—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Security Services ↔ relates to ↔ Procurement Public Spending

17 Wikipedia bridge articles confirmed in both vertical ledgers. 235 deterministic cross-vertical edges. 5,911 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
235 Cross Edges
5,911 External Sources
268 Wikipedia Articles
17 🌲 Evergreen
167 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Security Services
× Procurement Public Spending
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
235
External Sources Harvested
5,911
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  20 shared tokens
QID Bridge Titles (17)
IdahoRisk managementApprenticeshipBoise State UniversityGovernment procurementCollege of Western IdahoLaw enforcementEmergency managementTreasure ValleyVocational educationMergers and acquisitionsComputer securityPrivate equityBoise, IdahoCanyon County, IdahoMeridian, IdahoProfessional certification
Shared Semantics (20 tokens)
boiseidahopubliccapitalpopulationtechnologymanagementprofessionaloregonwesternamongcontroldevelopmentfinancelegalprocessestechnicalworkingactivitybusiness
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:03:55 UTC
Content Hash
df9d93fa7fd236bd
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in security_services (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (20): "approximately", "associated", "boise", "capital", "distinct", "geographic", "idaho", "isolated", "largest", "national", "official", "oregon", "periods", "population", "products", "separate", "small", "supplies", "technology", "western". | EXACT TITLE in security_services: "Idaho". | EXACT TITLE in procurement_public_spending: "Idaho".
approximatelyassociatedboisecapitaldistinctgeographicidahoisolatedlargestnationalofficialoregonperiodspopulationproductsseparatesmallsuppliestechnologywestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Risk management
Q189447 EXACT TITLE 1.000
QID OVERLAP: Q189447 in security_services (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (49): "according", "among", "another", "audit", "comprehensive", "control", "data", "design", "development", "engineering", "evaluated", "even", "finance", "financial", "health", "identifying", "improvement", "increase", "industrial", "institutions".... | EXACT TITLE in security_services: "Risk management". | EXACT TITLE in procurement_public_spending: "Risk management".
accordingamonganotherauditcomprehensivecontroldatadesigndevelopmentengineeringevaluatedevenfinancefinancialhealthidentifyingimprovementincreaseindustrialinstitutionsinsuranceinternallargelegalmanagementmanagersmarketsmonitoringnationalofficer+19
e Project Management Institute, the National Institute of Standards and Technology, actuarial societies, and International Organization for Standardization. Methods, definitions and goals vary widely according to whether the risk management method is in the context of project management, security, engineering, industrial processes, financial portfolios, actuarial assessments, or public health and safety. Certain risk management standards have been criticized for having no measurable improvement on risk, whereas the confidence in estimates and decisions seems to increase. Strategies to manage threats (uncertainties with negative consequences) typically include avoiding the threat, reducing the negative effect or probability of the threat, transferring all or part of the threat to another party, and even retaining some or all of the potential or actual consequences of a particular threat. The opposite of these strategies can be used to respond to opportunities (uncertain future states with benefits). As a professional role, a risk manager will "oversee the organization's comprehensive insurance and risk management program, assessing and identifying risks that could impede the reputation, safety, security, or financial success of the organization", and then develop plans to minimize and/or mitigate any negative (financial) outcomes. Risk analysts support the technical side of the organization's risk management approach: once risk data has been compiled and evaluated, analysts share their findings with their managers, who use those insights to decide among possible solutions.
Mild versus wild risk Benoit Mandelbrot distinguished between "mild" and "wild" risk and argued that risk assessment and management must be fundamentally different for the two types of risk. Mild risk follows normal or near-normal probability distributions, is subject to regression to the mean and the law of large numbers, and is therefore relatively predictable. Wild risk follows fat-tailed distributions, e.g., Pareto or power-law distributions, is subject to regression to the tail (infinite mean or variance, rendering the law of large numbers invalid or ineffective), and is therefore difficult or impossible to predict.
These quantities can be either simple to measure, in the case of the value of a lost building, or impossible to know for sure in the case of an unlikely event, the probability of occurrence of which is unknown. Therefore, in the assessment process it is critical to make the best educated decisions in order to properly prioritize the implementation of the risk management plan. Even a short-term positive improvement can have long-term negative impacts. Take the "turnpike" example. A highway is widened to allow more traffic. More traffic capacity leads to greater development in the areas surrounding the improved traffic capacity. Over time, traffic thereby increases to fill available capacity. Turnpikes thereby need to be expanded in a seemingly endless cycles. There are many other engineering examples where expanded capacity (to do any function) is soon filled by increased demand. Since expansion comes at a cost, the resulting growth could become unsustainable without forecasting and management. The fundamental difficulty in risk assessment is determining the rate of occurrence since statistical information is not available on all kinds of past incidents and is particularly scanty in the case of catastrophic events, simply because of their infrequency. Furthermore, evaluating the severity of the consequences (impact) is often quite difficult for intangible assets. Asset valuation is another question that needs to be addressed. Thus, best educated opinions and available statistics are the primary sources of information. Nevertheless, risk assessment should produce such information for senior executives of the organization that the primary risks are easy to understand and that the risk management decisions may be prioritized within overall company goals. Thus, there have been several theories and attempts to quantify risks. Numerous different risk formulae exist, but perhaps the most widely accepted formula for risk quantification is: "Rate (or probability) of occurrence multiplied by the impact of the event equals risk magnitude." Risk options Risk mitigation measures are usually formulated according to one or more of the following major risk options, which are: Design a new business process with adequate built-in risk control and containment measures from the start. Periodically re-assess risks that are accepted in ongoing processes as a normal feature of business operations and modify mitigation measures. Transfer risks to an external agency (e.g. an insurance company) Avoid risks altogether (e.g. by closing down a particular high-risk business area) Later research has shown that the financial benefits of risk management are less dependent on the formula used but are more dependent on the frequency and how risk assessment is performed. In business it is imperative to be able to present the findings of risk assessments in financial, market, or schedule terms. Robert Courtney Jr. (IBM, 1970) proposed a formula for presenting risks in financial terms. The Courtney formula was accepted as the official risk analysis method for the US governmental agencies.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in security_services (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (16): "certification", "competence", "complete", "field", "found", "gain", "labor", "license", "outside", "practitioners", "profession", "professional", "regulated", "system", "training", "working". | EXACT TITLE in security_services: "Apprenticeship".
certificationcompetencecompletefieldfoundgainlaborlicenseoutsidepractitionersprofessionprofessionalregulatedsystemtrainingworking
Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Expansion into services, agriculture, and mining sectors Cost-sharing between the industry and government Formalization of informal apprenticeships Alignment with the National Vocational Qualifications Framework (Pakistan NVQF) Increased female participation Financial incentives for industries exceeding apprentice requirements Joint assessment and certification by the industry, Chamber of Commerce, and government Switzerland In Switzerland, after the end of compulsory schooling, two thirds of young people follow a vocational training. Ninety percent of them are in the dual education system. Switzerland has an apprenticeship similarly to Germany and Austria. The educational system is ternar, which is basically dual education system with mandatory practical courses.
Length Apprenticeships with a length of 2 years are for persons with weaker school results. The certificate awarded after successfully completing a 2-year apprenticeship is called "Attestation de formation professionnelle" (AFP) in French, "Eidgenössisches Berufsattest" (EBA) in German and "Certificato federale di formazione pratica" (CFP) in Italian. It could be translated as "Attestation of professional formation". Apprenticeship with a length of 3 or 4 years are the most common ones. The certificate awarded after successfully completing a 3 or 4-year apprenticeship is called "Certificat Fédéral de Capacité" (CFC) in French, "Eidgenössisches Fähigkeitszeugnis" (EFZ) in German and "Attestato federale di capacità" (AFC) in Italian. It could be translated as "Federal Certificate of Proficiency". Some crafts, such as electrician, are educated in lengths of 3 and 4 years. In this case, an Electrician with 4 years apprenticeship gets more theoretical background than one with 3 years apprenticeship. Some languages have different names for a craft depending on the length of the apprenticeship; this can be lost in translation. Each of the over 300 nationwide defined vocational profiles has defined framework – conditions as length of education, theoretical and practical learning goals and certification conditions. Age of the apprentices Typically an apprenticeship can commence for individuals once they are aged 15 or 18 after finishing general education. Some apprenticeships have a recommend or required age of 18.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in security_services (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (19): "activity", "among", "boise", "business", "college", "compete", "division", "education", "engineering", "health", "idaho", "independent", "program", "programs", "public", "research", "school", "total", "university". | EXACT TITLE in security_services: "Boise State University". | EXACT TITLE in procurement_public_spending: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneducationengineeringhealthidahoindependentprogramprogramspublicresearchschooltotaluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
G
Q20665717 EXACT TITLE 1.000
QID OVERLAP: Q20665717 in security_services (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (36): "agency", "agreement", "approximately", "authority", "businesses", "capable", "clauses", "construction", "contracts", "direct", "economic", "enterprise", "estimated", "gain", "government", "governments", "group", "growth", "laws", "local".... | EXACT TITLE in security_services: "Government procurement". | EXACT TITLE in procurement_public_spending: "Government procurement".
agencyagreementapproximatelyauthoritybusinessescapableclausesconstructioncontractsdirecteconomicenterpriseestimatedgaingovernmentgovernmentsgroupgrowthlawslocalorganizationspracticesprivateprocessprocurementproducepublicpurchasesqualityrequire+6
Government procurement or public procurement is the purchase of goods, works (construction), or services by the state, such as by a government agency or a state-owned enterprise. In 2019, public procurement accounted for approximately 12% of GDP in OECD countries. In 2021, the World Bank Group estimated that public procurement made up about 15% of global GDP. Therefore, government procurement accounts for a substantial part of the global economy. Public procurement is based on the idea that governments should direct their society while giving the private sector the freedom to decide the best practices to produce the desired goods and services. One benefit of public procurement is its ability to cultivate innovation and economic growth. The public sector picks the most capable nonprofit or for-profit organizations available to issue the desired good or service to the taxpayers. This produces competition within the private sector to gain these contracts that then reward the organizations that can supply more cost-effective and quality goods and services. Some contracts also have specific clauses to promote working with minority-led, women-owned businesses and/or state-owned enterprises. Competition is a key component of public procurement which affects the outcomes of the whole process. There is a great amount of competition over public procurements because of the massive amount of money that flows through these systems; It is estimated that approximately eleven trillion USD is spent on public procurement worldwide every year. To prevent fraud, waste, corruption, or local protectionism, the laws of most countries regulate government procurement to some extent. Laws usually require the procuring authority to issue public tenders if the value of the procurement exceeds a certain threshold.
Others One issue of public procurement is the inability of governments to measure economic productivity, because as the size of public procurement systems substantially grows, so do their complexity and influence. Public procurement is heavily embedded in all forms of public sector goods and services, from health care to road maintenance, thus making it difficult for the government to monitor the impacts, positive or negative. Monitoring public spending and its impact is important to reform public procurement, especially when pending economic instability calls for proactive responses. In some cases, if a nation is extremely impoverished, it may not have the necessary funds or a large enough private sector to even procure companies to issue the goods or services to the people. Thus, omitting public procurement as a potential governing practice. Cost-plus contracts can incentivize cost overruns. Regulation by jurisdiction Albania Albania's Public Procurement Agency (Agjencia e Prokurimit Publik) is a central body with legal and public personality reporting to the Prime Minister, and financed by the State Budget. Its activity is based on: Law No. 9643/2006 "On public procurement", as amended Law No. 125/2013 "On concessions and public private partnership", as amended, which repealed the previous law "On concessions" (Law No. 9663, dated 18 December 2006), and Law No.
Law No. 9643/2006 "On public procurement", as amended Law No. 125/2013 "On concessions and public private partnership", as amended, which repealed the previous law "On concessions" (Law No. 9663, dated 18 December 2006), and Law No. 9874/2008 "On public auction", as amended. The main duties and competencies of the Public Procurement Agency are: preparation of project-proposals for public procurement regulations, public auctions and those in the field of concessions/public private partnerships, preparation of Standard Tender Documents and issuing the necessary instructions in order to assist the contracting authorities undertaking these procedures; verification of the implementation of public procurement, concessions and public auction procedures after the phase of contract signature and in case of infringements of the legal and sublegal provisions, penalizes with fines or proposes administrative measures; monitoring the progress of the public procurement system, and the implementation of measures and activities in order to achieve and maintain a completely transparent and efficient system of concessions/public private partnerships; preparation and publication of the Public Notices Bulletin; exclusion of economic operators from participation in public procurement, concessions or public auctions for a period of 1 to 3 years; promotion and organisation of training for central and local government officials involved in public procurement activities. The Public Procurement Commission (PPC in English, KPP in Albanian) is a quasi-judicial state body with responsibility for providing legal protection in relation to public procurement. The US Department of Commerce reports that businesses "occasionally complain about problems in the technical and financial criteria of contracts, resulting in biased and distorted competition" and that "improper implementation of [Albania's] public procurement procedures" has also been noted as a problem.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in security_services (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (25): "academic", "board", "boise", "canyon", "college", "comprehensive", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "residents", "students", "technical", "throughout".... | EXACT TITLE in security_services: "College of Western Idaho". | EXACT TITLE in procurement_public_spending: "College of Western Idaho".
academicboardboisecanyoncollegecomprehensivecwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicresidentsstudentstechnicalthroughouttransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
L
Q44554 EXACT TITLE 1.000
QID OVERLAP: Q44554 in security_services (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (24): "act", "activity", "associated", "authority", "codes", "courts", "forms", "governing", "government", "independently", "institutions", "law", "legal", "officer", "operate", "organizations", "power", "property", "protecting", "public".... | EXACT TITLE in security_services: "Law enforcement".
actactivityassociatedauthoritycodescourtsformsgoverninggovernmentindependentlyinstitutionslawlegalofficeroperateorganizationspowerpropertyprotectingpublicrecordrulessystemthroughout
Law enforcement is the activity of some members of the government or other social institutions who act in an organized manner to enforce the law by investigating, deterring, rehabilitating, or punishing people who violate the rules and norms governing that society. The term encompasses police, courts and corrections. These three components of the criminal justice system may operate independently of each other or collectively through the use of record sharing and cooperation. Throughout the world, law enforcement are also associated with protecting the public, life, property, and keeping the peace in society. The concept of law enforcement dates back to ancient times, and forms of law enforcement and police have existed in various forms across many human societies.
Law enforcement organizations existed in ancient times, such as prefects in ancient China, paqūdus in Babylonia, curaca in the Inca Empire, vigiles in the Roman Empire, and Medjay in ancient Egypt. Who law enforcers were and reported to depended on the civilization and often changed over time, but they were typically slaves, soldiers, officers of a judge, or hired by settlements and households. Aside from their duties to enforce laws, many ancient law enforcers also served as slave catchers, firefighters, watchmen, city guards, and bodyguards. By the post-classical period and the Middle Ages, forces such as the Santa Hermandades, the shurta, and the Maréchaussée provided services ranging from law enforcement and personal protection to customs enforcement and waste collection. In England, a complex law enforcement system emerged, where tithings, groups of ten families, were responsible for ensuring good behavior and apprehending criminals; groups of ten tithings ("hundreds") were overseen by a reeve; hundreds were governed by administrative divisions known as shires; and shires were overseen by shire-reeves. In feudal Japan, samurai were responsible for enforcing laws. The concept of police as the primary law enforcement organization originated in Europe in the early modern period; the first statutory police force was the High Constables of Edinburgh in 1611, while the first organized police force was the Paris lieutenant général de police in 1667. Until the 18th century, law enforcement in England was mostly the responsibility of private citizens and thief-takers, albeit also including constables and watchmen. This system gradually shifted to government control following the 1749 establishment of the London Bow Street Runners, the first formal police force in Britain. In 1800, Napoleon reorganized French law enforcement to form the Paris Police Prefecture; the British government passed the Glasgow Police Act, establishing the City of Glasgow Police; and the Thames River Police was formed in England to combat theft on the River Thames. In September 1829, Robert Peel merged the Bow Street Runners and the Thames River Police to form the Metropolitan Police.
Following European colonization of the Americas, the first law enforcement agencies in the Thirteen Colonies were the New York Sheriff's Office and the edit County Sheriff's Department, both formed in the 1660s in the Province of New York. The Province of Carolina established slave-catcher patrols in the 1700s, and by 1785, the Charleston Guard and Watch was reported to have the duties and organization of a modern police force. The first municipal police department in the United States was the Philadelphia Police Department, while the first American state police, federal law enforcement agency was the United States Marshals Service, both formed in 1789. In the American frontier, law enforcement was the responsibility of county sheriffs, rangers, constables, and marshals. The first law enforcement agency in Canada was the Royal Newfoundland Constabulary, established in 1729, while the first Canadian national law enforcement agency was the Dominion Police, established in 1868. By the 19th century, improvements in technology, greater global connections, and changes in the sociopolitical order led to the establishment of police forces worldwide. National, regional, and municipal civilian law enforcement agencies exist in practically all countries; to promote their international cooperation, the International Criminal Police Organization, also known as Interpol, was formed in September 1923.
Emergency management
Q1460420 EXACT TITLE 0.960
QID OVERLAP: Q1460420 in security_services (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (13): "different", "emergency", "federal", "generally", "governments", "local", "management", "needs", "organizations", "professional", "requires", "response", "risk". | EXACT TITLE in security_services: "Emergency management".
differentemergencyfederalgenerallygovernmentslocalmanagementneedsorganizationsprofessionalrequiresresponserisk
ng evacuation alerts. The management of disasters requires collaboration between individuals, households, non-governmental organizations, and local, provincial, and federal governments. Although many different terminologies exist globally, the activities of emergency management can be generally categorized into preparedness, response, mitigation, and recovery, although other terms such as disaster risk reduction and prevention are also common.
Employer responsibilities When an emergency situation occurs, employers may be expected to protect workers from all harm resulting from any potential hazard, including physical, chemical, and biological exposure. An employer should provide pre-emergency training and build an emergency action plan (EAP). Employers should train their employees annually before an emergency action plan is implemented to inform employees of their responsibilities and/or plan of action during emergency situations. The training program should include the types of emergencies that may occur, the appropriate response, evacuation procedure, warning/reporting procedure, and shutdown procedures.
Disaster mitigation measures are those that eliminate or reduce the impacts and risks of hazards through proactive measures taken before an emergency or disaster occurs. Preventive or mitigation measures vary for different types of disasters. In earthquake prone areas, these preventive measures might include structural changes such as the installation of an earthquake valve to instantly shut off the natural gas supply, seismic retrofits of property, and the securing of items inside a building. The latter may include the mounting of furniture, refrigerators, water heaters and breakables to the walls, and the addition of cabinet latches. In flood prone areas, houses can be built on stilts. In areas prone to prolonged electricity black-outs installation of a generator ensures continuation of electrical service. The construction of storm cellars and fallout shelters are further examples of personal mitigative actions. The safe room is a reinforced structure to provide near absolute protection in extreme wind events such as tornadoes and hurricanes. If one window or door breaks, the roof is more likely to blow off due to the pressure wind coming into the house. Closing all interior doors, reduces the forces on the roof. Doors, windows, and roofs rated for 195 mph (314 km/h) winds are stronger during hurricanes, typhoons and tornadoes.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in security_services (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (12): "association", "boise", "idaho", "local", "lower", "opportunities", "oregon", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in security_services: "Treasure Valley". | EXACT TITLE in procurement_public_spending: "Treasure Valley".
associationboiseidaholocalloweropportunitiesoregonregionresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Vocational education
Q6869278 QID OVERLAP 0.800
QID OVERLAP: Q6869278 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (16): "college", "economic", "education", "forms", "general", "individual", "knowledge", "names", "provide", "school", "schools", "specialized", "technical", "technology", "training", "type".
collegeeconomiceducationformsgeneralindividualknowledgenamesprovideschoolschoolsspecializedtechnicaltechnologytrainingtype
ng those techniques, as well as general knowledge, skills and values. A vocational school is a type of educational institution specifically designed to provide vocational education, as is a technical college. Vocational education can take place at the post-secondary, further education, and higher education levels.
e post-secondary, further education, and higher education levels. At the post-secondary level, vocational education is often provided by highly specialized trade schools, technical schools, community colleges, colleges of further education (UK), vocational universities, and institutes of technology (formerly called polytechnic institutes). Overview Historically, most vocational education took place in classrooms or on job sites, with students learning trade skills and trade theory from accredited instructors or established professionals. However, in recent years, online vocational education has grown in popularity, making learning various trade skills and soft skills from established professionals easier than ever for students, even those who may live far away from a traditional vocational school. Trends have emerged in the implementation of TVET and skills development worldwide. From the late 1980s onwards a number of governments began to emphasize on the role of education in preparing learners effectively for the world of work. This school of thought, termed "new vocationalism", placed the skills needs of industry at the centre of discussions on the purpose of public education. TVET and skills development were viewed as an important component in promoting economic growth in general and addressing youth unemployment in particular. General education systems had not been effective in developing the skills that many adolescents and adults needed to secure employment in industry.
Private sector Private TVET providers include for-profit and non-profit institutions. Several factors triggered actions to support the expansion of private TVET including the limited capacities of public TVET providers and their low responsiveness to enterprises and trainees. Private TVET providers were expected to be more responsive because they were subject to fewer bureaucratic restrictions than public institutions (particularly in centralized systems). Their presence was expected to help raise quality system-wide, in many developing countries, government budgets constituted a vulnerable and unreliable source of financing for TVET, an important objective was to finance TVET systems by increasing the contribution of beneficiaries, including employers and trainees. Private TVET provision over since 2005 has become a significant and growing part of TVET in sub-Saharan Africa, the Middle East and North Africa. In some countries, e.g. Lebanon, enrolments in private TVET institutions have exceeded enrolments in public institutions. In Jordan, private provision at the community college level has been promoted by the government. However, not all experiences has been positive with private proprietary institutions or NGOs, their courses have often been concentrated in professional areas that typically do not require large capital investment, permitting easy entry and exit by private providers from the sector.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (38): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "consolidated", "consolidation", "control", "create", "department", "described", "direct", "entity", "federal", "governed", "government"....
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralconsolidatedconsolidationcontrolcreatedepartmentdescribeddirectentityfederalgovernedgovernmentlawlegalmanagementmarketnotificationoperatingoperationsownershipprocessesrequire+8
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Computer security
Q3510521 QID OVERLAP 0.800
QID OVERLAP: Q3510521 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (26): "becomes", "cybersecurity", "data", "dependence", "digital", "electronic", "expanded", "field", "finance", "functions", "information", "infrastructure", "involve", "network", "networks", "physical", "power", "processes", "protecting", "provide"....
becomescybersecuritydatadependencedigitalelectronicexpandedfieldfinancefunctionsinformationinfrastructureinvolvenetworknetworksphysicalpowerprocessesprotectingprovidesecuritysoftwarestandardssystemstechnologytherefore
work standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
Computer security (also cybersecurity, digital security, or information technology (IT) security) is a subdiscipline within the field of information security. It focuses on protecting computer software, systems, and networks from threats that can lead to unauthorized information disclosure, theft, or damage to hardware, software, or data, as well as to the disruption or misdirection of the services they provide. The growing significance of computer security reflects the increasing dependence on computer systems, the Internet, and evolving wireless network standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
IP address spoofing is where the attacker hijacks routing protocols to reroute the targets traffic to a vulnerable network node for traffic interception or injection. Message spoofing (via email, SMS or OTT messaging) is where the attacker spoofs the identity or carrier service while the target is using messaging protocols like email, SMS or OTT (IP-based) messaging apps. The attacker can then monitor conversations, launch social attacks or trigger zero-day-vulnerabilities to allow for further attacks. WiFi SSID spoofing is where the attacker simulates a Wi-Fi base station SSID to capture and modify internet traffic and transactions. The attacker can also use local network addressing and reduced network defenses to penetrate the target's firewall by breaching known vulnerabilities. Sometimes known as a Pineapple attack thanks to a popular device. See also Malicious association. DNS spoofing is where attackers hijack domain name assignments to redirect traffic to systems under the attackers' control, in order to surveil traffic or launch other attacks. SSL hijacking, typically coupled with another media-level MITM attack, is where the attacker spoofs the SSL authentication and encryption protocol by way of Certificate Authority injection in order to decrypt, surveil and modify traffic. See also TLS interception Multi-vector, polymorphic attacks Surfacing in 2017, a new class of multi-vector, polymorphic cyber threats combine several types of attacks and change form to avoid cybersecurity controls as they spread. Multi-vector polymorphic attacks, as the name describes, are both multi-vectored and polymorphic. Firstly, they are a singular attack that involves multiple methods of attack. In this sense, they are "multi-vectored" (i.e. the attack can use multiple means of propagation such as via the Web, email and applications).
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (26): "business", "capital", "category", "changes", "control", "described", "development", "enterprise", "finance", "financial", "firms", "general", "limited", "management", "operational", "otherwise", "ownership", "private", "products", "provide"....
businesscapitalcategorychangescontroldescribeddevelopmententerprisefinancefinancialfirmsgenerallimitedmanagementoperationalotherwiseownershipprivateproductsprovidepublicratherrolespecializedstrategyworking
l restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
An Investment manager (the private equity investor) raises money from institutional investors (e.g., hedge funds, pension funds, university endowments, and ultra-high-net-worth individuals) to pursue a particular investment strategy. The fund's raised proceeds are placed into an investment fund, of which the investment manager acts as a general partner (GP) and the institutional investors act as limited partners (LPs). The investment manager then purchases equity ownership stakes in companies by using a combination of equity and debt financing, with the goal of generating returns on the equity invested, including any subsequent equity investments into the target companies, over a target horizon based on the particular investment fund and strategy (typically 4–7 years). From a financial modeling perspective, the primary levers available to private equity investors to drive returns are: Revenue growth Margin expansion (typically an EBITDA margin) Free cash flow generation / debt paydown Valuation multiple expansion (typically an Enterprise Value / EBITDA multiple) Value creation strategies can vary widely by private equity fund. For example, some investors may target increasing sales in new or existing markets (driving revenue growth), and others may look to reduce costs through headcount reduction (expanding margins). Many strategies incorporate some amount of corporate governance restructuring, for example, setting up a board of directors or updating the target's managerial reporting structure. The use of debt financing in acquiring companies increases an investment's return on equity by reducing the amount of initial equity required to purchase the target. Moreover, the interest payments are tax-deductible, so the debt financing reduces corporate taxes and thus increases total after-tax cash flows generated by the business. Following a series of high-profile bankruptcies, aggressive leverage usage by private equity funds has declined in recent decades. In 2005, approximately 70% of the average private equity acquisition represented debt, but it was closer to 50% in 2020. Firms that assume large operational risks (e.g., "turnarounds") will usually apply far lower leverage levels to acquired companies in order to provide management with more financial flexibility; firms taking fewer operational risks will often try to maximize available leverage and focus on investments that generate strong, stable cash flows needed to service the higher debt balances. Over time, "private equity" has come to refer to many different investment strategies, including leveraged buyout, distressed securities, venture capital, growth capital, and mezzanine capital.
Strategies The strategies private-equity firms may use are as follows, leveraged buyout being the most common. Leveraged buyout Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (13): "annual", "boise", "capital", "estimated", "home", "idaho", "locally", "major", "oregon", "population", "technology", "treasure", "valley".
annualboisecapitalestimatedhomeidaholocallymajororegonpopulationtechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in security_services (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "largest", "making", "nampa", "population".
boisecaldwellcanyonestimatedidaholargestmakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (8): "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population".
amongboisecapitalcitiesidahomakingmeridianpopulation
population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
P
Q16023913 QID OVERLAP 0.600
QID OVERLAP: Q16023913 in security_services (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (5): "agency", "certification", "professional", "public", "qualification".
agencycertificationprofessionalpublicqualification
on, is a designation earned by a person to assure qualification to perform a job or task. Not all certifications that use post-nominal letters are an acknowledgement of educational achievement, or an agency appointed to safeguard the public interest. Overview A certification is a third-party attestation of an individual's level of knowledge or proficiency in a certain industry or profession. They are granted by authorities in the field, such as professional societies and colleges, or by private certificate-granting agencies. Most certifications are time-limited; some expire after a period of time (e.g., the lifetime of a product that requires certification for use), while others can be renewed indefinitely as long as certain requirements are met. Renewal usually requires ongoing education to remain up-to-date on advancements in the field, evidenced by earning the specified number of continuing education credits (CECs), or continuing education units (CEUs), from approved professional development courses. Certification is different from occupational licensing. In the United States, licenses are typically issued by state agencies, whereas certifications are usually awarded by professional societies or educational institutes. Obtaining a certificate is voluntary in some fields, but in others, certification from a government-accredited agency may be legally required to perform certain jobs or tasks. In other countries, licenses are typically granted by professional societies or universities and require a certificate after about three to five years and so on thereafter. The assessment process for certification may be more comprehensive than that of licensure, though sometimes the assessment process is very similar or even the same, despite differing in terms of legal status. According to The Guide to National Professional Certification Programs (1997) by Phillip Barnhart, "certifications are portable, since they do not depend on one company's definition of a certain job" and they provide potential employers with "an impartial, third-party endorsement of an individual's professional knowledge and experience". Many certification programs are affiliated with professional associations, trade organizations, or private vendors interested in raising industry standards. Certification programs are often created or endorsed by professional associations, but are typically completely independent from membership organizations.
A certification is a third-party attestation of an individual's level of knowledge or proficiency in a certain industry or profession. They are granted by authorities in the field, such as professional societies and colleges, or by private certificate-granting agencies. Most certifications are time-limited; some expire after a period of time (e.g., the lifetime of a product that requires certification for use), while others can be renewed indefinitely as long as certain requirements are met. Renewal usually requires ongoing education to remain up-to-date on advancements in the field, evidenced by earning the specified number of continuing education credits (CECs), or continuing education units (CEUs), from approved professional development courses. Certification is different from occupational licensing. In the United States, licenses are typically issued by state agencies, whereas certifications are usually awarded by professional societies or educational institutes. Obtaining a certificate is voluntary in some fields, but in others, certification from a government-accredited agency may be legally required to perform certain jobs or tasks. In other countries, licenses are typically granted by professional societies or universities and require a certificate after about three to five years and so on thereafter. The assessment process for certification may be more comprehensive than that of licensure, though sometimes the assessment process is very similar or even the same, despite differing in terms of legal status. According to The Guide to National Professional Certification Programs (1997) by Phillip Barnhart, "certifications are portable, since they do not depend on one company's definition of a certain job" and they provide potential employers with "an impartial, third-party endorsement of an individual's professional knowledge and experience". Many certification programs are affiliated with professional associations, trade organizations, or private vendors interested in raising industry standards. Certification programs are often created or endorsed by professional associations, but are typically completely independent from membership organizations.
Data management Business Intelligence and Data Analyst (BIDA) by Corporate Finance Institute (CFI). Certified Data Management Professional (CDMP) by DAMA International. Dentistry Electronics In the United States, several electronics certifications are provided by the Electronics Technicians Association. Emergency management The Federal Emergency Management Agency's EMI offers credentials and training opportunities for United States citizens.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
218 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP218 edges
🌿 BRANCH167 edges
0.500
analysisassessmentassetsbuildingsclassificationdevelopmentdocumentationidentifyinformationmanagementpoliciesprocedureproceduresprotectingrisksecuritysystemsystems
SHARED TOKENS (18): "analysis", "assessment", "assets", "buildings", "classification", "development", "documentation", "identify", "information", "management", "policies", "procedure", "procedures", "protecting", "risk", "security", "system", "systems". | EXACT TITLE in security_services: "Security management".
0.500
accessactauthorizationauthorizedcontrolcontrolsdesigndigitalgeneralinformationleastmodelneedorderorganizationsphysicalplatformspoliciespolicyrequire
SHARED TOKENS (24): "access", "act", "authorization", "authorized", "control", "controls", "design", "digital", "general", "information", "least", "model", "need", "order", "organizations", "physical", "platforms", "policies", "policy", "require".... | EXACT TITLE in security_services: "Access control".
0.500
agenciesassetsauthoritiesauthoritybusinessesdepartmentsdirectlyeligibilityemergencyemployedequipmentexperiencegenerallygovernedgovernmenthiringhousingindividualjurisdictionleast
SHARED TOKENS (37): "agencies", "assets", "authorities", "authority", "businesses", "departments", "directly", "eligibility", "emergency", "employed", "equipment", "experience", "generally", "governed", "government", "hiring", "housing", "individual", "jurisdiction", "least".... | EXACT TITLE in security_services: "Security guard".
0.500
Inventory ↗ Q815410 EXACT TITLE
americanbusinessbusinessesdifferentfacilitygoalinformationinventorymanagementmaterialsnetworkoccurredprocessproductsprojectsrequiredsupplysystemsystemswork
SHARED TOKENS (20): "american", "business", "businesses", "different", "facility", "goal", "information", "inventory", "management", "materials", "network", "occurred", "process", "products", "projects", "required", "supply", "system", "systems", "work". | EXACT TITLE in security_services: "Inventory". | EXACT TITLE in procurement_public_spending: "Inventory".
0.500
accordingagencyallowsamericanassociationbecomebusinessbusinessescodecustomerevengovernmentalindependentlylocalmarketplacematerialsnearlyoperatingorganizationspolicy
SHARED TOKENS (25): "according", "agency", "allows", "american", "association", "become", "business", "businesses", "code", "customer", "even", "governmental", "independently", "local", "marketplace", "materials", "nearly", "operating", "organizations", "policy".... | EXACT TITLE in security_services: "Better Business Bureau".
0.500
americanbuildingcommunicationconstructioncontractorgeneralinformationlaborlargelegallylicensingmanagementprojectprojectsrequirementsresponsiblesmallstaffthroughoutvendors
SHARED TOKENS (21): "american", "building", "communication", "construction", "contractor", "general", "information", "labor", "large", "legally", "licensing", "management", "project", "projects", "requirements", "responsible", "small", "staff", "throughout", "vendors".... | EXACT TITLE in procurement_public_spending: "General contractor".
0.500
activityagenciesassetsauditauditingauditsboardbusinesscertifiedcomplianceconsultingcontrolcontrolsdatadepartmentsemployedestablishexaminationexecutivefederal
SHARED TOKENS (56): "activity", "agencies", "assets", "audit", "auditing", "audits", "board", "business", "certified", "compliance", "consulting", "control", "controls", "data", "departments", "employed", "establish", "examination", "executive", "federal".... | EXACT TITLE in procurement_public_spending: "Internal audit".
0.500
acquisitionanalysisassociatedbroadercapablecommercialcontractualcourtscoverdatadigitaldirectdiscoverydocumentselectronicevidenceexaminationexpandedfoundidentify
SHARED TOKENS (43): "acquisition", "analysis", "associated", "broader", "capable", "commercial", "contractual", "courts", "cover", "data", "digital", "direct", "discovery", "documents", "electronic", "evidence", "examination", "expanded", "found", "identify".... | EXACT TITLE in security_services: "Digital forensics".
0.500
analysisappliesbuildingbusinesscapitalcommercialconstructioncontrolcostdesignfirmsgoalincreasinglyinfrastructureknowledgemanagementmanagersownerplanningpractitioners
SHARED TOKENS (27): "analysis", "applies", "building", "business", "capital", "commercial", "construction", "control", "cost", "design", "firms", "goal", "increasingly", "infrastructure", "knowledge", "management", "managers", "owner", "planning", "practitioners".... | EXACT TITLE in procurement_public_spending: "Construction management".
0.500
boisecanyoncitiesestimatehomeidaholargerlargestmeridiannampanearlyoregonpopulationtotaltreasurevalley
SHARED TOKENS (16): "boise", "canyon", "cities", "estimate", "home", "idaho", "larger", "largest", "meridian", "nampa", "nearly", "oregon", "population", "total", "treasure", "valley". | EXACT TITLE in security_services: "Boise metropolitan area".
0.500
commercialconditionscontractcontroldocumententerpriseformsissueditselforderordersplacedplanningproductsrequiredresourcesystemtypes
SHARED TOKENS (18): "commercial", "conditions", "contract", "control", "document", "enterprise", "forms", "issued", "itself", "order", "orders", "placed", "planning", "products", "required", "resource", "system", "types". | EXACT TITLE in procurement_public_spending: "Purchase order".
0.500
agenciesallowsassociatedbusinessescapacitydistributioneconomicemployedemploymententryexistingfirmsimportantindustriallawmarketmetricsnumbersorderpower
SHARED TOKENS (28): "agencies", "allows", "associated", "businesses", "capacity", "distribution", "economic", "employed", "employment", "entry", "existing", "firms", "important", "industrial", "law", "market", "metrics", "numbers", "order", "power".... | EXACT TITLE in security_services: "Market concentration".
0.500
Architect ↗ Q42973 EXACT TITLE
academicarchitecturebuildingsconnectionconstructiondesigndevelopmenteducationexperienceinstitutionsjurisdictionlicenseplansprincipalprofessionprofessionalprovidepublicpurposerequirements
SHARED TOKENS (25): "academic", "architecture", "buildings", "connection", "construction", "design", "development", "education", "experience", "institutions", "jurisdiction", "license", "plans", "principal", "profession", "professional", "provide", "public", "purpose", "requirements".... | EXACT TITLE in security_services: "Architect". | EXACT TITLE in procurement_public_spending: "Architect".
0.500
accessagencieschangeconditionscreateddevelopmentdifferentdistincteconomicemergencyespeciallyfacilitiesfirmsgeneralgoalhealthindustrialinfrastructureinstitutionslaw
SHARED TOKENS (41): "access", "agencies", "change", "conditions", "created", "development", "different", "distinct", "economic", "emergency", "especially", "facilities", "firms", "general", "goal", "health", "industrial", "infrastructure", "institutions", "law".... | EXACT TITLE in security_services: "Infrastructure". | EXACT TITLE in procurement_public_spending: "Infrastructure".
0.500
Yelp ↗ Q2299611 EXACT TITLE
acquiredamericanannualapproximatelybecomebusinessbusinessescomdirectoryemployeesexpandedfundinginformationlatermobileonlineoperatespracticespublicpublished
SHARED TOKENS (27): "acquired", "american", "annual", "approximately", "become", "business", "businesses", "com", "directory", "employees", "expanded", "funding", "information", "later", "mobile", "online", "operates", "practices", "public", "published".... | EXACT TITLE in security_services: "Yelp".
0.500
Tort ↗ Q158970 EXACT TITLE
actcodecodescontractcontractuallawlegalliabilitymultipleobligationsprovisionsratherregardingrulesseparatesystems
SHARED TOKENS (16): "act", "code", "codes", "contract", "contractual", "law", "legal", "liability", "multiple", "obligations", "provisions", "rather", "regarding", "rules", "separate", "systems". | EXACT TITLE in procurement_public_spending: "Tort".
0.500
centralcoverdefenseeconomiceducationentityfeesfinancialgovernmenthealthcareindividualinfrastructureinstitutionsitselflawneedpolicyprogramprogramsrequires
SHARED TOKENS (22): "central", "cover", "defense", "economic", "education", "entity", "fees", "financial", "government", "healthcare", "individual", "infrastructure", "institutions", "itself", "law", "need", "policy", "program", "programs", "requires".... | EXACT TITLE in procurement_public_spending: "Government budget".
0.500
Accounting ↗ Q4116214 EXACT TITLE
accountinganalysisboardbusinessbusinessescostcouncileconomicfinancialfirmsformsfunctionsgenerallyhistoryinformationinternalmajormanagementoperationsorganizations
SHARED TOKENS (33): "accounting", "analysis", "board", "business", "businesses", "cost", "council", "economic", "financial", "firms", "forms", "functions", "generally", "history", "information", "internal", "major", "management", "operations", "organizations".... | EXACT TITLE in security_services: "Accounting". | EXACT TITLE in procurement_public_spending: "Accounting".
0.500
administrationagencyassetsauthorityaviationcertificationcommercialcontrolcreateddepartmentfederalgovernmentpersonnelregulatesstandardssurroundingtraffictransportationvehicles
SHARED TOKENS (19): "administration", "agency", "assets", "authority", "aviation", "certification", "commercial", "control", "created", "department", "federal", "government", "personnel", "regulates", "standards", "surrounding", "traffic", "transportation", "vehicles". | EXACT TITLE in procurement_public_spending: "Federal Aviation Administration".
0.500
Trespass ↗ Q3153728 EXACT TITLE
actactivityanotherassociatedcontactcourtsentrygenerallyidentifiedinvolvingjurisdictionlawlegallegallyliabilitymovementpropertyrequireseparateshowing
SHARED TOKENS (20): "act", "activity", "another", "associated", "contact", "courts", "entry", "generally", "identified", "involving", "jurisdiction", "law", "legal", "legally", "liability", "movement", "property", "require", "separate", "showing". | EXACT TITLE in security_services: "Trespass".
0.500
accountanalysisassessmentassociatedbecomebroaderchangecostcostsdocumentationexposureformsidentifiesidentifyingincreaseincreasinglyindividualindustrialintegrationinvolve
SHARED TOKENS (30): "account", "analysis", "assessment", "associated", "become", "broader", "change", "cost", "costs", "documentation", "exposure", "forms", "identifies", "identifying", "increase", "increasingly", "individual", "industrial", "integration", "involve".... | EXACT TITLE in security_services: "Risk assessment".
0.500
Airport ↗ Q1248784 EXACT TITLE
airportaviationbuildingschangecommercialcontrolemergencyexperiencefacilitiesfacilitygeneralimportantinfrastructurelargelargerleastlocalmaintainmajormaking
SHARED TOKENS (32): "airport", "aviation", "buildings", "change", "commercial", "control", "emergency", "experience", "facilities", "facility", "general", "important", "infrastructure", "large", "larger", "least", "local", "maintain", "major", "making".... | EXACT TITLE in security_services: "Airport". | EXACT TITLE in procurement_public_spending: "Airport".
0.500
agenciesagencyamericanbusinessesconditionscoordinationcurrentdatadepartmenteconomicfederalfieldgovernmentgovernmentslaborlocalmaintainmajormanagementneed
SHARED TOKENS (29): "agencies", "agency", "american", "businesses", "conditions", "coordination", "current", "data", "department", "economic", "federal", "field", "government", "governments", "labor", "local", "maintain", "major", "management", "need".... | EXACT TITLE in security_services: "Bureau of Labor Statistics".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordingaddressedanotherchaincostsdedicatedequipmentfacilityfieldfoodinformationlogisticsmanagementmaterialmaterialsmodelmovementneedsoperationalphysical
SHARED TOKENS (33): "according", "addressed", "another", "chain", "costs", "dedicated", "equipment", "facility", "field", "food", "information", "logistics", "management", "material", "materials", "model", "movement", "needs", "operational", "physical".... | EXACT TITLE in security_services: "Logistics". | EXACT TITLE in procurement_public_spending: "Logistics".
0.500
customerdemandfailurehealthinformationinfrastructuremaintainsmanagementmodelproviderresponsibilitysystemstechnicaltechnologytraditional
SHARED TOKENS (15): "customer", "demand", "failure", "health", "information", "infrastructure", "maintains", "management", "model", "provider", "responsibility", "systems", "technical", "technology", "traditional". | EXACT TITLE in security_services: "Managed services".
0.500
actcategoriesconditionscreatescustomerdefinesemployeeemployeeshealthmultiplenationaloccupationalphysicalprogramsproviderelationshiprisksafetyworkerworkers
SHARED TOKENS (20): "act", "categories", "conditions", "creates", "customer", "defines", "employee", "employees", "health", "multiple", "national", "occupational", "physical", "programs", "provide", "relationship", "risk", "safety", "worker", "workers". | EXACT TITLE in security_services: "Workplace violence".
0.500
Procurement ↗ Q829492 EXACT TITLE
accountaccountingacquisitionactivityadoptedagencybusinessconcerningcontractualdefineexposurefairgovernmentorganizationalpracticespriceprocessprocessesprocurementprovide
SHARED TOKENS (25): "account", "accounting", "acquisition", "activity", "adopted", "agency", "business", "concerning", "contractual", "define", "exposure", "fair", "government", "organizational", "practices", "price", "process", "processes", "procurement", "provide".... | EXACT TITLE in security_services: "Procurement". | EXACT TITLE in procurement_public_spending: "Procurement".
0.500
claimscompensationcontractcontractualcostcostscoveragecoveredcreateddedicateddefaultdefenseespeciallyevenexpresslygeneralgroupindividualinsurancelegal
SHARED TOKENS (31): "claims", "compensation", "contract", "contractual", "cost", "costs", "coverage", "covered", "created", "dedicated", "default", "defense", "especially", "even", "expressly", "general", "group", "individual", "insurance", "legal".... | EXACT TITLE in security_services: "Liability insurance".
0.500
buildingsconstructioncostsdesigneducationengineeringfacilitiesinfrastructuremanagementoperationspersonnelplanningproceduresprofessionalprojectprojectsqualityregardingrequirementsrequires
SHARED TOKENS (24): "buildings", "construction", "costs", "design", "education", "engineering", "facilities", "infrastructure", "management", "operations", "personnel", "planning", "procedures", "professional", "project", "projects", "quality", "regarding", "requirements", "requires".... | EXACT TITLE in procurement_public_spending: "Construction engineering".
0.500
assetsbroaderbuildingscapitalcategoryconstructiondirectlyeconomicemployedemploymentfacilitiesgovernmenthealthhospitalsinfrastructuremunicipalparksphysicalprivateprojects
SHARED TOKENS (25): "assets", "broader", "buildings", "capital", "category", "construction", "directly", "economic", "employed", "employment", "facilities", "government", "health", "hospitals", "infrastructure", "municipal", "parks", "physical", "private", "projects".... | EXACT TITLE in procurement_public_spending: "Public works".
0.500
associatedauditcreatedatadigitalevidencefoundgoalidentifyinginformationlegalmediapracticesreliablesimilarsystems
SHARED TOKENS (16): "associated", "audit", "create", "data", "digital", "evidence", "found", "goal", "identifying", "information", "legal", "media", "practices", "reliable", "similar", "systems". | EXACT TITLE in security_services: "Computer forensics".
0.500
academicanalysisarchitectureassociatedbecomecapabilitycompletecreatecyclesengineeringfieldfundinggeneralgenerategrowthhistoryintelligenceknowledgeleastmedia
SHARED TOKENS (36): "academic", "analysis", "architecture", "associated", "become", "capability", "complete", "create", "cycles", "engineering", "field", "funding", "general", "generate", "growth", "history", "intelligence", "knowledge", "least", "media".... | EXACT TITLE in procurement_public_spending: "Artificial intelligence".
0.500
accessassociationauthoritiescontractingcoordinationcostscoverdevelopmenteconomicfinancialformsfundedfundinggeneralgeographicgovernmenthistoricalinfrastructureintegratedinvolve
SHARED TOKENS (46): "access", "association", "authorities", "contracting", "coordination", "costs", "cover", "development", "economic", "financial", "forms", "funded", "funding", "general", "geographic", "government", "historical", "infrastructure", "integrated", "involve".... | EXACT TITLE in procurement_public_spending: "Public transport".
0.500
Fingerprint ↗ Q178022 EXACT TITLE
authoritiesdetailedemployedevidenceidentifyidentityimportantindividualinformationlowermakingmediarecordrecordsresearchstandards
SHARED TOKENS (16): "authorities", "detailed", "employed", "evidence", "identify", "identity", "important", "individual", "information", "lower", "making", "media", "record", "records", "research", "standards". | EXACT TITLE in security_services: "Fingerprint".
0.500
First aid ↗ Q133981 EXACT TITLE
associatedcoveremergencyequipmentextensiongenerallyguidancehealthindividualmandatorymedicalmoveprofessionalpublicrelationshiprequireresponseriskschoolssurrounding
SHARED TOKENS (21): "associated", "cover", "emergency", "equipment", "extension", "generally", "guidance", "health", "individual", "mandatory", "medical", "move", "professional", "public", "relationship", "require", "response", "risk", "schools", "surrounding".... | EXACT TITLE in security_services: "First aid".
0.500
associatedbeyonddatadevelopmentgraphincreasinglyknowledgemodelnetworksoperateprojectsresearchscopesystemstraditionaltype
SHARED TOKENS (16): "associated", "beyond", "data", "development", "graph", "increasingly", "knowledge", "model", "networks", "operate", "projects", "research", "scope", "systems", "traditional", "type". | EXACT TITLE in security_services: "Knowledge graph". | EXACT TITLE in procurement_public_spending: "Knowledge graph".
0.500
anotherbusinesscontractcontractorcostsexistinggeneralinvolveitselflowerneedobligationsprocurementprojectpublicreceiveriskrulessmallsupport
SHARED TOKENS (20): "another", "business", "contract", "contractor", "costs", "existing", "general", "involve", "itself", "lower", "need", "obligations", "procurement", "project", "public", "receive", "risk", "rules", "small", "support". | EXACT TITLE in procurement_public_spending: "Subcontractor".
0.500
accessallowsbuildingcommunicationcontrolentryevenhomeinterfacemonitoringpropertyprovidepurposerecordschoolsecuritysinglesmallsystemsystems
SHARED TOKENS (21): "access", "allows", "building", "communication", "control", "entry", "even", "home", "interface", "monitoring", "property", "provide", "purpose", "record", "school", "security", "single", "small", "system", "systems".... | EXACT TITLE in security_services: "Security alarm".
0.500
Contract ↗ Q93288 EXACT TITLE
adoptionagreementbusinesscategorycodecommercialcontractcontractingcontractscontractualdifferentdistinctdistinctiondocumentestablishingeventfieldframeworkgeneralgenerally
SHARED TOKENS (42): "adoption", "agreement", "business", "category", "code", "commercial", "contract", "contracting", "contracts", "contractual", "different", "distinct", "distinction", "document", "establishing", "event", "field", "framework", "general", "generally".... | EXACT TITLE in security_services: "Contract". | EXACT TITLE in procurement_public_spending: "Contract".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisconstructiondevelopmentdigitalengineeringequipmentestablishformsgovernmenthistoryimportantlawlegalmappingmapsownershipplanningprofessionprofessionalproperty
SHARED TOKENS (27): "analysis", "construction", "development", "digital", "engineering", "equipment", "establish", "forms", "government", "history", "important", "law", "legal", "mapping", "maps", "ownership", "planning", "profession", "professional", "property".... | EXACT TITLE in procurement_public_spending: "Surveying".
0.500
airportaviationboisecentercommercialdepartmentfacilityfieldfunctionsgeneralidahoincreasenationalofficeroperatesreceiverequiringsupportwestern
SHARED TOKENS (19): "airport", "aviation", "boise", "center", "commercial", "department", "facility", "field", "functions", "general", "idaho", "increase", "national", "officer", "operates", "receive", "requiring", "support", "western". | EXACT TITLE in procurement_public_spending: "Boise Airport".
0.500
accordingamendmentsassociatedbuildingcapabilitycodecodesconditionscontrolcurrentdesigndistributionexposurefunctionalinstallationlargelocalmodelnationaloperating
SHARED TOKENS (31): "according", "amendments", "associated", "building", "capability", "code", "codes", "conditions", "control", "current", "design", "distribution", "exposure", "functional", "installation", "large", "local", "model", "national", "operating".... | EXACT TITLE in security_services: "Electrical code".
0.500
accordinganalysisarchitecturebuildingclassificationcodescomplianceconstructiondesignfieldhealthinventorymanagementmemoryplanplanningpolicyprofessionqualitysolutions
SHARED TOKENS (22): "according", "analysis", "architecture", "building", "classification", "codes", "compliance", "construction", "design", "field", "health", "inventory", "management", "memory", "plan", "planning", "policy", "profession", "quality", "solutions".... | EXACT TITLE in procurement_public_spending: "Landscape architect".
0.500
Bridge ↗ Q12280 EXACT TITLE
bridgeconnectingconnectionconstructioncreatedesignengineeringformsidentityindustriallocalmajornetworkphysicalprocessesprovidepurposerequirementsstrongstructure
SHARED TOKENS (27): "bridge", "connecting", "connection", "construction", "create", "design", "engineering", "forms", "identity", "industrial", "local", "major", "network", "physical", "processes", "provide", "purpose", "requirements", "strong", "structure".... | EXACT TITLE in security_services: "Bridge". | EXACT TITLE in procurement_public_spending: "Bridge".
0.500
actagencycybersecuritydepartmentexpandedfederalgovernmentinformationinfrastructurenationalnetworkofficeprivateprogramsprotectingresponseresponsiblesecurityspecialtechnology
SHARED TOKENS (20): "act", "agency", "cybersecurity", "department", "expanded", "federal", "government", "information", "infrastructure", "national", "network", "office", "private", "programs", "protecting", "response", "responsible", "security", "special", "technology". | EXACT TITLE in security_services: "Cybersecurity and Infrastructure Security Agency".
0.500
businesscertificationcompensationcreatescustomereconomicentryevidencegeneralgovernmentgrowthhealthindividuallawlawsleastlicenselicensedlicensinglicensure
SHARED TOKENS (39): "business", "certification", "compensation", "creates", "customer", "economic", "entry", "evidence", "general", "government", "growth", "health", "individual", "law", "laws", "least", "license", "licensed", "licensing", "licensure".... | EXACT TITLE in security_services: "Occupational licensing". | EXACT TITLE in procurement_public_spending: "Occupational licensing".
0.500
associateddemandeconomicemergencyformsgenerallygovernmenthomehousinglocalmarketsnationalownershipresponsesupply
SHARED TOKENS (15): "associated", "demand", "economic", "emergency", "forms", "generally", "government", "home", "housing", "local", "markets", "national", "ownership", "response", "supply". | EXACT TITLE in procurement_public_spending: "Affordable housing".
0.500
accordingadministratorsauditsbecomebusinessesconnectioncustomerdatadetectionequipmentfacefeefunctionsguideidentifiedidentifyinginformationintelligencemanagementmarket
SHARED TOKENS (38): "according", "administrators", "audits", "become", "businesses", "connection", "customer", "data", "detection", "equipment", "face", "fee", "functions", "guide", "identified", "identifying", "information", "intelligence", "management", "market".... | EXACT TITLE in security_services: "Managed security service".
0.500
approvalsbusinesscreateddatadepartmentdistinctdocumentsfinancialimportantlegalliabilityorderordersprocessprocessingrequiredrequirementsresponsibilityreviewseeking
SHARED TOKENS (23): "approvals", "business", "created", "data", "department", "distinct", "documents", "financial", "important", "legal", "liability", "order", "orders", "process", "processing", "required", "requirements", "responsibility", "review", "seeking".... | EXACT TITLE in procurement_public_spending: "Accounts payable".
0.500
accordingaccountingactadministrationannualassetsauthoritiesauthorizationbusinessbusinessescertificationemployeesfairgovernmenthomeinspectionlargelicensemedicalnet
SHARED TOKENS (34): "according", "accounting", "act", "administration", "annual", "assets", "authorities", "authorization", "business", "businesses", "certification", "employees", "fair", "government", "home", "inspection", "large", "license", "medical", "net".... | EXACT TITLE in procurement_public_spending: "Small business".
0.500
becomecreatesdocumentsemployeeemployeesequipmentexistingexperiencefacefieldgrowthimportantindividualknowledgemanagementmaterialsperformanceprocessratherrequire
SHARED TOKENS (27): "become", "creates", "documents", "employee", "employees", "equipment", "existing", "experience", "face", "field", "growth", "important", "individual", "knowledge", "management", "materials", "performance", "process", "rather", "require".... | EXACT TITLE in security_services: "On-the-job training".
0.500
Intercom ↗ Q2603074 EXACT TITLE
buildingbuildingsconnectedconnectioncontrolcoverageevenfunctionsgenerallyindependentlyindividualinstallationlocalnetworkoutsidepropertypublicrequiresignalsmall
SHARED TOKENS (23): "building", "buildings", "connected", "connection", "control", "coverage", "even", "functions", "generally", "independently", "individual", "installation", "local", "network", "outside", "property", "public", "require", "signal", "small".... | EXACT TITLE in security_services: "Intercom".
0.500
actadministrationagencyconditionscostsdepartmenteducationemploymentfederalhealthlaborlawoccupationalsafetystandardsstatutestrainingworking
SHARED TOKENS (18): "act", "administration", "agency", "conditions", "costs", "department", "education", "employment", "federal", "health", "labor", "law", "occupational", "safety", "standards", "statutes", "training", "working". | EXACT TITLE in security_services: "Occupational Safety and Health Administration".
0.500
acquiredacquisitionadministrationagreementapplicantsassetsbuildingbusinesscapitalcommercialcontrolequipmentfinancialhomeindustrialinformationinspectionmaintainmaintenancemanagement
SHARED TOKENS (36): "acquired", "acquisition", "administration", "agreement", "applicants", "assets", "building", "business", "capital", "commercial", "control", "equipment", "financial", "home", "industrial", "information", "inspection", "maintain", "maintenance", "management".... | EXACT TITLE in security_services: "Property management".
0.500
adoptedassociationauthoritycodecommunicationcomplianceequipmentevenfederalgoverninginstallationjurisdictionlawlocalnationalpowerpracticesprivatepublishedregional
SHARED TOKENS (23): "adopted", "association", "authority", "code", "communication", "compliance", "equipment", "even", "federal", "governing", "installation", "jurisdiction", "law", "local", "national", "power", "practices", "private", "published", "regional".... | EXACT TITLE in security_services: "National Electrical Code".
0.500
awardbusinesscontractorscontractscustomerdocumentinformationneedsoriginalpriceprocessprocurementqualitysimilarsubmittedvendors
SHARED TOKENS (16): "award", "business", "contractors", "contracts", "customer", "document", "information", "needs", "original", "price", "process", "procurement", "quality", "similar", "submitted", "vendors". | EXACT TITLE in procurement_public_spending: "Request for proposal".
0.500
businessbuyerscompeteeventgovernmentincreasinglyobtainordinaryprivateprocessprocessesprocurementremainssimilartraditionaltype
SHARED TOKENS (16): "business", "buyers", "compete", "event", "government", "increasingly", "obtain", "ordinary", "private", "process", "processes", "procurement", "remains", "similar", "traditional", "type". | EXACT TITLE in procurement_public_spending: "Reverse auction".
0.500
accessagenciesbeyondcitiescontracteconomicgenerallygovernmentlocaloperateoperatesoperatorsorganizationsprivateprovidepublicservingsmallsubjectsupports
SHARED TOKENS (25): "access", "agencies", "beyond", "cities", "contract", "economic", "generally", "government", "local", "operate", "operates", "operators", "organizations", "private", "provide", "public", "serving", "small", "subject", "supports".... | EXACT TITLE in procurement_public_spending: "Paratransit".
0.500
americanarchitectureboisebuildingcapitalconstructioncostdepartmentdesigndistrictfederalgovernmenthomeidaholatermaterialsnationalstarwhose
SHARED TOKENS (19): "american", "architecture", "boise", "building", "capital", "construction", "cost", "department", "design", "district", "federal", "government", "home", "idaho", "later", "materials", "national", "star", "whose". | EXACT TITLE in security_services: "Idaho State Capitol".
0.500
accessauditingawarenessbusinesscontroldatadigitaldiscoveryelectronicenterprisegaingovernmentguidanceincreasinglyinformationinfrastructureinspectioninternalknowledgelaws
SHARED TOKENS (48): "access", "auditing", "awareness", "business", "control", "data", "digital", "discovery", "electronic", "enterprise", "gain", "government", "guidance", "increasingly", "information", "infrastructure", "inspection", "internal", "knowledge", "laws".... | EXACT TITLE in security_services: "Information security".
0.480
activityconnectededucationexposureoutsidepropertypublicrisksafetyschoolschoolssecuritystudentstraffic
SHARED TOKENS (14): "activity", "connected", "education", "exposure", "outside", "property", "public", "risk", "safety", "school", "schools", "security", "students", "traffic". | EXACT TITLE in security_services: "School security".
0.480
businesscertificationcertifieddisadvantagedenterpriseentitygovernmentleastprogramprovideresearchtechnologytransittransportation
SHARED TOKENS (14): "business", "certification", "certified", "disadvantaged", "enterprise", "entity", "government", "least", "program", "provide", "research", "technology", "transit", "transportation". | EXACT TITLE in procurement_public_spending: "Disadvantaged business enterprise".
0.480
americanapproximatelyboardemployeesgroupmajormediamovenationaloperatingoperationsregionservingtotal
SHARED TOKENS (14): "american", "approximately", "board", "employees", "group", "major", "media", "move", "national", "operating", "operations", "region", "serving", "total". | EXACT TITLE in procurement_public_spending: "Cox Enterprises".
0.460
associateddataelectronicenterpriseinformationinternalordersplanningprocessesprocurementresourcestrategicsystems
SHARED TOKENS (13): "associated", "data", "electronic", "enterprise", "information", "internal", "orders", "planning", "processes", "procurement", "resource", "strategic", "systems". | EXACT TITLE in procurement_public_spending: "E-procurement".
0.460
accesscontroldescribesdetectionequipmentfacilitiesmultiplepersonnelphysicalpropertyresourcessecuritysystems
SHARED TOKENS (13): "access", "control", "describes", "detection", "equipment", "facilities", "multiple", "personnel", "physical", "property", "resources", "security", "systems". | EXACT TITLE in security_services: "Physical security".
0.460
agenciescreatedgeneralidaholawlawslegallimitslocalofficeownershippropertyprovide
SHARED TOKENS (13): "agencies", "created", "general", "idaho", "law", "laws", "legal", "limits", "local", "office", "ownership", "property", "provide". | EXACT TITLE in security_services: "Idaho Attorney General".
0.460
accountingacquisitionbusinessconsolidatedconsolidationentityexistingfinancialgrouplargerlawssmallertransfer
SHARED TOKENS (13): "accounting", "acquisition", "business", "consolidated", "consolidation", "entity", "existing", "financial", "group", "larger", "laws", "smaller", "transfer". | EXACT TITLE in security_services: "Consolidation (business)". | EXACT TITLE in procurement_public_spending: "Consolidation (business)".
0.460
agencyboisecanyonidahooperatesproviderpublicregionalschoolservingtransittreasurevalley
SHARED TOKENS (13): "agency", "boise", "canyon", "idaho", "operates", "provider", "public", "regional", "school", "serving", "transit", "treasure", "valley". | EXACT TITLE in procurement_public_spending: "Valley Regional Transit".
0.440
agencydepartmentdevelopmenteconomicidahoinsurancelaborprocessesresponsibleselectedtechnologyworkforce
SHARED TOKENS (12): "agency", "department", "development", "economic", "idaho", "insurance", "labor", "processes", "responsible", "selected", "technology", "workforce". | EXACT TITLE in security_services: "Idaho Department of Labor".
0.440
actagenciesdatafairfederalfilesfinancialinformationprivateregulatesreportingreports
SHARED TOKENS (12): "act", "agencies", "data", "fair", "federal", "files", "financial", "information", "private", "regulates", "reporting", "reports". | EXACT TITLE in security_services: "Fair Credit Reporting Act".
0.440
amongappliescompletecomprehensiveeducationemploymenthistoryindividualprocesspurposerecordsecurity
SHARED TOKENS (12): "among", "applies", "complete", "comprehensive", "education", "employment", "history", "individual", "process", "purpose", "record", "security". | EXACT TITLE in security_services: "Background check".
0.440
Highway ↗ Q269949 EXACT TITLE
accessaccordingamericancodegovernmentlegalmaintainsmajorpatrolprivatepublicsystem
SHARED TOKENS (12): "access", "according", "american", "code", "government", "legal", "maintains", "major", "patrol", "private", "public", "system". | EXACT TITLE in procurement_public_spending: "Highway".
0.440
administrationagencydepartmentdivisionfederalmajorofficeprogramprogramspublicroletransportation
SHARED TOKENS (12): "administration", "agency", "department", "division", "federal", "major", "office", "program", "programs", "public", "role", "transportation". | EXACT TITLE in procurement_public_spending: "Federal Highway Administration".
0.420
agencycreateddepartmentfebruaryidaholawmunicipalorderorderspublicstatewide
SHARED TOKENS (11): "agency", "created", "department", "february", "idaho", "law", "municipal", "order", "orders", "public", "statewide". | EXACT TITLE in security_services: "Idaho State Police".
0.420
Carahsoft ↗ Q5037630 EXACT TITLE
americanconsultingfederalgovernmentsinformationinstitutionslocalprovidersoftwaresolutionstechnology
SHARED TOKENS (11): "american", "consulting", "federal", "governments", "information", "institutions", "local", "provider", "software", "solutions", "technology". | EXACT TITLE in procurement_public_spending: "Carahsoft".
0.400
associatedcybersecuritydetectionexpertisemonitororganizationsresponsesecuritytechnologytype
SHARED TOKENS (10): "associated", "cybersecurity", "detection", "expertise", "monitor", "organizations", "response", "security", "technology", "type". | EXACT TITLE in security_services: "Managed detection and response".
0.400
Invoice ↗ Q190581 EXACT TITLE
capitalcommercialcostsdocumentissuedlargepriceproductstransactionview
SHARED TOKENS (10): "capital", "commercial", "costs", "document", "issued", "large", "price", "products", "transaction", "view". | EXACT TITLE in procurement_public_spending: "Invoice".
0.400
anotherfacilityindustrialmunicipalprocessprocessespurposetypetypeswater
SHARED TOKENS (10): "another", "facility", "industrial", "municipal", "process", "processes", "purpose", "type", "types", "water". | EXACT TITLE in procurement_public_spending: "Wastewater treatment".
0.400
collegeeducationengineeringlegallymakingrequiredrequirestraditionaltrainingwork
SHARED TOKENS (10): "college", "education", "engineering", "legally", "making", "required", "requires", "traditional", "training", "work". | EXACT TITLE in security_services: "Locksmithing".
0.380
airportaviationcommunicationmaterialorderpropertyresourcessecuritystaff
SHARED TOKENS (9): "airport", "aviation", "communication", "material", "order", "property", "resources", "security", "staff". | EXACT TITLE in security_services: "Airport security".
0.380
agenciesdocumenteddocumentsgenerallygovernmentinformationjurisdictionpublicrecords
SHARED TOKENS (9): "agencies", "documented", "documents", "generally", "government", "information", "jurisdiction", "public", "records". | EXACT TITLE in security_services: "Public records". | EXACT TITLE in procurement_public_spending: "Public records".
0.380
Patrol ↗ Q11379765 EXACT TITLE
assignedgeographicgrouplawmonitorpatrolpersonnelsecuritytype
SHARED TOKENS (9): "assigned", "geographic", "group", "law", "monitor", "patrol", "personnel", "security", "type". | EXACT TITLE in security_services: "Patrol". | EXACT TITLE in procurement_public_spending: "Patrol".
0.360
collegeidahomedicalmeridianprivateschoolstudentsuniversity
SHARED TOKENS (8): "college", "idaho", "medical", "meridian", "private", "school", "students", "university". | EXACT TITLE in security_services: "Idaho College of Osteopathic Medicine".
0.360
businessdistributiongenerallyidahooperatesoregonpowerregulated
SHARED TOKENS (8): "business", "distribution", "generally", "idaho", "operates", "oregon", "power", "regulated". | EXACT TITLE in procurement_public_spending: "Idaho Power".
0.340
agenciescourtsdefensegovernmentinstitutionssupportsystem
SHARED TOKENS (7): "agencies", "courts", "defense", "government", "institutions", "support", "system". | EXACT TITLE in security_services: "Criminal justice".
0.340
assessmentidentifyingmanagementnetworksecuritysoftwareworking
SHARED TOKENS (7): "assessment", "identifying", "management", "network", "security", "software", "working". | EXACT TITLE in security_services: "Vulnerability management".
0.340
businessentityexpertiseprivatepublicsecuritytype
SHARED TOKENS (7): "business", "entity", "expertise", "private", "public", "security", "type". | EXACT TITLE in security_services: "Security company".
0.320
agencydistrictentitygovernmentidahoindependent
SHARED TOKENS (6): "agency", "district", "entity", "government", "idaho", "independent". | EXACT TITLE in procurement_public_spending: "Ada County Highway District".
0.320
actdatageneralinformationpagesecurity
SHARED TOKENS (6): "act", "data", "general", "information", "page", "security". | EXACT TITLE in security_services: "Data protection".
0.300
accountingamericananotherauditingcertifiedcollegedemandeducationevenexaminationexperiencefinancialfirmsgenerallygrowthlaborlawslegallylicenselicensing
SHARED TOKENS (34): "accounting", "american", "another", "auditing", "certified", "college", "demand", "education", "even", "examination", "experience", "financial", "firms", "generally", "growth", "labor", "laws", "legally", "license", "licensing"....
0.300
amongbuildingbusinessescapitalchaincontrolcostsdemanddepartmentdesigndistributionexistingfunctionsinformationinfrastructureintegratedintegrationinternalinventorylogistics
SHARED TOKENS (45): "among", "building", "businesses", "capital", "chain", "control", "costs", "demand", "department", "design", "distribution", "existing", "functions", "information", "infrastructure", "integrated", "integration", "internal", "inventory", "logistics"....
0.300
analysisanalyticsbusinesscompliancecontractcontrolscostsdatadevelopmentinventorymanagementmonitoringplanningprocessprocurementpurpose
SHARED TOKENS (16): "analysis", "analytics", "business", "compliance", "contract", "controls", "costs", "data", "development", "inventory", "management", "monitoring", "planning", "process", "procurement", "purpose".
0.300
accordingannualassociationdesigndevelopmentgrowthindependentlyintegratedlawlicensedmakingmarketmaterialmultiplenetworkspowerproducingprojectedrecordresearch
SHARED TOKENS (22): "according", "annual", "association", "design", "development", "growth", "independently", "integrated", "law", "licensed", "making", "market", "material", "multiple", "networks", "power", "producing", "projected", "record", "research"....
0.300
actagenciescontrolcouncilcybersecuritydefensedepartmentdepartmentsemployeesexecutivefederalhealthinvolveoperationspolicypublicresponseresponsibilitiesresponsiblesecurity
SHARED TOKENS (21): "act", "agencies", "control", "council", "cybersecurity", "defense", "department", "departments", "employees", "executive", "federal", "health", "involve", "operations", "policy", "public", "response", "responsibilities", "responsible", "security"....
0.300
administrationbusinessdataeconomiceducationemploymenthealthintelligenceinvolvelawlegalmediaprocessprocessingpublicrequiringsoftwaresourcessystemstechnical
SHARED TOKENS (21): "administration", "business", "data", "economic", "education", "employment", "health", "intelligence", "involve", "law", "legal", "media", "process", "processing", "public", "requiring", "software", "sources", "systems", "technical"....
0.300
Open data ↗ Q309901 KW CROSS HIGH
accesscapablecreateddataeducationespeciallyexplicitfairformsgenerallygovgovernmentgrowthimportantinstitutionsitselfknowledgelicenselicensedmovement
SHARED TOKENS (25): "access", "capable", "created", "data", "education", "especially", "explicit", "fair", "forms", "generally", "gov", "government", "growth", "important", "institutions", "itself", "knowledge", "license", "licensed", "movement"....
0.300
agenciesapplicationbusinesscapabilityclassificationconsolidatedcontingentcontractdistributionfinancialinstitutionslabormanagementmechanismorderoutsideprocessesprogramsreportingrisk
SHARED TOKENS (26): "agencies", "application", "business", "capability", "classification", "consolidated", "contingent", "contract", "distribution", "financial", "institutions", "labor", "management", "mechanism", "order", "outside", "processes", "programs", "reporting", "risk"....
0.300
Labour law ↗ Q628967 KW CROSS HIGH
administrationagenciescodeconditionscontractcontractorsemployeeemployeesemploymentgovernmentgovernmentsindividualjudiciallaborlawlawsrelationshipstandardstechnicalwork
SHARED TOKENS (21): "administration", "agencies", "code", "conditions", "contract", "contractors", "employee", "employees", "employment", "government", "governments", "individual", "judicial", "labor", "law", "laws", "relationship", "standards", "technical", "work"....
0.300
Temporary work ↗ Q667944 KW CROSS HIGH
accountingagencyanotherconsultantscontractcontractscontractualdevelopmentdifferentemployeeemployeesemploymentengineeringhealthincreasinglyindividualinsurancelaborlimitedmarket
SHARED TOKENS (38): "accounting", "agency", "another", "consultants", "contract", "contracts", "contractual", "development", "different", "employee", "employees", "employment", "engineering", "health", "increasingly", "individual", "insurance", "labor", "limited", "market"....
0.300
architectureautomaticchangecontrolcontrolledcoordinationdesigndifferentdistinctfoundhealthcareindustrialinfrastructureintegratedmedicalmonitoringmultipleoperatephysicalprocess
SHARED TOKENS (27): "architecture", "automatic", "change", "control", "controlled", "coordination", "design", "different", "distinct", "found", "healthcare", "industrial", "infrastructure", "integrated", "medical", "monitoring", "multiple", "operate", "physical", "process"....
0.300
accountingapplicationassetsbusinesscommercialcommunicationconnectconnectedconnectingconsequentlycontrolcreatesdatadescribesdevelopmentengineeringespeciallyfieldgovernmentgrowth
SHARED TOKENS (54): "accounting", "application", "assets", "business", "commercial", "communication", "connect", "connected", "connecting", "consequently", "control", "creates", "data", "describes", "development", "engineering", "especially", "field", "government", "growth"....
0.300
chainentryfacilitiesinformationlogisticsmanagementnotificationorganizationalperformancepracticesrequirementsrequiresscreeningsecuritysupplysystemstraditionaltransittransportationvalue
SHARED TOKENS (20): "chain", "entry", "facilities", "information", "logistics", "management", "notification", "organizational", "performance", "practices", "requirements", "requires", "screening", "security", "supply", "systems", "traditional", "transit", "transportation", "value".
0.300
applicationbuildingbusinesscommunicationdesigndevelopmentdifferentdiffersemergencyeventholdidentifyingknowledgelogisticsmanagementmarketorderorganizationspermitsplanning
SHARED TOKENS (34): "application", "building", "business", "communication", "design", "development", "different", "differs", "emergency", "event", "hold", "identifying", "knowledge", "logistics", "management", "market", "order", "organizations", "permits", "planning"....
0.300
accordingcontingentcontractcontractorsemployeesemploymentindependentlaborlimitedmultiplenearlyrelationshipsecuritystaffingtemporarytypeworkworkersworkforce
SHARED TOKENS (19): "according", "contingent", "contract", "contractors", "employees", "employment", "independent", "labor", "limited", "multiple", "nearly", "relationship", "security", "staffing", "temporary", "type", "work", "workers", "workforce".
0.300
administrationamendmentsamonganalysisbusinesschangescommercialcomplianceconditionsconstructionconsultantscontractcontractsdetailedemployeesexposurefinancialfoundimprovementslarger
SHARED TOKENS (49): "administration", "amendments", "among", "analysis", "business", "changes", "commercial", "compliance", "conditions", "construction", "consultants", "contract", "contracts", "detailed", "employees", "exposure", "financial", "found", "improvements", "larger"....
0.300
accountingactauditingbusinesscompliancecontrolcontrolsfinancialimportantimprovementsinternallawsmanagementoperationalorganizationalphysicalpoliciespracticesproceduresprocess
SHARED TOKENS (31): "accounting", "act", "auditing", "business", "compliance", "control", "controls", "financial", "important", "improvements", "internal", "laws", "management", "operational", "organizational", "physical", "policies", "practices", "procedures", "process"....
0.300
accessadoptedagenciesallowsamongassignedauthorityauthorizationbusinessescontrolcontrolledcontrolsdataexplainsgovernmentinformationinstitutionsmonitornetworknetworks
SHARED TOKENS (35): "access", "adopted", "agencies", "allows", "among", "assigned", "authority", "authorization", "businesses", "control", "controlled", "controls", "data", "explains", "government", "information", "institutions", "monitor", "network", "networks"....
0.300
centralcontroldetectiondiffersdigitaldirectlyequipmentespeciallyeveneventgeneratedgrowthindustrialinternallimitedmonitormonitoringoperateperformanceprocess
SHARED TOKENS (31): "central", "control", "detection", "differs", "digital", "directly", "equipment", "especially", "even", "event", "generated", "growth", "industrial", "internal", "limited", "monitor", "monitoring", "operate", "performance", "process"....
0.300
applicationcategorycloudcostdevelopmentdistinguishfeefeesinfrastructurelicensemodeloperatingownershipphysicalplatformpossessionpracticesproductsproviderrequired
SHARED TOKENS (25): "application", "category", "cloud", "cost", "development", "distinguish", "fee", "fees", "infrastructure", "license", "model", "operating", "ownership", "physical", "platform", "possession", "practices", "products", "provider", "required"....
0.300
anotherbecomechainconsolidationdescribeddifferentdirectlyintegratedintegrationlargemakingmanagementmarketmarketplaceneedownershipproduceproductsrathersupplies
SHARED TOKENS (21): "another", "become", "chain", "consolidation", "described", "different", "directly", "integrated", "integration", "large", "making", "management", "market", "marketplace", "need", "ownership", "produce", "products", "rather", "supplies"....
0.300
activityadministrationagenciesanotherchangescontrolcourtscreateddivisioneconomiceducationexecutiveexpandedgenerallygoverninggovernmentincreaseitselfjudiciallaw
SHARED TOKENS (32): "activity", "administration", "agencies", "another", "changes", "control", "courts", "created", "division", "economic", "education", "executive", "expanded", "generally", "governing", "government", "increase", "itself", "judicial", "law"....
0.300
compliancecontractcontractscontractualcostfinancialimprovementslawlegalliabilitylifecyclemanagementobligationsoperationalorganizationalprocessesrequirementsrisksoftwarethroughout
SHARED TOKENS (20): "compliance", "contract", "contracts", "contractual", "cost", "financial", "improvements", "law", "legal", "liability", "lifecycle", "management", "obligations", "operational", "organizational", "processes", "requirements", "risk", "software", "throughout".
0.300
accountingacquisitionbusinesscapitalchangescreatecurrentdirectlydistributioneducationemergencyemploymententryestablishesfeesfirmsgovernmentgovernmentshealthcareimportant
SHARED TOKENS (38): "accounting", "acquisition", "business", "capital", "changes", "create", "current", "directly", "distribution", "education", "emergency", "employment", "entry", "establishes", "fees", "firms", "government", "governments", "healthcare", "important"....
0.300
analysisanotherbecomechangeconsultantsconsultingcontingentdescriptiondevelopmenteconomicexpertiseexposurefirmsfunctionsgeneralgeographicguideimprovementinternallegal
SHARED TOKENS (40): "analysis", "another", "become", "change", "consultants", "consulting", "contingent", "description", "development", "economic", "expertise", "exposure", "firms", "functions", "general", "geographic", "guide", "improvement", "internal", "legal"....
0.300
OpenGov ↗ Q17084399 EXACT TITLE
februarygovernmentownerprivatetechnology
SHARED TOKENS (5): "february", "government", "owner", "private", "technology". | EXACT TITLE in procurement_public_spending: "OpenGov".
0.300
buildingcertifiedconstructioncontractingcontractorcontractorscontractualcostsfinancialknowledgelawprofessionprofessionalprojectprojectedprojectsqualifiedresponsiblesidetitle
SHARED TOKENS (21): "building", "certified", "construction", "contracting", "contractor", "contractors", "contractual", "costs", "financial", "knowledge", "law", "profession", "professional", "project", "projected", "projects", "qualified", "responsible", "side", "title"....
0.300
accessconnectedcontroldatadigitalecosystememployeesenterpriseframeworkgaingrantsidentifyidentifyingidentitymanagementneednetworkplatformspoliciesproducts
SHARED TOKENS (26): "access", "connected", "control", "data", "digital", "ecosystem", "employees", "enterprise", "framework", "gain", "grants", "identify", "identifying", "identity", "management", "need", "network", "platforms", "policies", "products"....
0.300
accessamericanamongbusinessescapacitychangescitiescompetedevelopmentearliereconomiceducationemployeesevaluatedformsgovernmenthistoryhomehuman-resourcesincrease
SHARED TOKENS (49): "access", "american", "among", "businesses", "capacity", "changes", "cities", "compete", "development", "earlier", "economic", "education", "employees", "evaluated", "forms", "government", "history", "home", "human-resources", "increase"....
0.300
Data quality ↗ Q1757694 KW CROSS HIGH
becomesbusinessesdatadiscussingevengenerallygovernanceinformationinternalmakingoperationsorderplanningpurposequalityrepresentsrequiredsourcesstandards
SHARED TOKENS (19): "becomes", "businesses", "data", "discussing", "even", "generally", "governance", "information", "internal", "making", "operations", "order", "planning", "purpose", "quality", "represents", "required", "sources", "standards".
0.300
accessanotherassociatedcategoriescostcostsdifferenteconomicexperiencefinancialidentitymanagementproductsproviderresourcesstrategicvalue
SHARED TOKENS (17): "access", "another", "associated", "categories", "cost", "costs", "different", "economic", "experience", "financial", "identity", "management", "products", "provider", "resources", "strategic", "value".
0.300
Privacy law ↗ Q1247836 KW CROSS HIGH
actaddressescategorycompliancecontactdatadifferentdigitalfinancialgeneralgovernmentsgovernshealthhomeindividualinformationlawlawsmedicalnames
SHARED TOKENS (29): "act", "addresses", "category", "compliance", "contact", "data", "different", "digital", "financial", "general", "governments", "governs", "health", "home", "individual", "information", "law", "laws", "medical", "names"....
0.300
accordingaccountagencyamericanbusinessbusinessescentralcertificationcertifiedcontrolleddevelopmententerprisefederalfirmsleastnearlyreview
SHARED TOKENS (17): "according", "account", "agency", "american", "business", "businesses", "central", "certification", "certified", "controlled", "development", "enterprise", "federal", "firms", "least", "nearly", "review".
0.300
accessadoptedcenterdatadifferentdigitalenterpriseespeciallyimportantinformationpoliciespracticesproblemspurposeresourcessecuritysolutionssystem
SHARED TOKENS (18): "access", "adopted", "center", "data", "different", "digital", "enterprise", "especially", "important", "information", "policies", "practices", "problems", "purpose", "resources", "security", "solutions", "system".
0.300
americanassociationcategoriescertificationcertifiedclassconstructioncovercreatedivisionengineeringexpertiselimitednationalprocedureprocessprofessionalprogramqualifiedresearch
SHARED TOKENS (25): "american", "association", "categories", "certification", "certified", "class", "construction", "cover", "create", "division", "engineering", "expertise", "limited", "national", "procedure", "process", "professional", "program", "qualified", "research"....
0.300
agenciesawarenessdedicateddifferentemergencyhealthinsurancemedicalnumbersorganizationsprogramspublicreportresponsibilitiessafetysecuritysolelytypesvehicles
SHARED TOKENS (19): "agencies", "awareness", "dedicated", "different", "emergency", "health", "insurance", "medical", "numbers", "organizations", "programs", "public", "report", "responsibilities", "safety", "security", "solely", "types", "vehicles".
0.300
activityemergencyfederalgenerallygovernmentinstitutionsjurisdictionlawmedicalorganizationsprivatepropertypublicregionalsafetysecuritystructure
SHARED TOKENS (17): "activity", "emergency", "federal", "generally", "government", "institutions", "jurisdiction", "law", "medical", "organizations", "private", "property", "public", "regional", "safety", "security", "structure".
0.300
accessaddressesallowsapplicationarchitecturecommunicationconnectedcreateddatadigitalelectronicengineeringfoundgroupidentifiedidentifyinformationlimitedmedianetwork
SHARED TOKENS (28): "access", "addresses", "allows", "application", "architecture", "communication", "connected", "created", "data", "digital", "electronic", "engineering", "found", "group", "identified", "identify", "information", "limited", "media", "network"....
0.300
administrationagencyairportapproximatelyauthorityconnectingcreateddatadepartmentdetectionemployedfacilitiesfederalgovernmentlawlocalnetworkspartnerspersonnelpolicies
SHARED TOKENS (33): "administration", "agency", "airport", "approximately", "authority", "connecting", "created", "data", "department", "detection", "employed", "facilities", "federal", "government", "law", "local", "networks", "partners", "personnel", "policies"....
0.300
agenciesagencyamericanauthoritybuildingcategoriescentralcitiescoordinationdepartmentfederalfieldfunctionsgeneralgenerallygovernmentintelligencejurisdictionlawlegal
SHARED TOKENS (37): "agencies", "agency", "american", "authority", "building", "categories", "central", "cities", "coordination", "department", "federal", "field", "functions", "general", "generally", "government", "intelligence", "jurisdiction", "law", "legal"....
0.300
Cost estimate ↗ Q795053 KW CROSS HIGH
americanassociationcostcostsdatadefinesdocumentedengineeringestimateestimatingfebruarygovernmentindividualofficeprocessprogramprojectreliablescopesingle
SHARED TOKENS (22): "american", "association", "cost", "costs", "data", "defines", "documented", "engineering", "estimate", "estimating", "february", "government", "individual", "office", "process", "program", "project", "reliable", "scope", "single"....
0.300
accessaccountingbusinesscapacitycategorycommercialcoredatadepartmentsdevelopmentdiffersenterpriseexistingfinancefunctionsgeneralincreasinglyinformationintegratedlarge
SHARED TOKENS (47): "access", "accounting", "business", "capacity", "category", "commercial", "core", "data", "departments", "development", "differs", "enterprise", "existing", "finance", "functions", "general", "increasingly", "information", "integrated", "large"....
0.300
actactivityagenciesagencyagreementanotherassetsauthoritybusinessclaimscontractcontroldigitalemployeeenterentityevenexistingexpresslygoal
SHARED TOKENS (47): "act", "activity", "agencies", "agency", "agreement", "another", "assets", "authority", "business", "claims", "contract", "control", "digital", "employee", "enter", "entity", "even", "existing", "expressly", "goal"....
0.300
administrationassetsbuildingcapitalcontractcontractingcostcostsdevelopmentemployedevidencefinancialfundinggovernmentgovernmentshospitalsinfrastructureinstitutionslowermultiple
SHARED TOKENS (38): "administration", "assets", "building", "capital", "contract", "contracting", "cost", "costs", "development", "employed", "evidence", "financial", "funding", "government", "governments", "hospitals", "infrastructure", "institutions", "lower", "multiple"....
0.300
authoritycourtsdescribedexecutivegovernmentgovernmentaljudiciallawspowerprocedureprocessreviewscopestatutestrongsubject
SHARED TOKENS (16): "authority", "courts", "described", "executive", "government", "governmental", "judicial", "laws", "power", "procedure", "process", "review", "scope", "statute", "strong", "subject".
0.300
agencyauthorizedawarddirecteconomicentityfederalfinancialfundinggeneralgovernmentgrantgrantsissuedlawlocalorganizationsoutsideprivateprograms
SHARED TOKENS (26): "agency", "authorized", "award", "direct", "economic", "entity", "federal", "financial", "funding", "general", "government", "grant", "grants", "issued", "law", "local", "organizations", "outside", "private", "programs"....
0.300
agenciesallowsamonganotherawardbusinessbusinessescategoriescontractcontractorsdetaileddifferentdocumentationdocumentsentityfairfilesfoundgenerallygenerate
SHARED TOKENS (44): "agencies", "allows", "among", "another", "award", "business", "businesses", "categories", "contract", "contractors", "detailed", "different", "documentation", "documents", "entity", "fair", "files", "found", "generally", "generate"....
0.300
CARES Act ↗ Q88815228 KW CROSS HIGH
actadministrationbusinessbusinessesclasscompensationconsolidateddevelopmentdirecteconomicfundinggenerallygovernmentshealthhistoryindividuallargerlargestlaterlaw
SHARED TOKENS (36): "act", "administration", "business", "businesses", "class", "compensation", "consolidated", "development", "direct", "economic", "funding", "generally", "governments", "health", "history", "individual", "larger", "largest", "later", "law"....
0.300
addressedanotherchangecostscreatecustomerentryinformationmakesmarketmoveproductsstandardssystemsvendor
SHARED TOKENS (15): "addressed", "another", "change", "costs", "create", "customer", "entry", "information", "makes", "market", "move", "products", "standards", "systems", "vendor".
0.300
departmentdevelopmentdiffersfederalgoalgovernmentsgrantgrantshousinginfrastructurelocalprogramprogramssubjecturban
SHARED TOKENS (15): "department", "development", "differs", "federal", "goal", "governments", "grant", "grants", "housing", "infrastructure", "local", "program", "programs", "subject", "urban".
0.300
chaincontractcostdevelopmentdifferencesdistinctfirmsimprovementincreaseindividualinfrastructurelabormanagementmarketneedsoperationsordersplacedplanningprice
SHARED TOKENS (30): "chain", "contract", "cost", "development", "differences", "distinct", "firms", "improvement", "increase", "individual", "infrastructure", "labor", "management", "market", "needs", "operations", "orders", "placed", "planning", "price"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyexecutivefederalgovernmenthomehousinglawspoliciesprogramreportsurban
SHARED TOKENS (16): "administers", "agency", "department", "departments", "development", "directly", "executive", "federal", "government", "home", "housing", "laws", "policies", "program", "reports", "urban".
0.300
allowsanotherdirectlyfoundhealthhospitalsneedneedsotherwisepatientrequiringsecuritysettingssignalstaffsystemstype
SHARED TOKENS (17): "allows", "another", "directly", "found", "health", "hospitals", "need", "needs", "otherwise", "patient", "requiring", "security", "settings", "signal", "staff", "systems", "type".
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
agencyanothercompensationcontractcontractscontractualdifferentexpresslyholdinsuranceitselflawlimitedmedicalownerprincipalrelationshiprelevantresponsibilities
SHARED TOKENS (19): "agency", "another", "compensation", "contract", "contracts", "contractual", "different", "expressly", "hold", "insurance", "itself", "law", "limited", "medical", "owner", "principal", "relationship", "relevant", "responsibilities".
0.300
agenciesamongannualanotherauditsauthoritiesbecomecentercentralcertificationcertifiedcompetecompliancecontactcustomerdatadetectiondifferentdigitaldirect
SHARED TOKENS (58): "agencies", "among", "annual", "another", "audits", "authorities", "become", "center", "central", "certification", "certified", "compete", "compliance", "contact", "customer", "data", "detection", "different", "digital", "direct"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
capacitychangecontrolinformationlawslocalnationalneedordersignalsignalssystemsystemstechnologytrafficusers
SHARED TOKENS (16): "capacity", "change", "control", "information", "laws", "local", "national", "need", "order", "signal", "signals", "system", "systems", "technology", "traffic", "users".
0.300
agenciesbuildingbusinesscategoriesdocumentdocumentsfilesgenerallygovernmentinformationlegalonlinepdfprocessprovidepubliclypurposereceiveresponsestrategy
SHARED TOKENS (23): "agencies", "building", "business", "categories", "document", "documents", "files", "generally", "government", "information", "legal", "online", "pdf", "process", "provide", "publicly", "purpose", "receive", "response", "strategy"....
0.300
actactivityawardbeyondbusinesscontractcontractorscontractscostsdifferenteconomicelectronicformsgovernmentguidanceincreaseincreasinglyinvolveissuedlegally
SHARED TOKENS (42): "act", "activity", "award", "beyond", "business", "contract", "contractors", "contracts", "costs", "different", "economic", "electronic", "forms", "government", "guidance", "increase", "increasingly", "involve", "issued", "legally"....
0.300
accordingactivityanalysisbecomesdefinedesigndocumentationengineeringestimategeneralgovernmentlegallicenselicensedlicensurelocalmaintenanceplanspractitionersprocess
SHARED TOKENS (36): "according", "activity", "analysis", "becomes", "define", "design", "documentation", "engineering", "estimate", "general", "government", "legal", "license", "licensed", "licensure", "local", "maintenance", "plans", "practitioners", "process"....
0.300
academiccollegedifferenteducationgenerallyinstitutionsmaintainpolicyprogramsschoolsimilarstudentstransfertypeuniversityworkforce
SHARED TOKENS (16): "academic", "college", "different", "education", "generally", "institutions", "maintain", "policy", "programs", "school", "similar", "students", "transfer", "type", "university", "workforce".
0.300
accountingboardbusinesscentraldedicatedfinancialframeworkfundedgovernmentgovernmentallegalmanagementmandatoryorganizationsprocesspublicpubliclyreportingresourcesspecialized
SHARED TOKENS (21): "accounting", "board", "business", "central", "dedicated", "financial", "framework", "funded", "government", "governmental", "legal", "management", "mandatory", "organizations", "process", "public", "publicly", "reporting", "resources", "specialized"....
0.300
accesscannotcommunicationcompetecontrolcostsdifferentdiscussedentityespeciallyfederalformsgovernmentinfrastructurelargelocalmaintainsmarketmultipleoperates
SHARED TOKENS (33): "access", "cannot", "communication", "compete", "control", "costs", "different", "discussed", "entity", "especially", "federal", "forms", "government", "infrastructure", "large", "local", "maintains", "market", "multiple", "operates"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
adoptedauthoritybecomesbuildingbuildingscodecodescomplianceconstructioncontrolcouncildepartmentsdesigndistrictfacilitygeneralgenerallygovernmentalhealthinsurance
SHARED TOKENS (41): "adopted", "authority", "becomes", "building", "buildings", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "district", "facility", "general", "generally", "governmental", "health", "insurance"....
0.300
agenciesagencyanotherauthoritycampusescontrolleddepartmentsemployedentityevenfacilitiesgenerallygovernmentgovernmentalhospitalsjurisdictionlawlawslicensedofficer
SHARED TOKENS (33): "agencies", "agency", "another", "authority", "campuses", "controlled", "departments", "employed", "entity", "even", "facilities", "generally", "government", "governmental", "hospitals", "jurisdiction", "law", "laws", "licensed", "officer"....
0.300
actadministrationagenciesamericanappearcurrentdepartmentdepartmentsexecutivefederalfinancefinancialgovernmentinstitutionsinternallicenseslimitedmajormattersnational
SHARED TOKENS (27): "act", "administration", "agencies", "american", "appear", "current", "department", "departments", "executive", "federal", "finance", "financial", "government", "institutions", "internal", "licenses", "limited", "major", "matters", "national"....
0.300
Use of force ↗ Q971119 KW CROSS HIGH
accordinganothercodecomplianceemployedeventfoundjurisdictionlawlegalmultipleneedsorderpersonnelphysicalpolicingpurposerequiredsecuritysubject
SHARED TOKENS (20): "according", "another", "code", "compliance", "employed", "event", "found", "jurisdiction", "law", "legal", "multiple", "needs", "order", "personnel", "physical", "policing", "purpose", "required", "security", "subject".
0.300
applicantsassociatedconcerningearlierevidencefoundincreaseindividualjurisdictionlawsnationalpermitspublicregardingrequirerequiredrequirementsreviewtotaltypes
SHARED TOKENS (20): "applicants", "associated", "concerning", "earlier", "evidence", "found", "increase", "individual", "jurisdiction", "laws", "national", "permits", "public", "regarding", "require", "required", "requirements", "review", "total", "types".
0.300
agenciesbuildingsconstructiondepartmentsdesigndistinguishengineeringfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicstructuralsystems
SHARED TOKENS (20): "agencies", "buildings", "construction", "departments", "design", "distinguish", "engineering", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public", "structural", "systems".
0.300
Bodyguard ↗ Q851436 KW CROSS HIGH
agencyassignedexecutivegovernmentgroupimportantindividuallawlowerofficerpersonnelprofessionalspublicrisksecuritysingletrainingtype
SHARED TOKENS (18): "agency", "assigned", "executive", "government", "group", "important", "individual", "law", "lower", "officer", "personnel", "professionals", "public", "risk", "security", "single", "training", "type".
0.300
accessautomaticbuildingbuildingscommercialcommunicationcontrolcontrolledcostsdemanddesignevenhomeindustrialinstitutionallocalmaintenancemanagementmonitormonitoring
SHARED TOKENS (35): "access", "automatic", "building", "buildings", "commercial", "communication", "control", "controlled", "costs", "demand", "design", "even", "home", "industrial", "institutional", "local", "maintenance", "management", "monitor", "monitoring"....
0.300
administersadministrationbuildingconditionscoverdepartmentdepartmentsdirectlyeconomicemploymentexecutivefederalgoverninggovernmenthealthhistoryhourlaborlawsoccupational
SHARED TOKENS (29): "administers", "administration", "building", "conditions", "cover", "department", "departments", "directly", "economic", "employment", "executive", "federal", "governing", "government", "health", "history", "hour", "labor", "laws", "occupational"....
0.300
agenciesassessmentbusinessescomprehensivedesignfacilitiesgenerallygovernmentmovemovementneedsplanningpoliciesprivateprocesspublicsystemtransportation
SHARED TOKENS (18): "agencies", "assessment", "businesses", "comprehensive", "design", "facilities", "generally", "government", "move", "movement", "needs", "planning", "policies", "private", "process", "public", "system", "transportation".
0.300
addressescodecompletedatadifferentdiffersentryexistingidentifyingincompleteinformationinvolvenumbersprocessprocessingqualityratherrecordssimilarsolutions
SHARED TOKENS (23): "addresses", "code", "complete", "data", "different", "differs", "entry", "existing", "identifying", "incomplete", "information", "involve", "numbers", "process", "processing", "quality", "rather", "records", "similar", "solutions"....
0.300
Public finance ↗ Q274490 KW CROSS HIGH
academicallocationamericanamongauthoritiescentraldirectdistributioneconomicfailurefieldfinanceframeworkgovernmentgovernmentalgovernmentsmarketpolicypublicresearch
SHARED TOKENS (24): "academic", "allocation", "american", "among", "authorities", "central", "direct", "distribution", "economic", "failure", "field", "finance", "framework", "government", "governmental", "governments", "market", "policy", "public", "research"....
0.300
approximatelychangescompleteconstructioncontactcontractcontractingcontractorcontractscostsdesignentityformshistoricalimportantindependentlylegalownerprocedureprocurement
SHARED TOKENS (33): "approximately", "changes", "complete", "construction", "contact", "contract", "contracting", "contractor", "contracts", "costs", "design", "entity", "forms", "historical", "important", "independently", "legal", "owner", "procedure", "procurement"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
capitalcommercialcostcostsdifferentinstitutionallargelargerpersonnelpolicypublicqualityresponsibilityseparatesmallsupplysurroundingsystemsystemsurban
SHARED TOKENS (22): "capital", "commercial", "cost", "costs", "different", "institutional", "large", "larger", "personnel", "policy", "public", "quality", "responsibility", "separate", "small", "supply", "surrounding", "system", "systems", "urban"....
0.300
accordingactamericananotherbusinessbusinessesclassificationconsolidateddirectdistributioneconomiceducationeligibilityestimatedexpandedfebruaryfinancialgovernmentshealthindividual
SHARED TOKENS (29): "according", "act", "american", "another", "business", "businesses", "classification", "consolidated", "direct", "distribution", "economic", "education", "eligibility", "estimated", "expanded", "february", "financial", "governments", "health", "individual"....
0.300
actagencyauthoritybuildingbusinesscodedepartmentdivisionfederalgovernmentindependentjurisdictionlawmonitoringofficeprincipalprovisionsresponsestatutestatutes
SHARED TOKENS (24): "act", "agency", "authority", "building", "business", "code", "department", "division", "federal", "government", "independent", "jurisdiction", "law", "monitoring", "office", "principal", "provisions", "response", "statute", "statutes"....
🫐 BERRY51 edges
0.280
approximatelyboisedatadistrictevenfoundgovernmentidaholimitslowerpopulationresidentssinglesplit
SHARED TOKENS (14): "approximately", "boise", "data", "district", "even", "found", "government", "idaho", "limits", "lower", "population", "residents", "single", "split".
0.280
analysisdataelectronicfieldidentifyingincreasinglyinventoryoperationspracticessecuritystaffsystemstrainingworking
SHARED TOKENS (14): "analysis", "data", "electronic", "field", "identifying", "increasingly", "inventory", "operations", "practices", "security", "staff", "systems", "training", "working".
0.280
accessassociatedconstructiondevelopmentdocumentsgoalgoverninggovernmentincreasinglyinformationinstitutionsmaintainspublicpublicly
SHARED TOKENS (14): "access", "associated", "construction", "development", "documents", "goal", "governing", "government", "increasingly", "information", "institutions", "maintains", "public", "publicly".
0.260
emergencyreportresources
SHARED TOKENS (3): "emergency", "report", "resources". | EXACT TITLE in security_services: "False alarm".
0.260
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
accordingboisecanyoncollegehomeidahomeaningmeridiannampapopulationprincipaluniversitywestern
SHARED TOKENS (13): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "nampa", "population", "principal", "university", "western".
0.260
feegeneralinformationmarketplacemultipleneedsonlineprocessproductssingletypetypesusers
SHARED TOKENS (13): "fee", "general", "information", "marketplace", "multiple", "needs", "online", "process", "products", "single", "type", "types", "users".
0.260
lawprivatework
SHARED TOKENS (3): "law", "private", "work". | EXACT TITLE in security_services: "Private investigator".
0.260
entryevenfoundhistoryindividualinformationlimitednationalqualifiedrecordrecordsrelevanttraffic
SHARED TOKENS (13): "entry", "even", "found", "history", "individual", "information", "limited", "national", "qualified", "record", "records", "relevant", "traffic".
0.260
Prison ↗ Q40357 KW CROSS HIGH
administrationauthoritycenterdetentionfacilityfairformsfunctionsgoverninglargelawprocesssystem
SHARED TOKENS (13): "administration", "authority", "center", "detention", "facility", "fair", "forms", "functions", "governing", "large", "law", "process", "system".
0.260
Biometrics ↗ Q177765 KW CROSS HIGH
accessclasscontrolfaceidentifyidentitylicenselimitedmetricsmovementreliablesystemstraditional
SHARED TOKENS (13): "access", "class", "control", "face", "identify", "identity", "license", "limited", "metrics", "movement", "reliable", "systems", "traditional".
0.260
chaindepartmentfinancialintegrationlargestmanagementorderplanningprocessprocurementsoftwaresupplysystems
SHARED TOKENS (13): "chain", "department", "financial", "integration", "largest", "management", "order", "planning", "process", "procurement", "software", "supply", "systems".
0.260
Campus police ↗ Q5028727 KW CROSS HIGH
agencyassociatedcollegeemployedprivatepropertypublicsafetysecuritysurroundingtypeuniversitywork
SHARED TOKENS (13): "agency", "associated", "college", "employed", "private", "property", "public", "safety", "security", "surrounding", "type", "university", "work".
0.260
activityconstructionequipmentmanagementmaterialspowerprotectingrisksafetytoolsvehiclesworkersworking
SHARED TOKENS (13): "activity", "construction", "equipment", "management", "materials", "power", "protecting", "risk", "safety", "tools", "vehicles", "workers", "working".
0.240
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingbuildingscodesconstructiondepartmentdivisioneventofficerpracticessafetyschoolsstructures
SHARED TOKENS (12): "building", "buildings", "codes", "construction", "department", "division", "event", "officer", "practices", "safety", "schools", "structures".
0.240
buildingbuildingscommercialconnectedcontrolemergencyfoundgenerallypresencerequiredsystemsystems
SHARED TOKENS (12): "building", "buildings", "commercial", "connected", "control", "emergency", "found", "generally", "presence", "required", "system", "systems".
0.240
allocationanalysisdatadesignfairgenerallyindividualitselflegalprocessesrelevantresponsibility
SHARED TOKENS (12): "allocation", "analysis", "data", "design", "fair", "generally", "individual", "itself", "legal", "processes", "relevant", "responsibility".
0.240
buildingscommercialdirectlyindustrialinfrastructureseparateservingsmallersystemsystemstypeurban
SHARED TOKENS (12): "buildings", "commercial", "directly", "industrial", "infrastructure", "separate", "serving", "smaller", "system", "systems", "type", "urban".
0.240
assetsauthoritycapabilitydataformsgovernancemanagementorganizationalprocessesqualityrolevalue
SHARED TOKENS (12): "assets", "authority", "capability", "data", "forms", "governance", "management", "organizational", "processes", "quality", "role", "value".
0.220
Grant ↗ Q219140 EXACT TITLE
grantgrants
SHARED TOKENS (2): "grant", "grants". | EXACT TITLE in security_services: "Grant". | EXACT TITLE in procurement_public_spending: "Grant".
0.220
americancybersecurityframeworkinfrastructureinvolvenationalprogrampublishedregionresponsesecurity
SHARED TOKENS (11): "american", "cybersecurity", "framework", "infrastructure", "involve", "national", "program", "published", "region", "response", "security".
0.220
accountingauditauditsevidencefinancialinformationmaterialprovidestandardstypeverified
SHARED TOKENS (11): "accounting", "audit", "audits", "evidence", "financial", "information", "material", "provide", "standards", "type", "verified".
0.220
Deterrence ↗ Q5265719 EXACT TITLE
especiallyregarding
SHARED TOKENS (2): "especially", "regarding". | EXACT TITLE in security_services: "Deterrence".
0.220
anotherphysical
SHARED TOKENS (2): "another", "physical". | EXACT TITLE in security_services: "De-escalation".
0.220
accessactivityconnectedcontrolcontrolledcurrentdirectlyelectronicoperatessystemtransaction
SHARED TOKENS (11): "access", "activity", "connected", "control", "controlled", "current", "directly", "electronic", "operates", "system", "transaction".
0.220
boisecapitaldistrictestimatedhomeidahojurisdictionlargestlocalpopulationprivate
SHARED TOKENS (11): "boise", "capital", "district", "estimated", "home", "idaho", "jurisdiction", "largest", "local", "population", "private".
0.200
datadifferentelectronicfinancialmobileprocesspublicrisksoftwaretechnical
SHARED TOKENS (10): "data", "different", "electronic", "financial", "mobile", "process", "public", "risk", "software", "technical".
0.200
agencycenterdivisiongenerallygovernmentinformationoperationsprotectingresponsiblesecurity
SHARED TOKENS (10): "agency", "center", "division", "generally", "government", "information", "operations", "protecting", "responsible", "security".
0.200
RMON ↗ Q1195500 KW CROSS HIGH
agentsanalysisinformationlayerlocalmonitoringnetworknetworksoriginalsupport
SHARED TOKENS (10): "agents", "analysis", "information", "layer", "local", "monitoring", "network", "networks", "original", "support".
0.200
catalogcodefoodmunicipalpublicroleseparatelysourcestraditionaltype
SHARED TOKENS (10): "catalog", "code", "food", "municipal", "public", "role", "separately", "sources", "traditional", "type".
0.200
assetsassociatedcloudcontrolsdatainformationinfrastructurenetworkpoliciessecurity
SHARED TOKENS (10): "assets", "associated", "cloud", "controls", "data", "information", "infrastructure", "network", "policies", "security".
0.200
Linked data ↗ Q515701 KW CROSS HIGH
associatedbecomedatadescribeddesigninformationmakespagesprojectrather
SHARED TOKENS (10): "associated", "become", "data", "described", "design", "information", "makes", "pages", "project", "rather".
0.200
communicationconsultantsgovernmentinformationprivateprocessesrelationshipsoftwaretechnologyworking
SHARED TOKENS (10): "communication", "consultants", "government", "information", "private", "processes", "relationship", "software", "technology", "working".
0.180
agencyconstructioncontractsdesigndiffersownerprojectseparatetraditional
SHARED TOKENS (9): "agency", "construction", "contracts", "design", "differs", "owner", "project", "separate", "traditional".
0.180
accessauthorizeddigitalfeedlimitedpublicrathersignalstype
SHARED TOKENS (9): "access", "authorized", "digital", "feed", "limited", "public", "rather", "signals", "type".
0.180
datadifferencesdifferententityfilesnationalrecordrecordssources
SHARED TOKENS (9): "data", "differences", "different", "entity", "files", "national", "record", "records", "sources".
0.180
Low voltage ↗ Q1504817 KW CROSS HIGH
codesdefinedesigndifferentdistributionengineeringpowerrequiredsafety
SHARED TOKENS (9): "codes", "define", "design", "different", "distribution", "engineering", "power", "required", "safety".
0.180
Wiretapping ↗ Q1067529 KW CROSS HIGH
agencyconnectionelectronicgovernmentlegalmonitoringotherwiserecordstraffic
SHARED TOKENS (9): "agency", "connection", "electronic", "government", "legal", "monitoring", "otherwise", "records", "traffic".
0.180
Keycard lock ↗ Q6398242 KW CROSS HIGH
commercialdigitalelectronicfeelowermechanismphysicaltypesusers
SHARED TOKENS (9): "commercial", "digital", "electronic", "fee", "lower", "mechanism", "physical", "types", "users".
0.180
Review site ↗ Q1340449 KW CROSS HIGH
businesseschannelcomlaterproductsprofessionalreviewsitesusers
SHARED TOKENS (9): "businesses", "channel", "com", "later", "products", "professional", "review", "sites", "users".
0.180
approximatelyboisecaldwellcanyoncollegeidaholocallyoregonpopulation
SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "oregon", "population".
0.160
Crowd control ↗ Q1872073 KW CROSS HIGH
controlinvolveinvolvinglargemanagementorderpublicsecurity
SHARED TOKENS (8): "control", "involve", "involving", "large", "management", "order", "public", "security".
0.160
accessadministrationclouddemandnetworkphysicalresourcesshared
SHARED TOKENS (8): "access", "administration", "cloud", "demand", "network", "physical", "resources", "shared".
0.160
controlledgeneralgenerallygovernmentlawspendingsupplysystem
SHARED TOKENS (8): "controlled", "general", "generally", "government", "law", "spending", "supply", "system".
0.140
accessfederalgovernmentinformationlocalpublicrecords
SHARED TOKENS (7): "access", "federal", "government", "information", "local", "public", "records".
0.140
Garden City, Idaho ↗ KW CROSS HIGH
boisegovernmentidahomunicipalnearlypopulationseparate
SHARED TOKENS (7): "boise", "government", "idaho", "municipal", "nearly", "population", "separate".
0.140
boisecanyonidahooregonregiontreasurevalley
SHARED TOKENS (7): "boise", "canyon", "idaho", "oregon", "region", "treasure", "valley".
0.140
contractcontractorinsuranceissuedperformanceprojectwork
SHARED TOKENS (7): "contract", "contractor", "insurance", "issued", "performance", "project", "work".
0.140
businessclassificationdatainformationintelligencemanagementtype
SHARED TOKENS (7): "business", "classification", "data", "information", "intelligence", "management", "type".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
boisegainidahonearlypopulation
SHARED TOKENS (5): "boise", "gain", "idaho", "nearly", "population".
0.100
Surety ↗ KW CROSS HIGH
contractfailurefinanceprincipalresponsibility
SHARED TOKENS (5): "contract", "failure", "finance", "principal", "responsibility".
0.100
Drawing pin ↗ Q406839 KW CROSS HIGH
americanmeaningotherwisesmalltype
SHARED TOKENS (5): "american", "meaning", "otherwise", "small", "type".
◈ Frequently Asked Questions
Security Services × Procurement Public Spending — Treasure Valley
HAIKU · HIGH GATE
How do Boise and Canyon County security service contracts appear in public spending records?
Boise city and Canyon County governments post security service procurement through standard government procurement channels, making vendor selections and contract values public record. Risk management assessments in both jurisdictions require documented security spending to meet legal control standards before award.
What role does Boise State University play in security services procurement for the Treasure Valley?
Boise State University manages its own security services procurement separately from municipal budgets, though its spending decisions influence regional security vendor development and professional standards. The university's apprenticeship and vocational education programs through College of Western Idaho produce trained security personnel who enter Treasure Valley procurement cycles.
How do law enforcement and emergency management agencies coordinate with public spending on private security contracts in the Treasure Valley?
Boise and Canyon County law enforcement agencies review private security service procurement to ensure coordination with emergency management plans and public capital allocation. Government procurement rules in Idaho require security service vendors to demonstrate legal compliance and management control before contract approval.
What technology standards apply to security services spending in Treasure Valley government budgets?
Computer security requirements shape how Boise, Idaho and Canyon County evaluate security service bids, particularly for vendors handling sensitive data or critical infrastructure. Public spending controls require documented technology and professional standards that security contractors must meet before government agencies award procurement contracts.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Security Services × Procurement Public Spending 17 QID bridges 235 edges 5,911 ext links 2026-07-17 23:03:55 UTC 2c48b548b9dfefc0
Security Services corridor ↗ Procurement Public Spending corridor ↗ Procurement Public Spending × Security Services ↗ boisestandard.org/standard ↗
Parent Corridors
Security Services × All Other Verticals