", "treatment", "unit". | EXACT TITLE in senior_services: "Phlebotomy".
0.340
boiseexpansionidaholong-distanceoperatingservethough
SHARED TOKENS (7): "boise", "expansion", "idaho", "long-distance", "operating", "serve", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.340
Fraud ↗ Q28813 EXACT TITLE
civildocumentitselflawlegalpropertytravel
SHARED TOKENS (7): "civil", "document", "itself", "law", "legal", "property", "travel". | EXACT TITLE in senior_services: "Fraud".
0.340
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverurbanwestern
SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "urban", "western". | EXACT TITLE in senior_services: "Boise River". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in senior_services: "Idaho Department of Health and Welfare".
0.320
civilfieldinvolvingnetworktelecommunicationstransportation
SHARED TOKENS (6): "civil", "field", "involving", "network", "telecommunications", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
accessibleaddressesageassociatedbuildingscreatecreatingdesigndifferentdisabilityknowledgemeasureparticipationpeopleprioritiesproductsrelevantsidewalkstrategythem
SHARED TOKENS (20): "accessible", "addresses", "age", "associated", "buildings", "create", "creating", "design", "different", "disability", "knowledge", "measure", "participation", "people", "priorities", "products", "relevant", "sidewalk", "strategy", "them".
0.300
actapartmentassetsbuildingbuildingscapitalcategorizedcenterscommercialdevelopmentdistinctestatefinancefinancialfinancinggoverninghospitalshousingincreasingindustry
SHARED TOKENS (39): "act", "apartment", "assets", "building", "buildings", "capital", "categorized", "centers", "commercial", "development", "distinct", "estate", "finance", "financial", "financing", "governing", "hospitals", "housing", "increasing", "industry"....
0.300
additionalagainstagenciesbusinessescommissionconsumerdirecteconomiceducationenforcemententitiesenvironmentestablishedevenfederalfoodgeneralhealthinformationintended
SHARED TOKENS (38): "additional", "against", "agencies", "businesses", "commission", "consumer", "direct", "economic", "education", "enforcement", "entities", "environment", "established", "even", "federal", "food", "general", "health", "information", "intended"....
0.300
accesschaincostsdirecteconomicsespeciallygeneralgroupintendeditselflogisticsmaterialoperatingpracticepracticesregionspecializedtrainstransporttransportation
SHARED TOKENS (20): "access", "chain", "costs", "direct", "economics", "especially", "general", "group", "intended", "itself", "logistics", "material", "operating", "practice", "practices", "region", "specialized", "trains", "transport", "transportation".
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
americanassociationclinicalcommunityconditionscontrolemploymenthealthhistoricalhistoryindividualindustryinfluenceinterdisciplinarymattersmedicalnationaloccupationalorganizationphysical
SHARED TOKENS (24): "american", "association", "clinical", "community", "conditions", "control", "employment", "health", "historical", "history", "individual", "industry", "influence", "interdisciplinary", "matters", "medical", "national", "occupational", "organization", "physical"....
0.300
actadultsamericansassistancecarecentercomprehensivecostdebtdefinesdepartmentdepartmentseconomiceducationfederalfoodgrowthhealthhighhousing
SHARED TOKENS (46): "act", "adults", "americans", "assistance", "care", "center", "comprehensive", "cost", "debt", "defines", "department", "departments", "economic", "education", "federal", "food", "growth", "health", "high", "housing"....
0.300
additionaladultsageagenciesassistanceavoidcarechangescostdifferentdisabilitiesexistingfacilitiesfacilityfinancialformalfuturehealthhealthcarehome
SHARED TOKENS (55): "additional", "adults", "age", "agencies", "assistance", "avoid", "care", "changes", "cost", "different", "disabilities", "existing", "facilities", "facility", "financial", "formal", "future", "health", "healthcare", "home"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalapprovedbrandconditionsdeterminedigitalindependentinspectionmaintenanceneedsproblemproposedrepairrolespecifictechnicianvehiclework
SHARED TOKENS (18): "approval", "approved", "brand", "conditions", "determine", "digital", "independent", "inspection", "maintenance", "needs", "problem", "proposed", "repair", "role", "specific", "technician", "vehicle", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomedesignenvironmentincreaseintegrationmakesneedpermittedreducerequireresearchresultingroadrulessafetyshownthemthroughoutwork
SHARED TOKENS (20): "associated", "become", "design", "environment", "increase", "integration", "makes", "need", "permitted", "reduce", "require", "research", "resulting", "road", "rules", "safety", "shown", "them", "throughout", "work".
0.300
accessactadministrationamericanamericansapprovalcandidatecarechangescivilconditionsconsumercreatedevelopmenteducationestablishedfederallygeneralhealthhistory
SHARED TOKENS (42): "access", "act", "administration", "american", "americans", "approval", "candidate", "care", "changes", "civil", "conditions", "consumer", "create", "development", "education", "established", "federally", "general", "health", "history"....
0.300
actamericanapplicationarticleauthoritycivildifferentemploymentfinalhistorylaborlawlawsnationalpowerpowersproposedpublicregulaterequirements
SHARED TOKENS (22): "act", "american", "application", "article", "authority", "civil", "different", "employment", "final", "history", "labor", "law", "laws", "national", "power", "powers", "proposed", "public", "regulate", "requirements"....
0.300
carecommunityemergencyfieldformalhealthhealthcareindividualmedicaloccupationalpharmacyphysicalprofessionalproviderpublicregisteredtechniciantechnicianstrainingtreatment
SHARED TOKENS (21): "care", "community", "emergency", "field", "formal", "health", "healthcare", "individual", "medical", "occupational", "pharmacy", "physical", "professional", "provider", "public", "registered", "technician", "technicians", "training", "treatment"....
0.300
adaboisecanyoncitiescombinedcountiesdesignatedhomeidaholargermeridianmetropolitanmountainnampapopulationsectionthirdtreasurevalley
SHARED TOKENS (19): "ada", "boise", "canyon", "cities", "combined", "counties", "designated", "home", "idaho", "larger", "meridian", "metropolitan", "mountain", "nampa", "population", "section", "third", "treasure", "valley".
0.300
actadministrationadultsagenciesamericansapplicationappointmentsassistancecreatedeligibilitygeneralincomeintendedlevelmillionolderoperationsprogramprogramsrequirements
SHARED TOKENS (23): "act", "administration", "adults", "agencies", "americans", "application", "appointments", "assistance", "created", "eligibility", "general", "income", "intended", "level", "million", "older", "operations", "program", "programs", "requirements"....
0.300
agenciesassociatedbusinessescapacitycompetitivedetermineeconomiceconomicsemploymententryexistingfirmsfunctionhighindustrylandlawmarketmeasureorganization
SHARED TOKENS (32): "agencies", "associated", "businesses", "capacity", "competitive", "determine", "economic", "economics", "employment", "entry", "existing", "firms", "function", "high", "industry", "land", "law", "market", "measure", "organization"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
classificationscontrolcriticaldriversenforcementhealthidentifiedleveloccupationalpracticesproduceprovidingpublicreductionremainrequiringroadruralsafesafety
SHARED TOKENS (30): "classifications", "control", "critical", "drivers", "enforcement", "health", "identified", "level", "occupational", "practices", "produce", "providing", "public", "reduction", "remain", "requiring", "road", "rural", "safe", "safety"....
0.300
abilityagecarecategorizedclinicaldisabilitiesdisabilityexpandedfacilitiesgrouphealthhealthcarehomehospitalslicenselicensedlivingneedneedsoccupations
SHARED TOKENS (40): "ability", "age", "care", "categorized", "clinical", "disabilities", "disability", "expanded", "facilities", "group", "health", "healthcare", "home", "hospitals", "license", "licensed", "living", "need", "needs", "occupations"....
0.300
Patient advocacy ↗ KW CROSS HIGH
abilityadvocacycarecommunitiesdirectlyeducationemploymentextendfunctionsgrouphealthhealthcarehospitalsindependentindividuallimitedmattersmedicalorganizationorganizations
SHARED TOKENS (39): "ability", "advocacy", "care", "communities", "directly", "education", "employment", "extend", "functions", "group", "health", "healthcare", "hospitals", "independent", "individual", "limited", "matters", "medical", "organization", "organizations"....
0.300
NNN lease ↗ Q6954788 KW CROSS HIGH
arrangementarrangementscommercialestateinsurancelawleasemaintenancenetownershippropertyratherrealreal-estateresponsiblesingletaxes
SHARED TOKENS (17): "arrangement", "arrangements", "commercial", "estate", "insurance", "law", "lease", "maintenance", "net", "ownership", "property", "rather", "real", "real-estate", "responsible", "single", "taxes".
0.300
buildingcenterdedicateddensedesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivateproblempublicrelationshipresidentialservingtransit
SHARED TOKENS (22): "building", "center", "dedicated", "dense", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "problem", "public", "relationship", "residential", "serving", "transit"....
0.300
actbusinessescareconcerningcoverageemployersentitiesentityfederalgovernsgrouphealthhealthcareinformationinsurancelawlimitedmedicalnationalpatient
SHARED TOKENS (31): "act", "businesses", "care", "concerning", "coverage", "employers", "entities", "entity", "federal", "governs", "group", "health", "healthcare", "information", "insurance", "law", "limited", "medical", "national", "patient"....
0.300
actagainstamericanamericansapproximatelyassistanceassociatedcannotcarecommercialcostscoveragecoveringdifferentdisabilityexpansionfederalfinancialformhealth
SHARED TOKENS (45): "act", "against", "american", "americans", "approximately", "assistance", "associated", "cannot", "care", "commercial", "costs", "coverage", "covering", "different", "disability", "expansion", "federal", "financial", "form", "health"....
0.300
becomechangesdesigndriversdrivingespeciallyfocusgrowingphysicalresponsibleroadrulesafetyurbanuses
SHARED TOKENS (15): "become", "changes", "design", "drivers", "driving", "especially", "focus", "growing", "physical", "responsible", "road", "rule", "safety", "urban", "uses".
0.300
accessibleadministrationageagencyamericanbuildingcenterscommercialconstructiondepartmentdrivedriversdrivingeducationenvironmentalfederalgoverninggovernshandlinghealth
SHARED TOKENS (48): "accessible", "administration", "age", "agency", "american", "building", "centers", "commercial", "construction", "department", "drive", "drivers", "driving", "education", "environmental", "federal", "governing", "governs", "handling", "health"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycreateddifferentestatefacilitylandlegallocaloperateownershippeoplephysicalprivaterealrightsroadroutesspecificthemtransportation
SHARED TOKENS (22): "authority", "created", "different", "estate", "facility", "land", "legal", "local", "operate", "ownership", "people", "physical", "private", "real", "rights", "road", "routes", "specific", "them", "transportation"....
0.300
addressingconcerningcreateddepartmenteducationfederalfundinggeneralhealthhealthcaremattersmedicalmissionprimaryprivateprovidingpublicresponsibleseparatesystem
SHARED TOKENS (21): "addressing", "concerning", "created", "department", "education", "federal", "funding", "general", "health", "healthcare", "matters", "medical", "mission", "primary", "private", "providing", "public", "responsible", "separate", "system"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecitiescommunitiescompetitiveconditioncreatecreatescurrentdescribesdevelopmenteconomiceconomicseducationenvironmentalgenerategeographygoalgrowth
SHARED TOKENS (56): "approximately", "architecture", "become", "cities", "communities", "competitive", "condition", "create", "creates", "current", "describes", "development", "economic", "economics", "education", "environmental", "generate", "geography", "goal", "growth"....
0.300
addingarticlebecomecapacityconditioncongestiondemanddepartmentsdriversdrivingfixedfocushighincreasinginteractionmodeledplanningpublicresultingroad
SHARED TOKENS (24): "adding", "article", "become", "capacity", "condition", "congestion", "demand", "departments", "drivers", "driving", "fixed", "focus", "high", "increasing", "interaction", "modeled", "planning", "public", "resulting", "road"....
0.300
alongsideamericancapacitycapitalcitiesconnectingcostdedicateddesigndesignedfeaturesmillionnetworkpublicqualityreducesinglesystemsystemstransit
SHARED TOKENS (21): "alongside", "american", "capacity", "capital", "cities", "connecting", "cost", "dedicated", "design", "designed", "features", "million", "network", "public", "quality", "reduce", "single", "system", "systems", "transit"....
0.300
advancedapplicationcapacitychangescollectionconditionscoordinateddifferentemergencyfieldincreaseinformationinfrastructurelawsmanagementmobilityprovidereduceroadsafety
SHARED TOKENS (25): "advanced", "application", "capacity", "changes", "collection", "conditions", "coordinated", "different", "emergency", "field", "increase", "information", "infrastructure", "laws", "management", "mobility", "provide", "reduce", "road", "safety"....
0.300
agecombineddemographicdesignatedfuturehistoryincreaseincreasinglevellong-termmillionpeoplepolicypopulationpopulationsprojectsratesreachseniorsingle
SHARED TOKENS (23): "age", "combined", "demographic", "designated", "future", "history", "increase", "increasing", "level", "long-term", "million", "people", "policy", "population", "populations", "projects", "rates", "reach", "senior", "single"....
0.300
creatingdepartmentdesignateddesigneddifferentdividedevenpathwaypermitprimaryprovidesharedtransporttravelurban
SHARED TOKENS (15): "creating", "department", "designated", "designed", "different", "divided", "even", "pathway", "permit", "primary", "provide", "shared", "transport", "travel", "urban".
0.300
administrationcarecentersclinicalcommunitycompliancedepartmentfederalhealthhealthcarehomehospitalsintegratedlivingmedicalmilitaryofficeoperationownedperformance
SHARED TOKENS (33): "administration", "care", "centers", "clinical", "community", "compliance", "department", "federal", "health", "healthcare", "home", "hospitals", "integrated", "living", "medical", "military", "office", "operation", "owned", "performance"....
0.300
actadditionalageamericansapplicantscannotcarechangesconditionscostscoveragedecisiondeliverydemographiceducationeligibilityestimatesexistingexpandedexpansion
SHARED TOKENS (55): "act", "additional", "age", "americans", "applicants", "cannot", "care", "changes", "conditions", "costs", "coverage", "decision", "delivery", "demographic", "education", "eligibility", "estimates", "existing", "expanded", "expansion"....
0.300
americanappearsassistancecombinedcreateddesignatedespeciallyevenfacilitiesfeatureslargelawsplacepointsroadrulessafelysafetyseparatestreet
SHARED TOKENS (22): "american", "appears", "assistance", "combined", "created", "designated", "especially", "even", "facilities", "features", "large", "laws", "place", "points", "road", "rules", "safely", "safety", "separate", "street"....
0.300
abilityaddressingaffectaffectingappearbecomebehavioralbodieschangesconditioncriticaleffectiveenvironmentalexistsformfurtheridentifiedmanagemedicalrather
SHARED TOKENS (28): "ability", "addressing", "affect", "affecting", "appear", "become", "behavioral", "bodies", "changes", "condition", "critical", "effective", "environmental", "exists", "form", "further", "identified", "manage", "medical", "rather"....
0.300
abilityaffectaffectingageamongexistingexplicitlyformfundinggrouphousingmarketplacesourcetreatment
SHARED TOKENS (15): "ability", "affect", "affecting", "age", "among", "existing", "explicitly", "form", "funding", "group", "housing", "market", "place", "source", "treatment".
0.300
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemarketingmetropolitanparkingpeoplepoolpublicroadsystemtransfertransittransportvehicle
SHARED TOKENS (15): "cities", "connections", "large", "marketing", "metropolitan", "parking", "people", "pool", "public", "road", "system", "transfer", "transit", "transport", "vehicle".
0.300
approvalassociationcontextdecisiondecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactsmajormakingmanagementmoveparticipationplanpoliciespolicy
SHARED TOKENS (32): "approval", "association", "context", "decision", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impacts", "major", "making", "management", "move", "participation", "plan", "policies", "policy"....
0.300
carecommunitiescurrenteconomicfinancefocusedformfurtherhealthhealthcareindustryintegrationinterdisciplinarymedicalpowerproductspurchasingreachingrequirementssector
SHARED TOKENS (21): "care", "communities", "current", "economic", "finance", "focused", "form", "further", "health", "healthcare", "industry", "integration", "interdisciplinary", "medical", "power", "products", "purchasing", "reaching", "requirements", "sector"....
0.300
acquisitionacquisitionsactactivityassetscapitalcombinedcommissioncompetitiveconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteconomicallyentitiesentity
SHARED TOKENS (46): "acquisition", "acquisitions", "act", "activity", "assets", "capital", "combined", "commission", "competitive", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "economically", "entities", "entity"....
0.300
accessadvancedamericanbuiltcapacitychangescitiescompletedconnectconnectedconnectingcontainingdesignedevenfreewayincreasinglimitsnetworkparkingplanned
SHARED TOKENS (35): "access", "advanced", "american", "built", "capacity", "changes", "cities", "completed", "connect", "connected", "connecting", "containing", "designed", "even", "freeway", "increasing", "limits", "network", "parking", "planned"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleastextendedgeneralidahomajornationalnearofficialplannedpositioningriverroadrulesthroughoutwestwestern
SHARED TOKENS (17): "caldwell", "east", "extended", "general", "idaho", "major", "national", "near", "official", "planned", "positioning", "river", "road", "rules", "throughout", "west", "western".
0.300
agencyapproveddepartmenteducationenforcementenvironmentalfederalfederallyfinancialindependentinformationlawslegallevellocalmattersmonitoringnationaloperationpowers
SHARED TOKENS (27): "agency", "approved", "department", "education", "enforcement", "environmental", "federal", "federally", "financial", "independent", "information", "laws", "legal", "level", "local", "matters", "monitoring", "national", "operation", "powers"....
0.300
actadministersadministrationagencyamericancenterscodifiedcreatedcurrentdisabilityestablishedfederalfieldincomeindependentinsurancelocalmillionnationalneed
SHARED TOKENS (31): "act", "administers", "administration", "agency", "american", "centers", "codified", "created", "current", "disability", "established", "federal", "field", "income", "independent", "insurance", "local", "million", "national", "need"....
0.300
ageagenciesalongsideconsumercontextdemographicdifferentearlyestimatesformalhighindividualmanufacturedmeasurenationalolderorganizationspeoplepopulationpopulations
SHARED TOKENS (30): "age", "agencies", "alongside", "consumer", "context", "demographic", "different", "early", "estimates", "formal", "high", "individual", "manufactured", "measure", "national", "older", "organizations", "people", "population", "populations"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
ageagenciesamericanamericanscanyoncommercialconstructioncontrolcreatedeastfallsfeaturesfurtherhighhistoryidaholargelimitedmajormilitary
SHARED TOKENS (38): "age", "agencies", "american", "americans", "canyon", "commercial", "construction", "control", "created", "east", "falls", "features", "further", "high", "history", "idaho", "large", "limited", "major", "military"....
0.300
actagainstagecivilconcerningconditionsemployersemploymentexplicitlygeneralinformationlaborlawneedsolderpublicrequiresrightsstandardstitle
SHARED TOKENS (21): "act", "against", "age", "civil", "concerning", "conditions", "employers", "employment", "explicitly", "general", "information", "labor", "law", "needs", "older", "public", "requires", "rights", "standards", "title"....
0.300
administrationagencyamericanassistancecenterscostcostsdepartmentdisabilityeducationemergencyestablishedexpandedfacilitiesfederalfuturehealthcarehomeinsurancelong-term
SHARED TOKENS (30): "administration", "agency", "american", "assistance", "centers", "cost", "costs", "department", "disability", "education", "emergency", "established", "expanded", "facilities", "federal", "future", "healthcare", "home", "insurance", "long-term"....
0.300
accessactamericanamongapproximatelyassociationcarecomplexcomprehensiveconstructioncostscoverageearlyeducationemployersestablishedexpansionfacilitiesfederalfocus
SHARED TOKENS (57): "access", "act", "american", "among", "approximately", "association", "care", "complex", "comprehensive", "construction", "costs", "coverage", "early", "education", "employers", "established", "expansion", "facilities", "federal", "focus"....
0.300
addressingagenciesamongbroadercapacitychangescommissioncontroldescribeddifferentenvironmentalfocusfunctiongrouphealthmajormerelyorganizationpeoplephysical
SHARED TOKENS (29): "addressing", "agencies", "among", "broader", "capacity", "changes", "commission", "control", "described", "different", "environmental", "focus", "function", "group", "health", "major", "merely", "organization", "people", "physical"....
0.300
actamericanappearscivilcodeconcerningdevelopmentdifferentdisabilitiesenforcementexpandedfederalfinancingfundinghousinglawmakesnationalpeopleprivate
SHARED TOKENS (29): "act", "american", "appears", "civil", "code", "concerning", "development", "different", "disabilities", "enforcement", "expanded", "federal", "financing", "funding", "housing", "law", "makes", "national", "people", "private"....
0.300
actadministrationagenciesamericansassistanceauthorizationcodifiedcontractorscoordinationcreateddepartmentdisabilitiesdisabilityeducationemploymentestablishexpandextendfederalfinancial
SHARED TOKENS (35): "act", "administration", "agencies", "americans", "assistance", "authorization", "codified", "contractors", "coordination", "created", "department", "disabilities", "disability", "education", "employment", "establish", "expand", "extend", "federal", "financial"....
0.300
combinedconnectscurrentdeliverydirectdirectlydistinctevenformhandlinghistoricallyincreaseindustrylevellinelocallong-distancemajormarketnetwork
SHARED TOKENS (27): "combined", "connects", "current", "delivery", "direct", "directly", "distinct", "even", "form", "handling", "historically", "increase", "industry", "level", "line", "local", "long-distance", "major", "market", "network"....
0.300
adultsageassistancecarecenterdemanddisabilitiesdischargefacilitiesfacilitygeneralgrouphealthhospitalincreasinglivingmedicalmodelneedneeds
SHARED TOKENS (27): "adults", "age", "assistance", "care", "center", "demand", "disabilities", "discharge", "facilities", "facility", "general", "group", "health", "hospital", "increasing", "living", "medical", "model", "need", "needs"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontrolinformationlawslevellocalnationalneedpolicereduceroadsouthsystemsystemstechnology
SHARED TOKENS (16): "advanced", "capacity", "control", "information", "laws", "level", "local", "national", "need", "police", "reduce", "road", "south", "system", "systems", "technology".
0.300
buildingcircumstancesconditionscontainingcreatesenvironmentevenhealthmaterialspeoplephysicalpropertypublicregulationssafetyspecificsubjectsystemthemtrained
SHARED TOKENS (21): "building", "circumstances", "conditions", "containing", "creates", "environment", "even", "health", "materials", "people", "physical", "property", "public", "regulations", "safety", "specific", "subject", "system", "them", "trained"....
0.300
administrationadvancedbehavioralclinicclinicaldevelopmentdifferentfallsfieldfocusedgrowthhealthidahoincreaseintegrationknowledgelargelevelmedicalmodel
SHARED TOKENS (35): "administration", "advanced", "behavioral", "clinic", "clinical", "development", "different", "falls", "field", "focused", "growth", "health", "idaho", "increase", "integration", "knowledge", "large", "level", "medical", "model"....
0.300
announcedapprovedcentercreateitselfnetworkoperatesoperatingprincipalprojectreachreportingroadroutessystemtransportationwestwestern
SHARED TOKENS (18): "announced", "approved", "center", "create", "itself", "network", "operates", "operating", "principal", "project", "reach", "reporting", "road", "routes", "system", "transportation", "west", "western".
0.300
accessactadditionaladministrationapproximatelyavoidbuiltcollectionconstructioncontinuedcostcreatingdensedesigndesignedestablishedexpandextendsfederalfreeway
SHARED TOKENS (50): "access", "act", "additional", "administration", "approximately", "avoid", "built", "collection", "construction", "continued", "cost", "creating", "dense", "design", "designed", "established", "expand", "extends", "federal", "freeway"....
0.300
activityanalysisbecomesdesigndocumentationenvironmentestablishedgenerallegallicenselicensedlicensurelocalmaintenancepracticepractitionersprocessproductsprofessionalproject
SHARED TOKENS (37): "activity", "analysis", "becomes", "design", "documentation", "environment", "established", "general", "legal", "license", "licensed", "licensure", "local", "maintenance", "practice", "practitioners", "process", "products", "professional", "project"....
0.300
authorizescarecombinedcomprehensivedecisiondecisionsdependsdocumentdocumentsespeciallyformhealthhealthcareinstructionsitselfjurisdictionlegallegallylivingmedical
SHARED TOKENS (26): "authorizes", "care", "combined", "comprehensive", "decision", "decisions", "depends", "document", "documents", "especially", "form", "health", "healthcare", "instructions", "itself", "jurisdiction", "legal", "legally", "living", "medical"....
0.300
collegecommunitydifferenteducationenrollmentformhighinstitutionspolicyprogramsseniorstudentstransferuniversityworkforce
SHARED TOKENS (15): "college", "community", "different", "education", "enrollment", "form", "high", "institutions", "policy", "programs", "senior", "students", "transfer", "university", "workforce".
0.300
adultsagebroadercommunitiescontinuingfocushealthhighincreaseincreasingmillionneedsolderpeoplepopulationpopulationsqualityratesseniorssupport
SHARED TOKENS (21): "adults", "age", "broader", "communities", "continuing", "focus", "health", "high", "increase", "increasing", "million", "needs", "older", "people", "population", "populations", "quality", "rates", "seniors", "support"....
0.300
associatedcomplexdemandeconomicemergencyformalhomehousingincomeincreasesindexlocalmarketsnationalownershipresponsesupply
SHARED TOKENS (17): "associated", "complex", "demand", "economic", "emergency", "formal", "home", "housing", "income", "increases", "index", "local", "markets", "national", "ownership", "response", "supply".
0.300
adjacentassistedavoidbuildingbuildingscarecommunitiescommunitycontinuingdifferentgardenindependentlevellivingmodelmoveneedsplanresidentssetting
SHARED TOKENS (21): "adjacent", "assisted", "avoid", "building", "buildings", "care", "communities", "community", "continuing", "different", "garden", "independent", "level", "living", "model", "move", "needs", "plan", "residents", "setting"....
0.300
adultsagenciesapartmentarticleassistanceassistedbuildingbuiltcarecitiescommunitiescommunitycomplexcontinuingcreatedesignedenvironmentestablishedestatefinancial
SHARED TOKENS (44): "adults", "agencies", "apartment", "article", "assistance", "assisted", "building", "built", "care", "cities", "communities", "community", "complex", "continuing", "create", "designed", "environment", "established", "estate", "financial"....
0.300
actagenciesapproximatelyauthoritybuildingcapacitycivilcombinedconstituteconstructioncontroldepartmentdesigndirectdirectlyeastenvironmentenvironmentalestablishfacilities
SHARED TOKENS (59): "act", "agencies", "approximately", "authority", "building", "capacity", "civil", "combined", "constitute", "construction", "control", "department", "design", "direct", "directly", "east", "environment", "environmental", "establish", "facilities"....
0.300
Loneliness ↗ Q223270 KW CROSS HIGH
ageamongbecomecommunityconnectedconnectionscoveragedescribedexistsfocusgeneralgrouphighincreaseinteractionmechanismmedicalowningpeoplephysical
SHARED TOKENS (26): "age", "among", "become", "community", "connected", "connections", "coverage", "described", "exists", "focus", "general", "group", "high", "increase", "interaction", "mechanism", "medical", "owning", "people", "physical"....
0.300
Food security ↗ Q1229911 KW CROSS HIGH
accessaffectsageagencyagriculturalavailabilitybeyondcreatedevelopmentearlyeconomicestimatesevenfoodfuturegrowthhealthhighindividualland
SHARED TOKENS (37): "access", "affects", "age", "agency", "agricultural", "availability", "beyond", "create", "development", "early", "economic", "estimates", "even", "food", "future", "growth", "health", "high", "individual", "land"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionapplicationbuildingsconnectdevelopmentevenexpandedfinalfunctionsinterestlandlegalmunicipalitiesownersownershippowerprivatepropertypublicrequire
SHARED TOKENS (27): "acquisition", "application", "buildings", "connect", "development", "even", "expanded", "final", "functions", "interest", "land", "legal", "municipalities", "owners", "ownership", "power", "private", "property", "public", "require"....
0.300
accessageamericanscarecircumstancesconditioncontinuouscoveragedesignateddischargeexpandedfacilityfinalgeneralhealthhomehospitalinsuranceintendedinterdisciplinary
SHARED TOKENS (46): "access", "age", "americans", "care", "circumstances", "condition", "continuous", "coverage", "designated", "discharge", "expanded", "facility", "final", "general", "health", "home", "hospital", "insurance", "intended", "interdisciplinary"....
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessamericansarticledatadetermineddocumentsespeciallyevenfinancialidentifyingindividualinformationinvolvinglegallylevellicensemajormillionofficeoperate
SHARED TOKENS (33): "access", "americans", "article", "data", "determined", "documents", "especially", "even", "financial", "identifying", "individual", "information", "involving", "legally", "level", "license", "major", "million", "office", "operate"....
0.300
additionaladvancedagenciesambulancebusinessescarecontactdepartmentdriveemergencyfacilitieshistoricallyhospitalmedicalmodeloperatepatientprimaryprovideproviding
SHARED TOKENS (35): "additional", "advanced", "agencies", "ambulance", "businesses", "care", "contact", "department", "drive", "emergency", "facilities", "historically", "hospital", "medical", "model", "operate", "patient", "primary", "provide", "providing"....
0.300
administrationagenciesamongchangescommunitiescompliancecontrolcurrentdefinesdepartmentdesigndesigneddocumentdriversfederalissuedlawlocalnationalowned
SHARED TOKENS (31): "administration", "agencies", "among", "changes", "communities", "compliance", "control", "current", "defines", "department", "design", "designed", "document", "drivers", "federal", "issued", "law", "local", "national", "owned"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiesbuildingscannotcombinedconnectdesigndesignedevenfallsinfrastructurelargemanagemunicipalparkingparkspropertypublicreceiverequireresidential
SHARED TOKENS (25): "bodies", "buildings", "cannot", "combined", "connect", "design", "designed", "even", "falls", "infrastructure", "large", "manage", "municipal", "parking", "parks", "property", "public", "receive", "require", "residential"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdefinitionsdifferentformindividuallinemultipleoperateoperatesoperatingoperationssectionsystemsystemstechnologytogethertransiturban
SHARED TOKENS (21): "broader", "capacity", "conditions", "definitions", "different", "form", "individual", "line", "multiple", "operate", "operates", "operating", "operations", "section", "system", "systems", "technology", "together", "transit", "urban"....
0.300
activityaffectsageannualapproximatelyassistanceassociatedbecomebehavioralburdenclinicalconditionconnectionscostdescribeddevelopmentearlyeconomicenvironmentalevents
SHARED TOKENS (50): "activity", "affects", "age", "annual", "approximately", "assistance", "associated", "become", "behavioral", "burden", "clinical", "condition", "connections", "cost", "described", "development", "early", "economic", "environmental", "events"....
0.300
actagainstamongcreatedcreatingdirectearlyestablishedfederalhealthcareinsurancelaborlawmajormedicaidnationalolderpeopleplanprogram
SHARED TOKENS (27): "act", "against", "among", "created", "creating", "direct", "early", "established", "federal", "healthcare", "insurance", "labor", "law", "major", "medicaid", "national", "older", "people", "plan", "program"....
0.300
americancarecomprehensivecontinuingfacilitieshealthhealthcarehomehospitalhospitalsidaholivingnetworkoperatesoperatingpeopleseniorsouthsupportsystem
SHARED TOKENS (20): "american", "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "living", "network", "operates", "operating", "people", "senior", "south", "support", "system".
0.300
accesscommunitydesigndesigneddrivingeconomicenvironmentalhealthhomelivingplannedpolicypractitionerspublicrequiressafesafetytransportationtravelurban
SHARED TOKENS (20): "access", "community", "design", "designed", "driving", "economic", "environmental", "health", "home", "living", "planned", "policy", "practitioners", "public", "requires", "safe", "safety", "transportation", "travel", "urban".
0.300
adaamericanarchitectureboisebuildingcapitalcompletedconstructioncontinuedcostdepartmentdesigndistrictfederalfinalhomeidaholistinglistsmaterials
SHARED TOKENS (25): "ada", "american", "architecture", "boise", "building", "capital", "completed", "construction", "continued", "cost", "department", "design", "district", "federal", "final", "home", "idaho", "listing", "lists", "materials"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
citiescommunitiesconnectingdifferenteastfeatureslinemetropolitanmultipleoperateoperatesregionalsystemstrainstransittransporturbanzone
SHARED TOKENS (18): "cities", "communities", "connecting", "different", "east", "features", "line", "metropolitan", "multiple", "operate", "operates", "regional", "systems", "trains", "transit", "transport", "urban", "zone".
0.300
assistancebecomecenterscommunitycompetitivedirectdirectlydisabilitiesemploymentenvironmentfoodindependentindividualintegratedintegrationlivingneedspeopleprofessionalsupport
SHARED TOKENS (23): "assistance", "become", "centers", "community", "competitive", "direct", "directly", "disabilities", "employment", "environment", "food", "independent", "individual", "integrated", "integration", "living", "needs", "people", "professional", "support"....
🫐 BERRY31 edges
0.280
applicationdesignfacilitiesfieldmanagementoccupationaloperationpeopleplanningprovidesafetechnologytransporttransportation
SHARED TOKENS (14): "application", "design", "facilities", "field", "management", "occupational", "operation", "people", "planning", "provide", "safe", "technology", "transport", "transportation".
0.280
actauthorizationfinancialformhealthlawlegalneedpowerpowersprincipalprivaterequirewelfare
SHARED TOKENS (14): "act", "authorization", "financial", "form", "health", "law", "legal", "need", "power", "powers", "principal", "private", "require", "welfare".
0.280
boisecitiesdesignatedfallshomeidaholinemajormetropolitanmountainnearriverroutesserves
SHARED TOKENS (14): "boise", "cities", "designated", "falls", "home", "idaho", "line", "major", "metropolitan", "mountain", "near", "river", "routes", "serves".
0.260
accesscapacitycontroldependeconomicfinancialformhomepowerpropertyresourcessupportthem
SHARED TOKENS (13): "access", "capacity", "control", "depend", "economic", "financial", "form", "home", "power", "property", "resources", "support", "them".
0.260
associationcarecostcreatehealthhealthcarehomeintendedorganizationprofessionalprovidequalityrequire
SHARED TOKENS (13): "association", "care", "cost", "create", "health", "healthcare", "home", "intended", "organization", "professional", "provide", "quality", "require".
0.260
communitycomplexdepartmentsdifferentdisabilitiesfundinghealthhousingintendedmobilitypeopleprofessionalwork
SHARED TOKENS (13): "community", "complex", "departments", "different", "disabilities", "funding", "health", "housing", "intended", "mobility", "people", "professional", "work".
0.260
approximatelyboisedatadistrictdividedevenidaholimitspeoplepopulationresidentssinglesouth
SHARED TOKENS (13): "approximately", "boise", "data", "district", "divided", "even", "idaho", "limits", "people", "population", "residents", "single", "south".
0.260
americandepartmentdepartmentsdirectlyfederalmissionpeopleplanreportssafeservingsystemtransportation
SHARED TOKENS (13): "american", "department", "departments", "directly", "federal", "mission", "people", "plan", "reports", "safe", "serving", "system", "transportation".
0.260
additionalbecomecontinuingeducationentry-levelfieldmedicalpracticeprofessionalrequirementsresearchspecifictraining
SHARED TOKENS (13): "additional", "become", "continuing", "education", "entry-level", "field", "medical", "practice", "professional", "requirements", "research", "specific", "training".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
constructionequipmentinfrastructurelargelegallimitsordinaryroadsizestandardtransporttransportationwater
SHARED TOKENS (13): "construction", "equipment", "infrastructure", "large", "legal", "limits", "ordinary", "road", "size", "standard", "transport", "transportation", "water".
0.240
civilconstructiondesignfuturemaintenancematerialsoperationplanningprofessionalstandardsstructuraltransportation
SHARED TOKENS (12): "civil", "construction", "design", "future", "maintenance", "materials", "operation", "planning", "professional", "standards", "structural", "transportation".
0.220
carecollegeeducationgeneralhealthlevelmedicalprofessionalspecializedthemtraining
SHARED TOKENS (11): "care", "college", "education", "general", "health", "level", "medical", "professional", "specialized", "them", "training".
0.220
bankscanyonconnectingeagleeastidahomarsingmeridiannamparivervalley
SHARED TOKENS (11): "banks", "canyon", "connecting", "eagle", "east", "idaho", "marsing", "meridian", "nampa", "river", "valley".
0.220
createuses
SHARED TOKENS (2): "create", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.220
americancommercialenvironmentextendedlandlogisticsmilitaryphysicalprocessproductstransport
SHARED TOKENS (11): "american", "commercial", "environment", "extended", "land", "logistics", "military", "physical", "process", "products", "transport".
0.210
rehabilitation
SHARED TOKENS (1): "rehabilitation". | EXACT TITLE in senior_services: "Rehabilitation". | EXACT TITLE in transportation_infrastructure: "Rehabilitation".
0.200
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanmiddletonnampapopulationruralwestern
SHARED TOKENS (10): "boise", "caldwell", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population", "rural", "western".
0.200
accessconnectingdesignedlocalmajormoveprovideresidentialroadserves
SHARED TOKENS (10): "access", "connecting", "designed", "local", "major", "move", "provide", "residential", "road", "serves".
0.180
agecontactgrouphistoricalhomeindividualsocietytemporarythough
SHARED TOKENS (9): "age", "contact", "group", "historical", "home", "individual", "society", "temporary", "though".
0.180
costshandlingitselfmultipleroadsecuritytransporttransportationvehicle
SHARED TOKENS (9): "costs", "handling", "itself", "multiple", "road", "security", "transport", "transportation", "vehicle".
0.180
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentrylinepermittedresearchroadsafetyshows
SHARED TOKENS (9): "businesses", "economic", "entry", "line", "permitted", "research", "road", "safety", "shows".
0.160
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedeastidaholimitedsouthsystemwestwestern
SHARED TOKENS (8): "continued", "east", "idaho", "limited", "south", "system", "west", "western".
0.160
citiescountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (8): "cities", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.160
adultsdemographicfallsmakingmultipleolderpeoplereduce
SHARED TOKENS (8): "adults", "demographic", "falls", "making", "multiple", "older", "people", "reduce".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
commerciallargelicensematerialsoperatesizevehicle
SHARED TOKENS (7): "commercial", "large", "license", "materials", "operate", "size", "vehicle".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
adaconnectingcountiesidahostar
SHARED TOKENS (5): "ada", "connecting", "counties", "idaho", "star".
0.100
actamongfederalhomelaw
SHARED TOKENS (5): "act", "among", "federal", "home", "law".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Senior Services × Transportation Infrastructure — Treasure Valley
HAIKU · HIGH GATE
How does paratransit in Boise serve seniors who cannot use fixed-route public transport?
Paratransit services in Boise operate under Americans with Disabilities Act of 1990 mandates to provide door-to-door or curb-to-curb transportation for seniors and people with disabilities who cannot access standard public transport routes. Senior services coordinators across Boise, Nampa, and Star work with local paratransit operators to schedule trips for medical appointments and essential services, addressing mobility gaps created by Treasure Valley suburbanization.
Why does demand-responsive transport matter for seniors in sprawling areas like Star and Nampa?
Urban sprawl across the Treasure Valley has increased distances between residential areas and senior service locations, making demand-responsive transport essential for populations in Star, Nampa, and outlying communities. Demand-responsive systems allow seniors to request rides based on actual need rather than fixed schedules, reducing travel barriers in low-density suburban development where traditional public transport is inefficient.
What role do Boise State University and College of Western Idaho play in researching senior transportation needs?
Boise State University and College of Western Idaho conduct research and workforce training in land-use planning and public transport design, contributing to solutions for aging populations across the metropolitan area. Their programs inform local zoning decisions and transportation infrastructure development that address how seniors navigate Treasure Valley communities from Boise east through Canyon County.
How does zoning policy in Boise and Nampa affect senior access to transportation?
Zoning regulations in Boise and Nampa determine land-use patterns that either concentrate or disperse senior services, directly impacting whether public transport and paratransit can efficiently serve older populations. Mixed-use zoning near transit corridors reduces distances seniors must travel, while single-use residential zoning in Treasure Valley suburbs increases dependence on demand-responsive and paratransit options.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Senior Services × Transportation Infrastructure 23 QID bridges 239 edges 6,630 ext links 2026-07-17 23:10:49 UTC ef56c72bedde0d4d
Senior Services corridor ↗ Transportation Infrastructure corridor ↗ Transportation Infrastructure × Senior Services ↗ boisestandard.org/standard ↗
Parent Corridors
Senior Services × All Other Verticals