—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Geology ↔ relates to ↔ Technology

11 Wikipedia bridge articles confirmed in both vertical ledgers. 211 deterministic cross-vertical edges. 5,704 external source links harvested. Every edge provenance-stamped. Every claim auditable.

11 QID Bridge Articles
211 Cross Edges
5,704 External Sources
236 Wikipedia Articles
11 🌲 Evergreen
155 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Geology
× Technology
QID Bridge Articles
11
confirmed Wikipedia overlap
Total Cross Edges
211
External Sources Harvested
5,704
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Treasure Valley
score: 1.0100  ·  type: exact_title_cross  ·  8 shared tokens
QID Bridge Titles (11)
Treasure ValleySemiconductorBoise State UniversityCollege of Western IdahoGeographic information systemBoise, IdahoNampa, IdahoKuna, IdahoMeridian, IdahoEagle, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahoadatreasurevalleywesterncollegecanyonnampadevelopmentphysicaleducationengineeringprogramspublicreporteduniversityacademictechnicalcapital
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:01:12 UTC
Content Hash
068836b7513a8ae2
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
11 BRIDGES
Treasure Valley
Q7836726 EXACT TITLE 1.010
QID OVERLAP: Q7836726 in geology (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (8): "boise", "historically", "idaho", "land", "local", "treasure", "valley", "western". | URL->B (1): https://www.hpmuseum.net/divisions.php?did=9. | EXACT TITLE in geology: "Treasure Valley". | EXACT TITLE in technology: "Treasure Valley".
boisehistoricallyidaholandlocaltreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
S
Q11456 EXACT TITLE 1.000
QID OVERLAP: Q11456 in geology (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (23): "capacity", "control", "conversion", "critical", "current", "development", "different", "early", "electronics", "group", "material", "materials", "modern", "near", "physical", "practical", "process", "semiconductor", "silicon", "single".... | EXACT TITLE in geology: "Semiconductor". | EXACT TITLE in technology: "Semiconductor".
capacitycontrolconversioncriticalcurrentdevelopmentdifferentearlyelectronicsgroupmaterialmaterialsmodernnearphysicalpracticalprocesssemiconductorsiliconsinglesmallstructurework
of electrical fields or light, devices made from semiconductors can be used for amplification, switching, and energy conversion. The term semiconductor is also used to describe materials used in high capacity, medium- to high-voltage cables as part of their insulation, and these materials are often plastic XLPE (cross-linked polyethylene) with carbon black. The conductivity of silicon can be increased by adding a small amount (of the order of 1 in 108) of pentavalent (antimony, phosphorus, or arsenic) or trivalent (boron, gallium, indium) atoms. This process is known as doping, and the resulting semiconductors are known as doped or extrinsic semiconductors. Apart from doping, the conductivity of a semiconductor can be improved by increasing its temperature. This is contrary to the behavior of a metal, in which conductivity decreases with an increase in temperature. The modern understanding of the properties of a semiconductor relies on quantum physics to explain the movement of charge carriers in a crystal lattice. Doping greatly increases the number of charge carriers within the crystal. When a semiconductor is doped by Group V elements, they will behave like donors creating free electrons, known as "n-type" doping. When a semiconductor is doped by Group III elements, they will behave like acceptors creating free holes, known as "p-type" doping. The semiconductor materials used in electronic devices are doped under precise conditions to control the concentration and regions of p- and n-type dopants. A single semiconductor device crystal can have many p- and n-type regions; the p–n junctions between these regions are responsible for the useful electronic behavior. Using a hot-point probe, one can determine quickly whether a semiconductor sample is p- or n-type. A few of the properties of semiconductor materials were observed throughout the mid-19th and first decades of the 20th century. The first practical application of semiconductors in electronics was the 1904 development of the cat's-whisker detector, a primitive semiconductor diode used in early radio receivers.
oped by Group III elements, they will behave like acceptors creating free holes, known as "p-type" doping. The semiconductor materials used in electronic devices are doped under precise conditions to control the concentration and regions of p- and n-type dopants. A single semiconductor device crystal can have many p- and n-type regions; the p–n junctions between these regions are responsible for the useful electronic behavior. Using a hot-point probe, one can determine quickly whether a semiconductor sample is p- or n-type. A few of the properties of semiconductor materials were observed throughout the mid-19th and first decades of the 20th century. The first practical application of semiconductors in electronics was the 1904 development of the cat's-whisker detector, a primitive semiconductor diode used in early radio receivers.
Excited electrons A difference in the electric potential on a semiconducting material would cause it to leave thermal equilibrium and create a non-equilibrium situation. This introduces electrons and holes to the system, which interact via a process called ambipolar diffusion. Whenever thermal equilibrium is disturbed in a semiconducting material, the number of holes and electrons changes. Such disruptions can occur as a result of a temperature difference or photons, which can enter the system and create electrons and holes. The processes that create or annihilate electrons and holes are called generation and recombination, respectively. Light emission In certain semiconductors, excited electrons can relax by emitting light instead of producing heat. Controlling the semiconductor composition and electrical current allows for the manipulation of the emitted light's properties.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in geology (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (18): "boise", "college", "compete", "conference", "division", "economics", "education", "engineering", "idaho", "institution", "million", "program", "programs", "public", "reported", "research", "universities", "university". | EXACT TITLE in geology: "Boise State University".
boisecollegecompeteconferencedivisioneconomicseducationengineeringidahoinstitutionmillionprogramprogramspublicreportedresearchuniversitiesuniversity
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
A program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
CAA Division I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in geology (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (21): "academic", "ada", "board", "boise", "canyon", "college", "cwi", "development", "education", "idaho", "large", "nampa", "programs", "public", "reported", "students", "technical", "treasure", "valley", "western".... | EXACT TITLE in geology: "College of Western Idaho". | EXACT TITLE in technology: "College of Western Idaho".
academicadaboardboisecanyoncollegecwidevelopmenteducationidaholargenampaprogramspublicreportedstudentstechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Geographic information system
Q483130 QID OVERLAP 0.800
QID OVERLAP: Q483130 in geology (tier:branch) and technology (tier:branch). | SHARED TOKENS (29): "ability", "academic", "analysis", "another", "broader", "data", "engineering", "gis", "industry", "institutional", "insurance", "intelligence", "key", "knowledge", "management", "operations", "physical", "planning", "processes", "real"....
abilityacademicanalysisanotherbroaderdataengineeringgisindustryinstitutionalinsuranceintelligencekeyknowledgemanagementoperationsphysicalplanningprocessesrealrelevantsciencesoftwarestaffsupportsystemsystemstechnicalworkflows
nd Earth science. For this reason, GIS and location intelligence applications are at the foundation of location-enabled services, which rely on geographic analysis and visualization. GIS provides the ability to relate previously unrelated information, through the use of location as the "key index variable". Locations and extents that are found in the Earth's spacetime are able to be recorded through the date and time of occurrence, along with x, y, and z coordinates; representing, longitude (x), latitude (y), and elevation (z). All Earth-based, spatial–temporal, location and extent references should be relatable to one another, and ultimately, to a "real" physical location or extent.
One of the first known instances in which spatial analysis was used came from the field of epidemiology in the Rapport sur la marche et les effets du choléra dans Paris et le département de la Seine (1832). French cartographer and geographer Charles Picquet created a map outlining the forty-eight districts in Paris, using halftone color gradients, to provide a visual representation for the number of reported deaths due to cholera per every 1,000 inhabitants. In 1854, John Snow, an epidemiologist and physician, was able to determine the source of a cholera outbreak in London through the use of spatial analysis. Snow achieved this through plotting the residence of each casualty on a map of the area, as well as the nearby water sources. Once these points were marked, he was able to identify the water source within the cluster that was responsible for the outbreak. This was one of the earliest successful uses of a geographic methodology in pinpointing the source of an outbreak in epidemiology. While the basic elements of topography and theme existed previously in cartography, Snow's map was unique due to his use of cartographic methods, not only to depict, but also to analyze clusters of geographically dependent phenomena. The early 20th century saw the development of photozincography, which allowed maps to be split into layers, for example one layer for vegetation and another for water. This was particularly used for printing contours – drawing these was a labour-intensive task but having them on a separate layer meant they could be worked on without the other layers to confuse the draughtsman. This work was initially drawn on glass plates, but later plastic film was introduced, with the advantages of being lighter, using less storage space and being less brittle, among others. When all the layers were finished, they were combined into one image using a large process camera. Once color printing came in, the layers idea was also used for creating separate printing plates for each color. While the use of layers much later became one of the typical features of a contemporary GIS, the photographic process just described is not considered a GIS in itself – as the maps were just images with no database to link them to. Two additional developments are notable in the early days of GIS: Ian McHarg's publication Design with Nature and its map overlay method and the introduction of a street network into the U.S. Census Bureau's DIME (Dual Independent Map Encoding) system. The first publication detailing the use of computers to facilitate cartography was written by Waldo Tobler in 1959. Further computer hardware development spurred by nuclear weapon research led to more widespread general-purpose computer "mapping" applications by the early 1960s. In 1963, the world's first true operational GIS was developed in Ottawa, Ontario, Canada, by the federal Department of Forestry and Rural Development. Developed by Roger Tomlinson, it was called the Canada Geographic Information System (CGIS) and was used to store, analyze, and manipulate data collected for the Canada Land Inventory, an effort to determine the land capability for rural Canada by mapping information about soils, agriculture, recreation, wildlife, waterfowl, forestry and land use at a scale of 1:50,000. A rating classification factor was also added to permit analysis. CGIS was an improvement over "computer mapping" applications as it provided capabilities for data storage, overlay, measurement, and digitizing/scanning. It supported a national coordinate system that spanned the continent, coded lines as arcs having a true embedded topology and it stored the attribute and locational information in separate files. As a result of this, Tomlinson has become known as the "father of GIS", particularly for his use of overlays in promoting the spatial analysis of convergent geographic data. CGIS lasted into the 1990s and built a large digital land resource database in Canada. It was developed as a mainframe-based system in support of federal and provincial resource planning and management. Its strength was continent-wide analysis of complex datasets. The CGIS was never available commercially. In 1964, Howard T. Fisher formed the Laboratory for Computer Graphics and Spatial Analysis at the Harvard Graduate School of Design (LCGSA 1965–1991), where a number of important theoretical concepts in spatial data handling were developed, and which by the 1970s had distributed seminal software code and systems, such as SYMAP, GRID, and ODYSSEY, to universities, research centers and corporations worldwide. These programs were the first examples of general-purpose GIS software that was not developed for a particular installation, and was very influential on future commercial software, such as Esri ARC/INFO, released in 1983. Working in the Harvard Lab, Tom Waugh developed his vector-based Geographic Information Mapping and Manipulation System (GIMMS) software from 1969. He returned to the University of Edinburgh and this software was sold commercially from 1973. By 1977 it was used at 300 sites worldwide. This can be considered the first globally used GIS which anticipated some key characteristics of the Harvard Odyssey system by nearly five years and ARC/INFO by a decade. By the late 1970s, two public domain GIS systems (MOSS and GRASS GIS) were in development, and by the early 1980s, M&S Computing (later Intergraph) along with Bentley Systems Incorporated for the CAD platform, Environmental Systems Research Institute (ESRI), CARIS (Computer Aided Resource Information System), and ERDAS (Earth Resource Data Analysis System) emerged as commercial vendors of GIS software, successfully incorporating many of the CGIS features, combining the first-generation approach to separation of spatial and attribute information with a second-generation approach to organizing attribute data into database structures. In 1986, Mapping Display and Analysis System (MIDAS), the first desktop GIS product, was released for MS-DOS. It was renamed in 1990 to MapInfo for Windows when it was ported to Windows. This began the process of moving GIS from the research department into the business environment. By the end of the 20th century, the rapid growth in various systems had been consolidated and standardized on relatively few platforms and users were beginning to explore viewing GIS data over the Internet, requiring data format and transfer standards. More recently, a growing number of free, open-source GIS packages run on a range of operating systems and can be customized to perform specific tasks.
Primary data capture Survey data can be directly entered into a GIS from digital data collection systems on survey instruments using a technique called coordinate geometry (COGO). Positions from a global navigation satellite system (GNSS) like the Global Positioning System can also be collected and then imported into a GIS. A current trend in data collection gives users the ability to use field computers with the ability to edit live data using wireless connections or disconnected editing sessions. The current trend is to use applications available on smartphones and PDAs in the form of mobile GIS. This has been enhanced by the availability of low-cost mapping-grade GPS units with decimeter accuracy in real time. This eliminates the need to post process, import, and update the data in the office after fieldwork has been collected. This includes the ability to incorporate positions collected using a laser rangefinder. New technologies also allow users to create maps as well as analysis directly in the field, making projects more efficient and mapping more accurate. Remotely sensed data also plays an important role in data collection and consist of sensors attached to a platform. Sensors include cameras, digital scanners and lidar, while platforms usually consist of aircraft and satellites. In England in the mid-1990s, hybrid kite/balloons called helikites first pioneered the use of compact airborne digital cameras as airborne geo-information systems. Aircraft measurement software, accurate to 0.4 mm, was used to link the photographs and measure the ground. Helikites are inexpensive and gather more accurate data than aircraft. Helikites can be used over roads, railways and towns where unmanned aerial vehicles (UAVs) are banned. Recently, aerial data collection has become more accessible with miniature UAVs and drones. For example, the Aeryon Scout was used to map a 50-acre area with a ground sample distance of 1 inch (2.54 cm) in only 12 minutes. The majority of digital data currently comes from photo interpretation of aerial photographs. Soft-copy workstations are used to digitize features directly from stereo pairs of digital photographs. These systems allow data to be captured in two and three dimensions, with elevations measured directly from a stereo pair using principles of photogrammetry. Analog aerial photos must be scanned before being entered into a soft-copy system, for high-quality digital cameras this step is skipped. Satellite remote sensing provides another important source of spatial data. Here satellites use different sensor packages to passively measure the reflectance from parts of the electromagnetic spectrum or radio waves that were sent out from an active sensor such as radar.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in geology (tier:branch) and technology (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "capital", "employers", "idaho", "level", "major", "manufacturing", "technology", "treasure", "valley".
adaannualboisecapitalemployersidaholevelmajormanufacturingtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.680
QID OVERLAP: Q622633 in geology (tier:branch) and technology (tier:branch). | SHARED TOKENS (9): "boise", "canyon", "college", "idaho", "meridian", "nampa", "northwest", "university", "western".
boisecanyoncollegeidahomeridiannampanorthwestuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Kuna, Idaho
Q1515177 QID OVERLAP 0.600
QID OVERLAP: Q1515177 in geology (tier:branch) and technology (tier:branch). | SHARED TOKENS (5): "ada", "boise", "idaho", "kuna", "nearly".
adaboiseidahokunanearly
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.600
QID OVERLAP: Q1085274 in geology (tier:branch) and technology (tier:branch). | SHARED TOKENS (5): "ada", "boise", "capital", "idaho", "meridian".
adaboisecapitalidahomeridian
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in geology (tier:branch) and technology (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "northwest".
adaboiseeagleidahonorthwest
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Canyon County, Idaho
Q486078 QID OVERLAP 0.580
QID OVERLAP: Q486078 in geology (tier:branch) and technology (tier:evergreen). | SHARED TOKENS (4): "boise", "canyon", "idaho", "nampa".
boisecanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
200 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP200 edges
🌲 EVERGREEN1 edges
0.650
adaairairportbaseboisecentercommercialdepartmentfieldgeneralidahologisticalmillionnationaloperatesroughlysupportuseswestern
SHARED TOKENS (19): "ada", "air", "airport", "base", "boise", "center", "commercial", "department", "field", "general", "idaho", "logistical", "million", "national", "operates", "roughly", "support", "uses", "western". | URL->B (1): http://www.iflyboise.com/. | EXACT TITLE in geology: "Boise Airport". | EXACT TITLE in technology: "Boise Airport".
🌿 BRANCH154 edges
0.570
boisecompliancefinancialheadquarteredidahoinvestmentofficesperformancereportingrisktechnology
SHARED TOKENS (11): "boise", "compliance", "financial", "headquartered", "idaho", "investment", "offices", "performance", "reporting", "risk", "technology". | URL->B (1): https://clearwateranalytics.com/. | EXACT TITLE in technology: "Clearwater Analytics".
0.500
chaincomplexdevelopedhandlinglargermanagementofficeoperationsprocessproductionprogramsreportingsoftwaresupplysupportsystemsystemstoolsuses
SHARED TOKENS (19): "chain", "complex", "developed", "handling", "larger", "management", "office", "operations", "process", "production", "programs", "reporting", "software", "supply", "support", "system", "systems", "tools", "uses". | EXACT TITLE in technology: "Enterprise software".
0.500
agoapproximatelyboisecompeteconferencedivisionidaholaterofficesoperatesproductionpublicresearchstatewidestudentsuniversity
SHARED TOKENS (16): "ago", "approximately", "boise", "compete", "conference", "division", "idaho", "later", "offices", "operates", "production", "public", "research", "statewide", "students", "university". | EXACT TITLE in geology: "University of Idaho".
0.500
Geology ↗ Q1069 EXACT TITLE
academicanalysiscentralchemicalclimatedescribesengineeringenvironmentalhistoryimportantmajormodernphysicalpracticalproblemsprocessesrolesciencestructuresurface
SHARED TOKENS (24): "academic", "analysis", "central", "chemical", "climate", "describes", "engineering", "environmental", "history", "important", "major", "modern", "physical", "practical", "problems", "processes", "role", "science", "structure", "surface".... | EXACT TITLE in geology: "Geology".
0.500
Well ↗ Q43483 EXACT TITLE
accessagoanotheraquiferchemicalcompletedconcreteconstructioncontainscreatecreateddeepdeeperenvironmentalhistoricallymachinematerialmineralsmodernneeds
SHARED TOKENS (32): "access", "ago", "another", "aquifer", "chemical", "completed", "concrete", "construction", "contains", "create", "created", "deep", "deeper", "environmental", "historically", "machine", "material", "minerals", "modern", "needs".... | EXACT TITLE in geology: "Well".
0.500
Intuit ↗ Q1318848 EXACT TITLE
createdevelopedfinancefinancialheadquarteredmarketmonitoringoperationsproductssmallsoftwarestandardsystemsystemstax
SHARED TOKENS (15): "create", "developed", "finance", "financial", "headquartered", "market", "monitoring", "operations", "products", "small", "software", "standard", "system", "systems", "tax". | EXACT TITLE in technology: "Intuit".
0.500
Uranium ↗ Q1098 EXACT TITLE
anotherbillionchainchemicaldegreedensitydifferentdiscoveryenvironmentalevenfacilitiesfuelfutureindustrialindustryleadmaterialmillionmineralsneeds
SHARED TOKENS (30): "another", "billion", "chain", "chemical", "degree", "density", "different", "discovery", "environmental", "even", "facilities", "fuel", "future", "industrial", "industry", "lead", "material", "million", "minerals", "needs".... | EXACT TITLE in geology: "Uranium".
0.500
actagenciesapproximatelybillioncreateddepartmentdescribedestateexistingfederalfuturegeneralgovernmentheadquarteredidaholandmanagementmanagesmillionnational
SHARED TOKENS (28): "act", "agencies", "approximately", "billion", "created", "department", "described", "estate", "existing", "federal", "future", "general", "government", "headquartered", "idaho", "land", "management", "manages", "million", "national".... | EXACT TITLE in geology: "Bureau of Land Management".
0.500
airapproximatelyclimateflowindustrialirrigationpeoplepotentiallyproducedremainingsmallsourcesourcessupplysurfacewastewaterwater
SHARED TOKENS (17): "air", "approximately", "climate", "flow", "industrial", "irrigation", "people", "potentially", "produced", "remaining", "small", "source", "sources", "supply", "surface", "wastewater", "water". | EXACT TITLE in geology: "Water resources".
0.500
analysisapproximatelyartificialclassdatadeepdescribeddescribingdevelopmentfieldintelligencelearningmachinenetworksperformancerelatedrisk
SHARED TOKENS (17): "analysis", "approximately", "artificial", "class", "data", "deep", "described", "describing", "development", "field", "intelligence", "learning", "machine", "networks", "performance", "related", "risk". | EXACT TITLE in geology: "Machine learning". | EXACT TITLE in technology: "Machine learning".
0.500
Idaho ↗ Q1221 EXACT TITLE
agricultureapproximatelyaroundboisecapitalcontainsdistinctearlyeconomyidahoisolatedlandmanufacturingmillionnationalnorthwestorganizedpacificpeopleprior
SHARED TOKENS (28): "agriculture", "approximately", "around", "boise", "capital", "contains", "distinct", "early", "economy", "idaho", "isolated", "land", "manufacturing", "million", "national", "northwest", "organized", "pacific", "people", "prior".... | EXACT TITLE in geology: "Idaho". | EXACT TITLE in technology: "Idaho".
0.500
capacitycontinueddepartmentgeothermalindustrialindustrynearneedspeoplepowerprocessessourcespacesupplywater
SHARED TOKENS (15): "capacity", "continued", "department", "geothermal", "industrial", "industry", "near", "needs", "people", "power", "processes", "source", "space", "supply", "water". | EXACT TITLE in geology: "Geothermal energy".
0.500
anotheraquiferchemicalconcernsdesigndesigneddevelopeddistributionengineeringflowlocalplacesqualitysuppliessurfacesystemsystemswater
SHARED TOKENS (18): "another", "aquifer", "chemical", "concerns", "design", "designed", "developed", "distribution", "engineering", "flow", "local", "places", "quality", "supplies", "surface", "system", "systems", "water". | EXACT TITLE in geology: "Hydrogeology".
0.500
Mining ↗ Q44497 EXACT TITLE
analysiscannotcontainsdependentenvironmentaleveninvestmentlaborlandlocalmaterialsmeansmineralsmodernoperationspoliticalprocessesremoterisksrole
SHARED TOKENS (27): "analysis", "cannot", "contains", "dependent", "environmental", "even", "investment", "labor", "land", "local", "materials", "means", "minerals", "modern", "operations", "political", "processes", "remote", "risks", "role".... | EXACT TITLE in geology: "Mining".
0.500
Silver ↗ Q1090 EXACT TITLE
beyondchemicaldemanddescribeddigitalelectronicsimportantindustrialinvestmentleadmaterialmaterialsmineralsrolesystemsuses
SHARED TOKENS (16): "beyond", "chemical", "demand", "described", "digital", "electronics", "important", "industrial", "investment", "lead", "material", "materials", "minerals", "role", "systems", "uses". | EXACT TITLE in geology: "Silver".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agricultureaquiferbecomebillioncapacitycentralclimatecontaincontainsdeepdepthdistributioneffectsenvironmentalfieldgeothermalindustriallandlevelmajor
SHARED TOKENS (39): "agriculture", "aquifer", "become", "billion", "capacity", "central", "climate", "contain", "contains", "deep", "depth", "distribution", "effects", "environmental", "field", "geothermal", "industrial", "land", "level", "major".... | EXACT TITLE in geology: "Groundwater".
0.500
beganchemicalcreateseffectsenvironmentalhistoryindustriallandmodernmunicipalphysicalplanningpriorprocesssites
SHARED TOKENS (15): "began", "chemical", "creates", "effects", "environmental", "history", "industrial", "land", "modern", "municipal", "physical", "planning", "prior", "process", "sites". | EXACT TITLE in geology: "Mine reclamation".
0.500
Lake ↗ Q23397 EXACT TITLE
approximatelyarounddeeperdirectlydistinctdomesticevenformedindustriallandlargelargermaterialnearpowerprocessesshallowsurfacewaterzones
SHARED TOKENS (20): "approximately", "around", "deeper", "directly", "distinct", "domestic", "even", "formed", "industrial", "land", "large", "larger", "material", "near", "power", "processes", "shallow", "surface", "water", "zones". | EXACT TITLE in geology: "Lake".
0.500
5G ↗ Q1363408 EXACT TITLE
accessairbasebegancapabilitiescapacitycommercialconnectcorecurrentdatadesigndesigneddevelopedearlieredgeeffectsevaluationexistingindustrial
SHARED TOKENS (42): "access", "air", "base", "began", "capabilities", "capacity", "commercial", "connect", "core", "current", "data", "design", "designed", "developed", "earlier", "edge", "effects", "evaluation", "existing", "industrial".... | EXACT TITLE in technology: "5G".
0.500
Tech hub ↗ Q137582815 EXACT TITLE
broaderbusinessescontaindevelopmentdistinctfirmsgovernmenthousinginstitutioninstitutionslargeprivaterelatedresearchsciencetechnologyuniversitiesuniversity
SHARED TOKENS (18): "broader", "businesses", "contain", "development", "distinct", "firms", "government", "housing", "institution", "institutions", "large", "private", "related", "research", "science", "technology", "universities", "university". | EXACT TITLE in technology: "Tech hub".
0.500
analysiscompletedconstructiondesigndevelopmentengineeringenvironmentalinteractionsknowledgemaintenancematerialplanningprivateprocessespublicrelatedstructuralstructurestrainedtraining
SHARED TOKENS (21): "analysis", "completed", "construction", "design", "development", "engineering", "environmental", "interactions", "knowledge", "maintenance", "material", "planning", "private", "processes", "public", "related", "structural", "structures", "trained", "training".... | EXACT TITLE in geology: "Engineering geology".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
aircontainsdesignedfacilitiesindustrialinsidelevelmanufacturingmaterialmaterialspermitsprocessesproductionresearchsemiconductorsmallerspacework
SHARED TOKENS (18): "air", "contains", "designed", "facilities", "industrial", "inside", "level", "manufacturing", "material", "materials", "permits", "processes", "production", "research", "semiconductor", "smaller", "space", "work". | EXACT TITLE in technology: "Cleanroom".
0.500
Weathering ↗ Q179177 EXACT TITLE
artificialchemicalcreatedistincteffectsexposureimportantmaterialmaterialsmineralsphysicalprocessesproducedproductwater
SHARED TOKENS (15): "artificial", "chemical", "create", "distinct", "effects", "exposure", "important", "material", "materials", "minerals", "physical", "processes", "produced", "product", "water". | EXACT TITLE in geology: "Weathering".
0.500
annualanotherbecomebillionbuildcapitalcontroldevelopmentearlyemergingfinancefinancialfirmsfundinggrowthhistoryinstitutionalinvestmentinvestmentsinvestors
SHARED TOKENS (41): "annual", "another", "become", "billion", "build", "capital", "control", "development", "early", "emerging", "finance", "financial", "firms", "funding", "growth", "history", "institutional", "investment", "investments", "investors".... | EXACT TITLE in technology: "Venture capital".
0.500
Manganese ↗ Q731 EXACT TITLE
activechemicalcomplexcriticaldeepdefenseimportantindustrialisolatedmineralsproductionsitesstrengthsystemstreatmentuseswater
SHARED TOKENS (17): "active", "chemical", "complex", "critical", "deep", "defense", "important", "industrial", "isolated", "minerals", "production", "sites", "strength", "systems", "treatment", "uses", "water". | EXACT TITLE in geology: "Manganese".
0.500
Silicon ↗ Q670 EXACT TITLE
billionchemicalconcreteconstructiondescribeddigitaldistributedearlyeconomyelectronicsgrouphighlyindustrialindustrylargelateleadmarketmaterialminerals
SHARED TOKENS (32): "billion", "chemical", "concrete", "construction", "described", "digital", "distributed", "early", "economy", "electronics", "group", "highly", "industrial", "industry", "large", "late", "lead", "market", "material", "minerals".... | EXACT TITLE in geology: "Silicon". | EXACT TITLE in technology: "Silicon".
0.500
Miocene ↗ Q76267 EXACT TITLE
agoaroundbeganclimateconnectioncontinueddistinctearlyendfollowedgloballatemajormeansmillionmodern
SHARED TOKENS (16): "ago", "around", "began", "climate", "connection", "continued", "distinct", "early", "end", "followed", "global", "late", "major", "means", "million", "modern". | EXACT TITLE in geology: "Miocene".
0.500
becomecontaincontinueddesigndigitaleffectselectronicsequipmentfasterinteractionslargermaterialsmeansrequiresscalesemiconductorsmallsmallersoftwarespecialized
SHARED TOKENS (20): "become", "contain", "continued", "design", "digital", "effects", "electronics", "equipment", "faster", "interactions", "larger", "materials", "means", "requires", "scale", "semiconductor", "small", "smaller", "software", "specialized". | EXACT TITLE in technology: "Microelectronics".
0.500
Ericsson ↗ Q52618 EXACT TITLE
aroundcontroldevelopmentearlyequipmentheadquarteredindustryinfrastructureinvestmentmajoroperatespeoplesoftwaresystemstechnology
SHARED TOKENS (15): "around", "control", "development", "early", "equipment", "headquartered", "industry", "infrastructure", "investment", "major", "operates", "people", "software", "systems", "technology". | EXACT TITLE in technology: "Ericsson".
0.500
Thorium ↗ Q1115 EXACT TITLE
airanalysisbecomebillionchainchemicalconcernsdevelopeddifferentdominatedequipmentfieldfuellargelatematerialnearpointreplacementscience
SHARED TOKENS (24): "air", "analysis", "become", "billion", "chain", "chemical", "concerns", "developed", "different", "dominated", "equipment", "field", "fuel", "large", "late", "material", "near", "point", "replacement", "science".... | EXACT TITLE in geology: "Thorium".
0.500
articlechainchainscomplexconsumerdirectdirectlydistributionendfacilitiesflowmanagementmaterialsnetworkorganizedpointproductproductsstructuresupply
SHARED TOKENS (23): "article", "chain", "chains", "complex", "consumer", "direct", "directly", "distribution", "end", "facilities", "flow", "management", "materials", "network", "organized", "point", "product", "products", "structure", "supply".... | EXACT TITLE in geology: "Supply chain". | EXACT TITLE in technology: "Supply chain".
0.500
Hydrology ↗ Q42250 EXACT TITLE
datadistributionengineeringenvironmentalimportantmanagementphysicalplanningpolicyproblemsqualityrelatedresearchsciencesolvesurfacewater
SHARED TOKENS (17): "data", "distribution", "engineering", "environmental", "important", "management", "physical", "planning", "policy", "problems", "quality", "related", "research", "science", "solve", "surface", "water". | EXACT TITLE in geology: "Hydrology".
0.500
Vanadium ↗ Q722 EXACT TITLE
activecenterchemicaldirectlyfuelfutureimportantindustrialisolatedlargelaterlayerleadmineralspresenceproducedproductionstorage
SHARED TOKENS (18): "active", "center", "chemical", "directly", "fuel", "future", "important", "industrial", "isolated", "large", "later", "layer", "lead", "minerals", "presence", "produced", "production", "storage". | EXACT TITLE in geology: "Vanadium".
0.500
Earthquake ↗ Q7944 EXACT TITLE
airbeyondcannotcreatescriticaldesigndirectlyeffectsengineeringgeneralhistoricalinfrastructurelargelevelmodernpeoplepointreleaserisksstructures
SHARED TOKENS (21): "air", "beyond", "cannot", "creates", "critical", "design", "directly", "effects", "engineering", "general", "historical", "infrastructure", "large", "level", "modern", "people", "point", "release", "risks", "structures".... | EXACT TITLE in geology: "Earthquake".
0.500
buildingconnectiondataequipmentlayerlevellocalmodelnetworknetworksnodesphysicalplaceprocessstructureuses
SHARED TOKENS (16): "building", "connection", "data", "equipment", "layer", "level", "local", "model", "network", "networks", "nodes", "physical", "place", "process", "structure", "uses". | EXACT TITLE in technology: "Wireless network".
0.500
Niobium ↗ Q1046 EXACT TITLE
chemicalcontaincurrentearlyelectronicshighlyimportantmakesmaterialsmineralsnamesphysicalproducedreportedsmallstrength
SHARED TOKENS (16): "chemical", "contain", "current", "early", "electronics", "highly", "important", "makes", "materials", "minerals", "names", "physical", "produced", "reported", "small", "strength". | EXACT TITLE in geology: "Niobium".
0.500
Exyte ↗ Q100531288 EXACT TITLE
belongsbuildingbusinessescapitalchemicalconstructionconsultingcontractcoredatadesigndevelopmentdivisionengineeringequipmentgroupheadquartersitselflargerlater
SHARED TOKENS (33): "belongs", "building", "businesses", "capital", "chemical", "construction", "consulting", "contract", "core", "data", "design", "development", "division", "engineering", "equipment", "group", "headquarters", "itself", "larger", "later".... | EXACT TITLE in technology: "Exyte".
0.500
accessaffectsassetbuildingcreateddepartmentdevelopmentdisasteremergencyexecutivefederalfundinggovernmenthousinginfrastructurelocalmajormanagementplaceplan
SHARED TOKENS (27): "access", "affects", "asset", "building", "created", "department", "development", "disaster", "emergency", "executive", "federal", "funding", "government", "housing", "infrastructure", "local", "major", "management", "place", "plan".... | EXACT TITLE in geology: "Federal Emergency Management Agency".
0.500
airchemicalconstructioncontrolcreatedesignengineeringengineersenvironmentalglobalindustriallawlocalmanagementmunicipalplanspublicqualityrecyclingrelated
SHARED TOKENS (27): "air", "chemical", "construction", "control", "create", "design", "engineering", "engineers", "environmental", "global", "industrial", "law", "local", "management", "municipal", "plans", "public", "quality", "recycling", "related".... | EXACT TITLE in geology: "Environmental engineering".
0.500
continuedcontroldesignelectronicsengineeringfieldintendedmanufacturingmodernpeopleproductsciencestandardsystemstechnicaltechnologytreat
SHARED TOKENS (17): "continued", "control", "design", "electronics", "engineering", "field", "intended", "manufacturing", "modern", "people", "product", "science", "standard", "systems", "technical", "technology", "treat". | EXACT TITLE in technology: "Mechatronics".
0.500
createdevelopmentdifferentfinancialformedfundingglobalgovernmentimportantindustrylargelegallocalpeoplephysicalresearchrolescalesiliconsupport
SHARED TOKENS (23): "create", "development", "different", "financial", "formed", "funding", "global", "government", "important", "industry", "large", "legal", "local", "people", "physical", "research", "role", "scale", "silicon", "support".... | EXACT TITLE in technology: "Startup ecosystem".
0.500
Geophysics ↗ Q46255 EXACT TITLE
analysisbroaderconnectsdatadeepdevelopmentearlyenvironmentalfieldinteractionslatermonitoringobservationphysicalpracticalprocessesprocessingrecordsremotescience
SHARED TOKENS (25): "analysis", "broader", "connects", "data", "deep", "development", "early", "environmental", "field", "interactions", "later", "monitoring", "observation", "physical", "practical", "processes", "processing", "records", "remote", "science".... | EXACT TITLE in geology: "Geophysics".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciesagocanyoncentralcommercialconstructioncontrolcreateddevelopedfarmlandflowsfollowedhistoryidahoimportantirrigationlargelatemajornational
SHARED TOKENS (32): "agencies", "ago", "canyon", "central", "commercial", "construction", "control", "created", "developed", "farmland", "flows", "followed", "history", "idaho", "important", "irrigation", "large", "late", "major", "national".... | EXACT TITLE in geology: "Snake River".
0.500
Gold ↗ Q897 EXACT TITLE
alonearoundbasechemicalcontinuedfollowedgrouphistoryindustrialindustryinvestmentsmineralspolicypresenceproducedproductionstandardsystemtreat
SHARED TOKENS (19): "alone", "around", "base", "chemical", "continued", "followed", "group", "history", "industrial", "industry", "investments", "minerals", "policy", "presence", "produced", "production", "standard", "system", "treat". | EXACT TITLE in geology: "Gold".
0.500
Phosphate ↗ Q46220103 EXACT TITLE
agriculturearoundcontaingroupgrowthimportanceimportantindustrykeyleadmajormeansnamesplacerolesource
SHARED TOKENS (16): "agriculture", "around", "contain", "group", "growth", "importance", "important", "industry", "key", "lead", "major", "means", "names", "place", "role", "source". | EXACT TITLE in geology: "Phosphate".
0.500
architectureartificialcannotcentralcomplexconcernsconstructiondatadescribesdesigndifferentdistinctionengineeringenvironmentalequipmentfieldgeneralintelligencelearningmachine
SHARED TOKENS (36): "architecture", "artificial", "cannot", "central", "complex", "concerns", "construction", "data", "describes", "design", "different", "distinction", "engineering", "environmental", "equipment", "field", "general", "intelligence", "learning", "machine".... | EXACT TITLE in technology: "Computer science".
0.500
Neogene ↗ Q103924 EXACT TITLE
agocannotclimateconnectioncontinuedearlierendfollowedgloballatelatermillionmodernnearpacificplacesystem
SHARED TOKENS (17): "ago", "cannot", "climate", "connection", "continued", "earlier", "end", "followed", "global", "late", "later", "million", "modern", "near", "pacific", "place", "system". | EXACT TITLE in geology: "Neogene".
0.500
actchangeschemicalcontrolcoordinationdirectlyengineersenvironmentalfederalfundinglawmajormodernphysicalqualityrecoverytreatmentwastewaterwater
SHARED TOKENS (19): "act", "changes", "chemical", "control", "coordination", "directly", "engineers", "environmental", "federal", "funding", "law", "major", "modern", "physical", "quality", "recovery", "treatment", "wastewater", "water". | EXACT TITLE in geology: "Clean Water Act".
0.500
Materials science ↗ EXACT TITLE
academicanalystsaroundbegancontrolcreatedcriticaldescribeddesigndistinctengineeringengineersfieldhistoryinstitutionsknowledgemajormaterialmaterialsperformance
SHARED TOKENS (30): "academic", "analysts", "around", "began", "control", "created", "critical", "described", "design", "distinct", "engineering", "engineers", "field", "history", "institutions", "knowledge", "major", "material", "materials", "performance".... | EXACT TITLE in geology: "Materials science". | EXACT TITLE in technology: "Materials science".
0.500
advancedaroundbridgechemicalcommercialconsumercontaincriticaldatadefensedemanddescribesdifferenteffectselectronicsenvironmentalglobalgovernmentimportanceindustrial
SHARED TOKENS (39): "advanced", "around", "bridge", "chemical", "commercial", "consumer", "contain", "critical", "data", "defense", "demand", "describes", "different", "effects", "electronics", "environmental", "global", "government", "importance", "industrial".... | EXACT TITLE in geology: "Rare-earth element".
0.500
agricultureairbuildingscreatedcriticalformedinfrastructurelargermaterialnetworkspowerproblemsproducedproductsstructuressupplysystemstransportationwater
SHARED TOKENS (19): "agriculture", "air", "buildings", "created", "critical", "formed", "infrastructure", "larger", "material", "networks", "power", "problems", "produced", "products", "structures", "supply", "systems", "transportation", "water". | EXACT TITLE in geology: "Volcanic ash".
0.500
aroundbecomebillionbusinessescomconsultingcontractcreateddatadevelopeddirectlydistributionequipmentestablishfollowedgovernmenthistoryindustrylargelater
SHARED TOKENS (39): "around", "become", "billion", "businesses", "com", "consulting", "contract", "created", "data", "developed", "directly", "distribution", "equipment", "establish", "followed", "government", "history", "industry", "large", "later".... | EXACT TITLE in technology: "Hewlett-Packard".
0.500
Equifax ↗ Q5384453 EXACT TITLE
agenciesannualbillionbusinessesconsumerdatadirectlyheadquarteredinvestmentsmillionmonitoringnearlyoperatespacificpreventionreporting
SHARED TOKENS (16): "agencies", "annual", "billion", "businesses", "consumer", "data", "directly", "headquartered", "investments", "million", "monitoring", "nearly", "operates", "pacific", "prevention", "reporting". | EXACT TITLE in technology: "Equifax".
0.500
actcommoditycompliancedepartmentdifferentdistrictsdivisionfederallabormeansofficeoperationsorganizedprocessingsafetysmall
SHARED TOKENS (16): "act", "commodity", "compliance", "department", "different", "districts", "division", "federal", "labor", "means", "office", "operations", "organized", "processing", "safety", "small". | EXACT TITLE in geology: "Mine Safety and Health Administration".
0.500
activecapitalchangescontroldescribeddevelopmentexpansionfinancefinancialfirmsgeneralinvestmentinvestmentslong-termmanagementoperationalprivateproductproductspublic
SHARED TOKENS (22): "active", "capital", "changes", "control", "described", "development", "expansion", "finance", "financial", "firms", "general", "investment", "investments", "long-term", "management", "operational", "private", "product", "products", "public".... | EXACT TITLE in technology: "Private equity".
0.500
accesscreateddatadifferentdigitalinteractionsorganizationplatformsproducedprofilepublicrecordssecuritysocialsystems
SHARED TOKENS (15): "access", "created", "data", "different", "digital", "interactions", "organization", "platforms", "produced", "profile", "public", "records", "security", "social", "systems". | EXACT TITLE in technology: "Digital identity".
0.500
businessescloudconsumerdevelopmentdigitalelectronicsmanufacturingproductsresearchsiliconsoftwarestoragesupporttechnologyvalley
SHARED TOKENS (15): "businesses", "cloud", "consumer", "development", "digital", "electronics", "manufacturing", "products", "research", "silicon", "software", "storage", "support", "technology", "valley". | EXACT TITLE in technology: "Technology company".
0.500
Erosion ↗ Q80026 EXACT TITLE
actagriculturealreadyanotherchemicalclimatecontroldistincteffectsenvironmentalflowflowsfollowedgloballandlayersmaterialmaterialsphysicalprevention
SHARED TOKENS (27): "act", "agriculture", "already", "another", "chemical", "climate", "control", "distinct", "effects", "environmental", "flow", "flows", "followed", "global", "land", "layers", "material", "materials", "physical", "prevention".... | EXACT TITLE in geology: "Erosion".
0.500
becomecentercomplexcontrolcreatescriticaldatadesigneddirectengineeringfailsimportantindustryleadmeansperformancepoliticalpowerprocessingproduction
SHARED TOKENS (25): "become", "center", "complex", "control", "creates", "critical", "data", "designed", "direct", "engineering", "fails", "important", "industry", "lead", "means", "performance", "political", "power", "processing", "production".... | EXACT TITLE in technology: "Redundancy (engineering)".
0.500
Data center ↗ Q671224 EXACT TITLE
approximatelyaroundartificialcenterclimatecloudcontinuitycontrolscriticaldatademanddesignedgeendenvironmentalfacilitiesfinancialglobalgrowthimportant
SHARED TOKENS (50): "approximately", "around", "artificial", "center", "climate", "cloud", "continuity", "controls", "critical", "data", "demand", "design", "edge", "end", "environmental", "facilities", "financial", "global", "growth", "important".... | EXACT TITLE in technology: "Data center".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectschemicalenvironmentalgroupimportantindustrylargerleadmineralspeopleproblemproductionproductsresearchriskrolesemiconductorsitessmalltherefore
SHARED TOKENS (21): "affects", "chemical", "environmental", "group", "important", "industry", "larger", "lead", "minerals", "people", "problem", "production", "products", "research", "risk", "role", "semiconductor", "sites", "small", "therefore".... | EXACT TITLE in geology: "Arsenic".
0.480
Tungsten ↗ Q743 EXACT TITLE
chemicalconstructiondensitydistinctimportantindustrialisolatedleadmajormaterialpointremainingstandardwork
SHARED TOKENS (14): "chemical", "construction", "density", "distinct", "important", "industrial", "isolated", "lead", "major", "material", "point", "remaining", "standard", "work". | EXACT TITLE in geology: "Tungsten".
0.480
baseeconomyengineersenvironmentalindustrialknowledgematerialsmineralspracticalsciencesourcesstructuralunderstandvalue
SHARED TOKENS (14): "base", "economy", "engineers", "environmental", "industrial", "knowledge", "materials", "minerals", "practical", "science", "sources", "structural", "understand", "value". | EXACT TITLE in geology: "Economic geology".
0.480
Gallium ↗ Q861 EXACT TITLE
artificialbecomeschemicalcomplexelectronicsnearpointpressureproductionrolestandardstructuresystemswater
SHARED TOKENS (14): "artificial", "becomes", "chemical", "complex", "electronics", "near", "point", "pressure", "production", "role", "standard", "structure", "systems", "water". | EXACT TITLE in geology: "Gallium".
0.480
Copper ↗ Q753 EXACT TITLE
anotherbuildingbuildingschemicalcomplexcontaincreatedirectlyearlyhistoricallylatermaterialmineralssurface
SHARED TOKENS (14): "another", "building", "buildings", "chemical", "complex", "contain", "create", "directly", "early", "historically", "later", "material", "minerals", "surface". | EXACT TITLE in geology: "Copper".
0.480
basechangeschemicalengineeringfieldhistorynearoperatingphysicalprocessesresearchsurfaceunderstandwork
SHARED TOKENS (14): "base", "changes", "chemical", "engineering", "field", "history", "near", "operating", "physical", "processes", "research", "surface", "understand", "work". | EXACT TITLE in geology: "Geomorphology".
0.480
accessbegandatadevelopersdevelopmentdigitalearlyglobalmeansnetworksphysicalpowersingletechnology
SHARED TOKENS (14): "access", "began", "data", "developers", "development", "digital", "early", "global", "means", "networks", "physical", "power", "single", "technology". | EXACT TITLE in technology: "Telecommunications".
0.460
Rift ↗ Q473935 EXACT TITLE
activecentralcontaincontinuecreatedfailslevelmajorpointremainsystemsvalleywater
SHARED TOKENS (13): "active", "central", "contain", "continue", "created", "fails", "level", "major", "point", "remain", "systems", "valley", "water". | EXACT TITLE in geology: "Rift".
0.460
boarddepartmentgovernmentidahoinstitutionslandmanagesmillionofficesoperatespreventionprogramspublic
SHARED TOKENS (13): "board", "department", "government", "idaho", "institutions", "land", "manages", "million", "offices", "operates", "prevention", "programs", "public". | EXACT TITLE in geology: "Idaho Department of Lands".
0.460
capitalestatefinancefinancialheadquarteredinvestmentmanagementofficeprivaterealservesspecializedtechnology
SHARED TOKENS (13): "capital", "estate", "finance", "financial", "headquartered", "investment", "management", "office", "private", "real", "serves", "specialized", "technology". | EXACT TITLE in technology: "Iconiq Capital".
0.460
Landslide ↗ Q167903 EXACT TITLE
buildclimatedescribesdevelopmentdisasterevenflowsgloballandpolicyriskroadshallow
SHARED TOKENS (13): "build", "climate", "describes", "development", "disaster", "even", "flows", "global", "land", "policy", "risk", "road", "shallow". | EXACT TITLE in geology: "Landslide".
0.460
basebillionbuildingconcreteconstructionedgematerialmaterialsproducedroadroadsservesstrength
SHARED TOKENS (13): "base", "billion", "building", "concrete", "construction", "edge", "material", "materials", "produced", "road", "roads", "serves", "strength". | EXACT TITLE in geology: "Construction aggregate".
0.460
Cobalt ↗ Q740 EXACT TITLE
activealonecenterchemicaldeepglobalgroupimportantindustrymineralsproducedproductionsmall
SHARED TOKENS (13): "active", "alone", "center", "chemical", "deep", "global", "group", "important", "industry", "minerals", "produced", "production", "small". | EXACT TITLE in geology: "Cobalt".
0.460
billioncapitalestatefinancialfirmsgrowthindustrialmanagementmanufacturingofficesprivaterealtechnology
SHARED TOKENS (13): "billion", "capital", "estate", "financial", "firms", "growth", "industrial", "management", "manufacturing", "offices", "private", "real", "technology". | EXACT TITLE in technology: "Warburg Pincus".
0.460
acquisitionactivecommercialcurrentintelligencelandobservationphysicalplanningremotesciencesignalsurface
SHARED TOKENS (13): "acquisition", "active", "commercial", "current", "intelligence", "land", "observation", "physical", "planning", "remote", "science", "signal", "surface". | EXACT TITLE in geology: "Remote sensing".
0.440
Ransomware ↗ Q926331 EXACT TITLE
billioncenterdatadigitalearlyfederalfileslawmillionsecuritysoftwarestarting
SHARED TOKENS (12): "billion", "center", "data", "digital", "early", "federal", "files", "law", "million", "security", "software", "starting". | EXACT TITLE in technology: "Ransomware".
0.420
academicadvancedconnectsdepartmentemployersindustrylaborlearningneedsprogramworkers
SHARED TOKENS (11): "academic", "advanced", "connects", "department", "employers", "industry", "labor", "learning", "needs", "program", "workers". | EXACT TITLE in technology: "Registered apprenticeship".
0.420
Tellurium ↗ Q1100 EXACT TITLE
chemicalexposureitselfleadmineralspartlyplaceproductionrelatedsourcespace
SHARED TOKENS (11): "chemical", "exposure", "itself", "lead", "minerals", "partly", "place", "production", "related", "source", "space". | EXACT TITLE in geology: "Tellurium".
0.420
Quartz ↗ Q43010 EXACT TITLE
chemicaldifferentgroupmaterialmineralsplacescalesiliconstructurallythereforevalue
SHARED TOKENS (11): "chemical", "different", "group", "material", "minerals", "place", "scale", "silicon", "structurally", "therefore", "value". | EXACT TITLE in geology: "Quartz".
0.400
Colocation ↗ Q2983522 EXACT TITLE
centerdataequipmentofficepeoplesinglesolvespacestructuresystem
SHARED TOKENS (10): "center", "data", "equipment", "office", "people", "single", "solve", "space", "structure", "system". | EXACT TITLE in technology: "Colocation".
0.400
Basalt ↗ Q43338 EXACT TITLE
chemicaldeepflowsformedimportantmovingnearprocessessurfacesystem
SHARED TOKENS (10): "chemical", "deep", "flows", "formed", "important", "moving", "near", "processes", "surface", "system". | EXACT TITLE in geology: "Basalt".
0.400
Graphite ↗ Q5309 EXACT TITLE
chemicalcriticallargelayersmillionpressureprocessesscalestandarduses
SHARED TOKENS (10): "chemical", "critical", "large", "layers", "million", "pressure", "processes", "scale", "standard", "uses". | EXACT TITLE in geology: "Graphite".
0.400
baseequipmentflowmaterialmineralsmodernpressuresourcesurfacewater
SHARED TOKENS (10): "base", "equipment", "flow", "material", "minerals", "modern", "pressure", "source", "surface", "water". | EXACT TITLE in geology: "Placer mining".
0.400
activedistinctionlargemappedmapsplacereleasesinglesurfacezones
SHARED TOKENS (10): "active", "distinction", "large", "mapped", "maps", "place", "release", "single", "surface", "zones". | EXACT TITLE in geology: "Fault (geology)".
0.400
beyondfieldimportantmajorprocessessciencesystemsystemstoolsuses
SHARED TOKENS (10): "beyond", "field", "important", "major", "processes", "science", "system", "systems", "tools", "uses". | EXACT TITLE in geology: "Geochemistry".
0.400
Permira ↗ Q662030 EXACT TITLE
billioncapitalfirmsglobalinvestmentofficesoperatingpeopleprivatespecialists
SHARED TOKENS (10): "billion", "capital", "firms", "global", "investment", "offices", "operating", "people", "private", "specialists". | EXACT TITLE in technology: "Permira".
0.400
Floodplain ↗ Q193110 EXACT TITLE
advantagebasecontroldevelopedimportantlandnearriskvalleywater
SHARED TOKENS (10): "advantage", "base", "control", "developed", "important", "land", "near", "risk", "valley", "water". | EXACT TITLE in geology: "Floodplain".
0.400
Ore ↗ Q102798 EXACT TITLE
complexcontainsformedmaterialmineralsprocessprocessesthereforetreatedvalue
SHARED TOKENS (10): "complex", "contains", "formed", "material", "minerals", "process", "processes", "therefore", "treated", "value". | EXACT TITLE in geology: "Ore". | EXACT TITLE in technology: "Ore".
0.400
connectsdeepdesignengineeringlayershallowstructurestructuressupportingwater
SHARED TOKENS (10): "connects", "deep", "design", "engineering", "layer", "shallow", "structure", "structures", "supporting", "water". | EXACT TITLE in geology: "Foundation (engineering)". | EXACT TITLE in technology: "Foundation (engineering)".
0.400
Export control ↗ EXACT TITLE
controlcontrolsdepartmentexportgovernmentlocalpotentiallyrequiressoftwaretechnology
SHARED TOKENS (10): "control", "controls", "department", "export", "government", "local", "potentially", "requires", "software", "technology". | EXACT TITLE in technology: "Export control".
0.400
approximatelyaroundcentralcontainscreatedidaholargerlatemillionsmaller
SHARED TOKENS (10): "approximately", "around", "central", "contains", "created", "idaho", "larger", "late", "million", "smaller". | EXACT TITLE in geology: "Idaho Batholith".
0.380
Pliocene ↗ Q76259 EXACT TITLE
agoendfollowedmajormillionolderpriorregionalscale
SHARED TOKENS (9): "ago", "end", "followed", "major", "million", "older", "prior", "regional", "scale". | EXACT TITLE in geology: "Pliocene".
0.380
Quaternary ↗ Q26185 EXACT TITLE
agochangesclimatecurrentenvironmentalgrowthmillionrelatedscale
SHARED TOKENS (9): "ago", "changes", "climate", "current", "environmental", "growth", "million", "related", "scale". | EXACT TITLE in geology: "Quaternary".
0.380
boisedepartmentenvironmentalfederalgovernmentidahoofficesqualityregional
SHARED TOKENS (9): "boise", "department", "environmental", "federal", "government", "idaho", "offices", "quality", "regional". | EXACT TITLE in geology: "Idaho Department of Environmental Quality".
0.380
designdevelopmentdiscoveryengineeringmineralsoperationsplansprocessingproduction
SHARED TOKENS (9): "design", "development", "discovery", "engineering", "minerals", "operations", "plans", "processing", "production". | EXACT TITLE in geology: "Mining engineering".
0.380
departmentdevelopmentidahoinsurancelabormanagedprocessestechnologyworkforce
SHARED TOKENS (9): "department", "development", "idaho", "insurance", "labor", "managed", "processes", "technology", "workforce". | EXACT TITLE in technology: "Idaho Department of Labor".
0.380
financialinvestmentorganizationprocessingrecordsrelationshipsreportingsoftwaresystem
SHARED TOKENS (9): "financial", "investment", "organization", "processing", "records", "relationships", "reporting", "software", "system". | EXACT TITLE in technology: "Financial software".
0.380
Tectonics ↗ Q193343 EXACT TITLE
buildingdirectlyfieldglobalgrowthimportantprocessprocessesstructure
SHARED TOKENS (9): "building", "directly", "field", "global", "growth", "important", "process", "processes", "structure". | EXACT TITLE in geology: "Tectonics".
0.380
highlyindustrymanufacturingpowerscalesemiconductortreatedtreatmentwater
SHARED TOKENS (9): "highly", "industry", "manufacturing", "power", "scale", "semiconductor", "treated", "treatment", "water". | EXACT TITLE in geology: "Ultrapure water".
0.360
Tantalum ↗ Q1123 EXACT TITLE
chemicalequipmentgrouphighlyindustrialmaterialpointsources
SHARED TOKENS (8): "chemical", "equipment", "group", "highly", "industrial", "material", "point", "sources". | EXACT TITLE in geology: "Tantalum".
0.360
agoanothercreatedformedidaholargeplacescale
SHARED TOKENS (8): "ago", "another", "created", "formed", "idaho", "large", "place", "scale". | EXACT TITLE in geology: "Yellowstone hotspot".
0.360
arounddistributiongeothermalidahooperatespowerpurchasedutility
SHARED TOKENS (8): "around", "distribution", "geothermal", "idaho", "operates", "power", "purchased", "utility". | EXACT TITLE in technology: "Idaho Power".
0.360
continuedfieldlaborleveloutsidepeoplesystemtraining
SHARED TOKENS (8): "continued", "field", "labor", "level", "outside", "people", "system", "training". | EXACT TITLE in technology: "Apprenticeship".
0.360
anotherbuildingconstructionformedgroupindustrymaterialminerals
SHARED TOKENS (8): "another", "building", "construction", "formed", "group", "industry", "material", "minerals". | EXACT TITLE in geology: "Aggregate (geology)".
0.360
chemicalcompliancephysicalqualitysafetysupplytreatmentwater
SHARED TOKENS (8): "chemical", "compliance", "physical", "quality", "safety", "supply", "treatment", "water". | EXACT TITLE in geology: "Water quality".
0.360
Antimony ↗ Q1099 EXACT TITLE
chemicaldirectfollowedhistoryindustrialleadproductionsemiconductor
SHARED TOKENS (8): "chemical", "direct", "followed", "history", "industrial", "lead", "production", "semiconductor". | EXACT TITLE in geology: "Antimony".
0.360
constructionengineeringknowledgematerialsproblemsrelatedsolveuses
SHARED TOKENS (8): "construction", "engineering", "knowledge", "materials", "problems", "related", "solve", "uses". | EXACT TITLE in geology: "Geotechnical engineering".
0.360
HP Inc. ↗ Q21404084 EXACT TITLE
headquartersitselflegalproductrelatedservingsuppliestechnology
SHARED TOKENS (8): "headquarters", "itself", "legal", "product", "related", "serving", "supplies", "technology". | EXACT TITLE in technology: "HP Inc.".
0.360
buildingdistributionfieldhistoryimportantsciencestructuralunderstand
SHARED TOKENS (8): "building", "distribution", "field", "history", "important", "science", "structural", "understand". | EXACT TITLE in geology: "Structural geology".
0.340
activebegandevelopmentendfieldidaholate
SHARED TOKENS (7): "active", "began", "development", "end", "field", "idaho", "late". | EXACT TITLE in geology: "Owyhee Mountains".
0.340
departmentdevelopmentgrowthidaholevelpublictax
SHARED TOKENS (7): "department", "development", "growth", "idaho", "level", "public", "tax". | EXACT TITLE in technology: "Idaho Department of Commerce".
0.300
anotherconstructioncreatedependdevelopersdevelopmentenvironmentalfieldindustrylandmaterialmaterialsmunicipalphysicalpressureprogramprogramsregulatoryriskstreatment
SHARED TOKENS (21): "another", "construction", "create", "depend", "developers", "development", "environmental", "field", "industry", "land", "material", "materials", "municipal", "physical", "pressure", "program", "programs", "regulatory", "risks", "treatment"....
0.300
abilityarchitecturebuildclouddatademanddigitaldistributedinfrastructurelargelargermanagementmapnodenodesoperatingprocessingrequirescalesites
SHARED TOKENS (22): "ability", "architecture", "build", "cloud", "data", "demand", "digital", "distributed", "infrastructure", "large", "larger", "management", "map", "node", "nodes", "operating", "processing", "require", "scale", "sites"....
0.300
annualbillionconsumerdesigndevelopmentelectronicsgrowthindustrylawmarketmaterialnetworkspowerproducingproductionresearchsemiconductorsingletechnologywider
SHARED TOKENS (20): "annual", "billion", "consumer", "design", "development", "electronics", "growth", "industry", "law", "market", "material", "networks", "power", "producing", "production", "research", "semiconductor", "single", "technology", "wider".
0.300
Meta Platforms ↗ Q380 KW CROSS HIGH
billiondescribeddevelopmentdigitalglobalheadquarteredmarketnetworkoperatesplatformspublicresearchsitessocialstrategictechnology
SHARED TOKENS (16): "billion", "described", "development", "digital", "global", "headquartered", "market", "network", "operates", "platforms", "public", "research", "sites", "social", "strategic", "technology".
0.300
analysisbecomecomplexdependsdesigndifferenteconomicsengineersevenfailslayersmaterialsmechanismpresencepressurerequirerequiresriskroadsafety
SHARED TOKENS (28): "analysis", "become", "complex", "depends", "design", "different", "economics", "engineers", "even", "fails", "layers", "materials", "mechanism", "presence", "pressure", "require", "requires", "risk", "road", "safety"....
0.300
Moore's law ↗ Q178655 KW CROSS HIGH
annualanotheraroundbecomecapacitychangescontinuedescribesdevelopmentdigitalelectronicsevenexecutivegrowthhistoricalindustrylawlong-termobservationplanning
SHARED TOKENS (25): "annual", "another", "around", "become", "capacity", "changes", "continue", "describes", "development", "digital", "electronics", "even", "executive", "growth", "historical", "industry", "law", "long-term", "observation", "planning"....
0.300
Mineralogy ↗ Q83353 EXACT TITLE
distributionmineralsphysicalprocessesstructure
SHARED TOKENS (5): "distribution", "minerals", "physical", "processes", "structure". | EXACT TITLE in geology: "Mineralogy".
0.300
academicdistincteducationinstitutionintendedjobslearningnearlyoperatespeoplepracticalprogramprogramsstudentsuniversityworkworkforce
SHARED TOKENS (17): "academic", "distinct", "education", "institution", "intended", "jobs", "learning", "nearly", "operates", "people", "practical", "program", "programs", "students", "university", "work", "workforce".
0.300
Rocky Mountains ↗ Q5463 KW CROSS HIGH
agobegandistinctendformeditselfmajormillionmineralsnearpointpublicshallowsystemwestern
SHARED TOKENS (15): "ago", "began", "distinct", "end", "formed", "itself", "major", "million", "minerals", "near", "point", "public", "shallow", "system", "western".
0.300
Holocene ↗ Q25445 KW CROSS HIGH
agoapproximatelyaroundbeganclimatecontinuedcurrentdevelopmentdistinctfutureglobalgrowthhistorylargelatemajoroutside
SHARED TOKENS (17): "ago", "approximately", "around", "began", "climate", "continued", "current", "development", "distinct", "future", "global", "growth", "history", "large", "late", "major", "outside".
0.300
E-government ↗ Q211017 KW CROSS HIGH
accessagenciesbuildbusinesseschangescontinueddigitaldirectdirectlyeducationfastergovernmentinteractionsitselfmanagementmeansnationalorganizationprocessprocesses
SHARED TOKENS (25): "access", "agencies", "build", "businesses", "changes", "continued", "digital", "direct", "directly", "education", "faster", "government", "interactions", "itself", "management", "means", "national", "organization", "process", "processes"....
0.300
advancedaircentralcontaincontrolcreatecreatedendequipmentfacilitieshandlinghighlyindustrialindustryinsidelargemachinemanufacturingmaterialmaterials
SHARED TOKENS (32): "advanced", "air", "central", "contain", "control", "create", "created", "end", "equipment", "facilities", "handling", "highly", "industrial", "industry", "inside", "large", "machine", "manufacturing", "material", "materials"....
0.300
Soil mechanics ↗ Q471872 KW CROSS HIGH
airanalysisarticlebridgebuildingcapacitycontainsdependentdescribesdistinctionengineeringflowpipelinepressurerelatedstrengthstructuressystemswater
SHARED TOKENS (19): "air", "analysis", "article", "bridge", "building", "capacity", "contains", "dependent", "describes", "distinction", "engineering", "flow", "pipeline", "pressure", "related", "strength", "structures", "systems", "water".
0.300
constructioncurrentengineeringexistingformedhistoryimportantlandlargelayersmineralspartlyphysicalplaceprocessroadssourcesourcesstructuralstructure
SHARED TOKENS (23): "construction", "current", "engineering", "existing", "formed", "history", "important", "land", "large", "layers", "minerals", "partly", "physical", "place", "process", "roads", "source", "sources", "structural", "structure"....
0.300
Pleistocene ↗ Q25546 KW CROSS HIGH
agoaroundbridgeclimateconnectioncontinuedearlierearlyendexpansionhighlyisolatedlandlargelatemillionmodernoutside
SHARED TOKENS (18): "ago", "around", "bridge", "climate", "connection", "continued", "earlier", "early", "end", "expansion", "highly", "isolated", "land", "large", "late", "million", "modern", "outside".
0.300
Drilling rig ↗ Q12688575 KW CROSS HIGH
basecomplexconstructioncontaincrewsenvironmentalequipmentevenhousinglandlargelargerphysicalplatformsremotesmallstructuressupplysurfacesystem
SHARED TOKENS (23): "base", "complex", "construction", "contain", "crews", "environmental", "equipment", "even", "housing", "land", "large", "larger", "physical", "platforms", "remote", "small", "structures", "supply", "surface", "system"....
0.300
Network security ↗ KW CROSS HIGH
accessagenciesbusinessescontrolcontrolsdatagovernmentinstitutionsjobsnetworknetworksoperationsprivateprocessesprogramspublicsecuritysimple
SHARED TOKENS (18): "access", "agencies", "businesses", "control", "controls", "data", "government", "institutions", "jobs", "network", "networks", "operations", "private", "processes", "programs", "public", "security", "simple".
0.300
Fracking ↗ Q890794 KW CROSS HIGH
becomescreatedivisionflowgeneralhistoryindustrypressureprocessproductionpublicsmallsourcetreatmentwater
SHARED TOKENS (15): "becomes", "create", "division", "flow", "general", "history", "industry", "pressure", "process", "production", "public", "small", "source", "treatment", "water".
0.300
Volcanology ↗ Q102904 EXACT TITLE
activecurrentmajorproductsrelated
SHARED TOKENS (5): "active", "current", "major", "products", "related". | EXACT TITLE in geology: "Volcanology".
0.300
agriculturedepartmentdevelopmentfederallandmajormanagementmanagesmillionnationalofficeoperationsprivateresearchsystem
SHARED TOKENS (15): "agriculture", "department", "development", "federal", "land", "major", "management", "manages", "million", "national", "office", "operations", "private", "research", "system".
0.300
capacitycommodityconversiondatademanddifferentdigitaldirectlyearlyelectronicsfasterkeymajormanufacturersmarketmodernneedneedspowerprocess
SHARED TOKENS (28): "capacity", "commodity", "conversion", "data", "demand", "different", "digital", "directly", "early", "electronics", "faster", "key", "major", "manufacturers", "market", "modern", "need", "needs", "power", "process"....
0.300
Flash memory ↗ Q174077 KW CROSS HIGH
accessadvantagearchitecturebecomebegancapabilitiesdatadesigndifferentdigitaldirectdirectlyelectronicsfastergeneralindustrialinsidekeylargelayers
SHARED TOKENS (36): "access", "advantage", "architecture", "become", "began", "capabilities", "data", "design", "different", "digital", "direct", "directly", "electronics", "faster", "general", "industrial", "inside", "key", "large", "layers"....
0.300
actanalystsbillionchaindevelopmentdivisiondomesticequipmentfederalfundingindustryinvestmentinvestmentsjobslawmanufacturingmaterialspublicresearchresilience
SHARED TOKENS (32): "act", "analysts", "billion", "chain", "development", "division", "domestic", "equipment", "federal", "funding", "industry", "investment", "investments", "jobs", "law", "manufacturing", "materials", "public", "research", "resilience"....
0.300
airattentioncentraldesigneddevelopmentmodernoperatingpowerprocessprocessingproducedsinglesmallsystemsystems
SHARED TOKENS (15): "air", "attention", "central", "designed", "development", "modern", "operating", "power", "process", "processing", "produced", "single", "small", "system", "systems".
0.300
boiseconsumercreateddatademandelectronicsidahomajormanufacturersmarketproducedproductssemiconductorstoragetechnology
SHARED TOKENS (15): "boise", "consumer", "created", "data", "demand", "electronics", "idaho", "major", "manufacturers", "market", "produced", "products", "semiconductor", "storage", "technology".
0.300
Plate tectonics ↗ Q7950 KW CROSS HIGH
activeagobillionbuildingdensitydevelopededgeformedimportanceinsidelargelatemajormodelmovingprocessprocessesshowsstrongestsurface
SHARED TOKENS (20): "active", "ago", "billion", "building", "density", "developed", "edge", "formed", "importance", "inside", "large", "late", "major", "model", "moving", "process", "processes", "shows", "strongest", "surface".
0.300
Gold rush ↗ Q273182 KW CROSS HIGH
becomebeyonddescribeddiscoverydistributedearlyenvironmentalfacilitiesgeneralglobalhistoryimportantinvestmentitselflargelocalmajormineralspeopleplace
SHARED TOKENS (26): "become", "beyond", "described", "discovery", "distributed", "early", "environmental", "facilities", "general", "global", "history", "important", "investment", "itself", "large", "local", "major", "minerals", "people", "place"....
0.300
Smart city ↗ Q1231558 KW CROSS HIGH
alreadybuildingsbusinessescapitalconnectdatadigitaleducationflowsfuturegovernmentinfrastructurelocalmodelneedsnetworknetworkspeopleperformanceplan
SHARED TOKENS (33): "already", "buildings", "businesses", "capital", "connect", "data", "digital", "education", "flows", "future", "government", "infrastructure", "local", "model", "needs", "network", "networks", "people", "performance", "plan"....
0.300
agoaroundbeganchainschangesclimateearlylargermajormillionnationalpointsmallvalleywestern
SHARED TOKENS (15): "ago", "around", "began", "chains", "changes", "climate", "early", "larger", "major", "million", "national", "point", "small", "valley", "western".
0.300
aroundbegandepartmenteducationengineersenvironmentalexecutivefederalfederallyfinancialgovernmentheadquarterslegallevellocalmattersmonitoringnationalofficespermitting
SHARED TOKENS (26): "around", "began", "department", "education", "engineers", "environmental", "executive", "federal", "federally", "financial", "government", "headquarters", "legal", "level", "local", "matters", "monitoring", "national", "offices", "permitting"....
0.300
Remote work ↗ Q1135326 KW CROSS HIGH
accessanotheraroundbeganbridgecloudconferencecontrolsdevelopeddistributedemployersenvironmentalevenlargeleadnetworkofficeofficesremotescale
SHARED TOKENS (28): "access", "another", "around", "began", "bridge", "cloud", "conference", "controls", "developed", "distributed", "employers", "environmental", "even", "large", "lead", "network", "office", "offices", "remote", "scale"....
0.300
becomescriticaldatadigitalfieldfinanceinfrastructureleadmodernnetworknetworksphysicalpowerprocessessecuritysoftwaresystemstechnologytherefore
SHARED TOKENS (19): "becomes", "critical", "data", "digital", "field", "finance", "infrastructure", "lead", "modern", "network", "networks", "physical", "power", "processes", "security", "software", "systems", "technology", "therefore".
0.300
Help desk ↗ Q2055062 KW CROSS HIGH
analystsdepartmentdevelopmentdifferentknowledgelargelevelmanagersorganizationplanningpositionproblemsproductproductsresearchsimplespecializedstructuresupportsystems
SHARED TOKENS (25): "analysts", "department", "development", "different", "knowledge", "large", "level", "managers", "organization", "planning", "position", "problems", "product", "products", "research", "simple", "specialized", "structure", "support", "systems"....
0.300
anotherconcernscriticalcurriculumdepartmentdevelopmenteconomicseconomyeducationengineeringgrouplabornationalnetpeoplepolicypoliticalrelatedsciencesecurity
SHARED TOKENS (28): "another", "concerns", "critical", "curriculum", "department", "development", "economics", "economy", "education", "engineering", "group", "labor", "national", "net", "people", "policy", "political", "related", "science", "security"....
0.300
buildingchangeschemicalconstructionengineeringexistingformedlandlargelayersphysicalpressureprocessprocessessurface
SHARED TOKENS (15): "building", "changes", "chemical", "construction", "engineering", "existing", "formed", "land", "large", "layers", "physical", "pressure", "process", "processes", "surface".
0.300
actagenciesaroundcreateddesignedeffectsenvironmentalexecutivefederalgovernmentlawnationalpolicyqualityreportsrequires
SHARED TOKENS (16): "act", "agencies", "around", "created", "designed", "effects", "environmental", "executive", "federal", "government", "law", "national", "policy", "quality", "reports", "requires".
0.300
Colluvium ↗ Q1152275 EXACT TITLE
basegeneralmaterialprocessessurface
SHARED TOKENS (5): "base", "general", "material", "processes", "surface". | EXACT TITLE in geology: "Colluvium".
0.300
Ore genesis ↗ Q7100977 KW CROSS HIGH
actactiveanalysischemicalcommoditycurrentindustrylargemechanismmineralsmovingphysicalpositionprocesssource
SHARED TOKENS (15): "act", "active", "analysis", "chemical", "commodity", "current", "industry", "large", "mechanism", "minerals", "moving", "physical", "position", "process", "source".
0.300
agenciesbuildingsconstructiondesignengineeringfirmsglobalgovernmentinfrastructuremaintenancemunicipalnationalphysicalplaceprivatepublicroadssectorstructuralsystems
SHARED TOKENS (20): "agencies", "buildings", "construction", "design", "engineering", "firms", "global", "government", "infrastructure", "maintenance", "municipal", "national", "physical", "place", "private", "public", "roads", "sector", "structural", "systems".
0.300
annualbillioncapacitychemicaleconomyelectronicsgroupidahoimportantlandmajormanufacturingprocessingproductproducts
SHARED TOKENS (15): "annual", "billion", "capacity", "chemical", "economy", "electronics", "group", "idaho", "important", "land", "major", "manufacturing", "processing", "product", "products".
0.300
centercurrentdatadepartmentfederalgovernmentheadquarteredmajormakesmapsnearofficesorganizationpeoplepublicregulatoryresearchsciencespacework
SHARED TOKENS (20): "center", "current", "data", "department", "federal", "government", "headquartered", "major", "makes", "maps", "near", "offices", "organization", "people", "public", "regulatory", "research", "science", "space", "work".
0.300
Boise River ↗ Q891080 EXACT TITLE
approximatelyboisehighlyidahowestern
SHARED TOKENS (5): "approximately", "boise", "highly", "idaho", "western". | EXACT TITLE in geology: "Boise River".
0.300
academicanalysisanothercapacitycommercialconnectingcontrolcoredevelopmentfundingglobalgovernmentimportantindustrialinstitutionsknowledgemarketmeansmovingorganization
SHARED TOKENS (29): "academic", "analysis", "another", "capacity", "commercial", "connecting", "control", "core", "development", "funding", "global", "government", "important", "industrial", "institutions", "knowledge", "market", "means", "moving", "organization"....
🫐 BERRY45 edges
0.280
accesscenterchemicaldepartmentemergencylocalnetworkoperatorspeoplepointpublicsafetysystemtrained
SHARED TOKENS (14): "access", "center", "chemical", "department", "emergency", "local", "network", "operators", "people", "point", "public", "safety", "system", "trained".
0.280
aroundavailabilitybeganclouddevelopmenteconomyinfrastructuremodeloperatingphysicalproductsscalesoftwaresystems
SHARED TOKENS (14): "around", "availability", "began", "cloud", "development", "economy", "infrastructure", "model", "operating", "physical", "products", "scale", "software", "systems".
0.280
idaholandmajornorthwest
SHARED TOKENS (4): "idaho", "land", "major", "northwest". | EXACT TITLE in geology: "Snake River Plain".
0.280
begancenterdatadesigndistributedearlyedgemodelnearnetworksplacesourcesstoragesystems
SHARED TOKENS (14): "began", "center", "data", "design", "distributed", "early", "edge", "model", "near", "networks", "place", "sources", "storage", "systems".
0.280
Petrology ↗ Q163082 EXACT TITLE
chemicalmodernprocessesstructure
SHARED TOKENS (4): "chemical", "modern", "processes", "structure". | EXACT TITLE in geology: "Petrology".
0.280
lawlayersrelatedrelationships
SHARED TOKENS (4): "law", "layers", "related", "relationships". | EXACT TITLE in geology: "Stratigraphy".
0.280
Fraud ↗ Q28813 EXACT TITLE
anotheritselflawlegal
SHARED TOKENS (4): "another", "itself", "law", "legal". | EXACT TITLE in technology: "Fraud".
0.280
buildcontroldesignmanagementneedsnetworkorganizationprocessqualityreportsupportsystemstechnologyuses
SHARED TOKENS (14): "build", "control", "design", "management", "needs", "network", "organization", "process", "quality", "report", "support", "systems", "technology", "uses".
0.260
actdiscoveryfederalformedgenerallandlatelawleadmineralsolderpublicsystem
SHARED TOKENS (13): "act", "discovery", "federal", "formed", "general", "land", "late", "law", "lead", "minerals", "older", "public", "system".
0.260
HP LaserJet ↗ Q4040290 KW CROSS HIGH
basedifferentearlyhistorylargerlatermodelnamesofficesreportedservingsuppliestechnology
SHARED TOKENS (13): "base", "different", "early", "history", "larger", "later", "model", "names", "offices", "reported", "serving", "supplies", "technology".
0.260
chainscriticaldemandexpansionimportantmaterialsmineralsnationalrolesciencesecuritystrategicsupply
SHARED TOKENS (13): "chains", "critical", "demand", "expansion", "important", "materials", "minerals", "national", "role", "science", "security", "strategic", "supply".
0.260
actbusinessesemployersfederalgroupinsurancejobslawnationalplansrequirerequiresworkers
SHARED TOKENS (13): "act", "businesses", "employers", "federal", "group", "insurance", "jobs", "law", "national", "plans", "require", "requires", "workers".
0.260
actactivecontrolcreateddepartmenteffectsenvironmentalfederallawofficeprogramsregulatorysurface
SHARED TOKENS (13): "act", "active", "control", "created", "department", "effects", "environmental", "federal", "law", "office", "programs", "regulatory", "surface".
0.260
Alluvium ↗ Q6185405 EXACT TITLE
describedhighlywater
SHARED TOKENS (3): "described", "highly", "water". | EXACT TITLE in geology: "Alluvium".
0.240
basechangesclimatecreateearlierflowhighlylandleadlevelpointsystem
SHARED TOKENS (12): "base", "changes", "climate", "create", "earlier", "flow", "highly", "land", "lead", "level", "point", "system".
0.240
Angel investor ↗ Q778274 KW CROSS HIGH
approximatelybusinessescapitalearlyinvestmentinvestorsnearlynetworksprivaterisksmallsupport
SHARED TOKENS (12): "approximately", "businesses", "capital", "early", "investment", "investors", "nearly", "networks", "private", "risk", "small", "support".
0.220
formedsurface
SHARED TOKENS (2): "formed", "surface". | EXACT TITLE in geology: "Terrace (geology)".
0.220
actenvironmentalfederalintendedlawprivatepublicqualitysystemsystemswater
SHARED TOKENS (11): "act", "environmental", "federal", "intended", "law", "private", "public", "quality", "system", "systems", "water".
0.220
demandinfrastructurelong-termmanagedmanagementmanagesmodelsectorsystemstechnicaltechnology
SHARED TOKENS (11): "demand", "infrastructure", "long-term", "managed", "management", "manages", "model", "sector", "systems", "technical", "technology".
0.220
centerdatadata-centerdescribesdevelopedequipmentglobalinfrastructurepowerstandarduses
SHARED TOKENS (11): "center", "data", "data-center", "describes", "developed", "equipment", "global", "infrastructure", "power", "standard", "uses".
0.220
adaboisecentercentralcontainsidahoitselfnationalroadsvalleywestern
SHARED TOKENS (11): "ada", "boise", "center", "central", "contains", "idaho", "itself", "national", "roads", "valley", "western".
0.200
LTE ↗ Q247385 EXACT TITLE
topics
EXACT TITLE in geology: "LTE". | EXACT TITLE in technology: "LTE".
0.200
changesdeepdifferenthistoricalhistoryprocessesscalestructuralsurfaceuses
SHARED TOKENS (10): "changes", "deep", "different", "historical", "history", "processes", "scale", "structural", "surface", "uses".
0.200
Watershed ↗ Q4018542 EXACT TITLE
topicswatershed
EXACT TITLE in geology: "Watershed".
0.200
Fluorite ↗ Q102151 KW CROSS HIGH
belongscomplexdensitymineralsproductionscalesourceusesvaluevisible
SHARED TOKENS (10): "belongs", "complex", "density", "minerals", "production", "scale", "source", "uses", "value", "visible".
0.200
Enfusion ↗ Q5377362 EXACT TITLE
EXACT TITLE in technology: "Enfusion".
0.200
Graben ↗ Q192810 EXACT TITLE
blockfaultsgeologygrabennormal
EXACT TITLE in geology: "Graben".
0.200
basedevelopeddevelopmentevaluationhistoricalmineralsreportingsitestandardsystems
SHARED TOKENS (10): "base", "developed", "development", "evaluation", "historical", "minerals", "reporting", "site", "standard", "systems".
0.200
buildingbuildingscapacityconnectscoredifferentlargeneedsnetworknetworks
SHARED TOKENS (10): "building", "buildings", "capacity", "connects", "core", "different", "large", "needs", "network", "networks".
0.180
Core sample ↗ Q1942237 KW CROSS HIGH
concretecoredatadevelopmentdifferentequipmentmaterialsprocesstechnology
SHARED TOKENS (9): "concrete", "core", "data", "development", "different", "equipment", "materials", "process", "technology".
0.180
Sedimentology ↗ Q205768 KW CROSS HIGH
formedhistorylayersmodernphysicalprocessesrelationshipsstructuressurface
SHARED TOKENS (9): "formed", "history", "layers", "modern", "physical", "processes", "relationships", "structures", "surface".
0.180
Reserved word ↗ Q1192029 KW CROSS HIGH
adaanothercannotdistinctfollowednamesstandardtreattreated
SHARED TOKENS (9): "ada", "another", "cannot", "distinct", "followed", "names", "standard", "treat", "treated".
0.180
adaboisecapitalidaholocalnorthwestpacificprivateroads
SHARED TOKENS (9): "ada", "boise", "capital", "idaho", "local", "northwest", "pacific", "private", "roads".
0.160
dependsdescribesdistributedlargemodelneedsurfacewater
SHARED TOKENS (8): "depends", "describes", "distributed", "large", "model", "need", "surface", "water".
0.160
actfundinghighlylargerorganizationprocessprogramspublic
SHARED TOKENS (8): "act", "funding", "highly", "larger", "organization", "process", "programs", "public".
0.140
anotherlocalnetworksplaceproductresearchersvisible
SHARED TOKENS (7): "another", "local", "networks", "place", "product", "researchers", "visible".
0.140
Igneous rock ↗ Q42045 KW CROSS HIGH
existingformedlargeplatformspressureprocessessurface
SHARED TOKENS (7): "existing", "formed", "large", "platforms", "pressure", "processes", "surface".
0.140
deeperlargermineralsnearriskssafetysurface
SHARED TOKENS (7): "deeper", "larger", "minerals", "near", "risks", "safety", "surface".
0.140
Great Basin ↗ Q966943 KW CROSS HIGH
climateidaholargenearlypointvalleywestern
SHARED TOKENS (7): "climate", "idaho", "large", "nearly", "point", "valley", "western".
0.140
Freight exchange ↗ KW CROSS HIGH
airboardcapacityneedneedsprivateroad
SHARED TOKENS (7): "air", "board", "capacity", "need", "needs", "private", "road".
0.120
accessclouddemandnetworkorganizationphysical
SHARED TOKENS (6): "access", "cloud", "demand", "network", "organization", "physical".
0.120
boisecentercontainsfederallyidahovalley
SHARED TOKENS (6): "boise", "center", "contains", "federally", "idaho", "valley".
0.100
developedenvironmentallandpublicrisk
SHARED TOKENS (5): "developed", "environmental", "land", "public", "risk".
0.100
approximatelyboisecanyoncollegeidaho
SHARED TOKENS (5): "approximately", "boise", "canyon", "college", "idaho".
0.100
accesscommercialorganizationorganizedrelated
SHARED TOKENS (5): "access", "commercial", "organization", "organized", "related".
◈ Frequently Asked Questions
Geology × Technology — Treasure Valley
HAIKU · HIGH GATE
How do Treasure Valley geological surveys support semiconductor manufacturing in Boise?
Geological mapping of Ada County's subsurface conditions informs site selection and foundation design for semiconductor fabrication plants around Boise. Boise State University's geology programs provide technical expertise on groundwater availability and soil stability, factors critical to semiconductor facility operations.
What role does Canyon County geology play in technology infrastructure development in Nampa?
Canyon County's volcanic geology and mineral composition affect site preparation for technology parks and data centers in Nampa. College of Western Idaho coordinates with local geology research to assess land stability for development, ensuring reliable physical infrastructure for technology operations.
How do geographic information systems map Treasure Valley geology for technology planning?
GIS technology layers geological data from Boise, Meridian, Eagle, and Kuna to identify optimal locations for technology campuses and industrial development. Boise State University and College of Western Idaho use GIS-integrated geology to advise public and private technology sector planning across the Treasure Valley.
Why do technology engineers in the Treasure Valley need geological knowledge during development projects?
Engineers designing technology facilities in Ada and Canyon counties must understand local geology to address seismic risk, drainage, and soil composition specific to sites in Boise, Nampa, and surrounding areas. Boise State's engineering and geology programs teach integrated approaches to ensure technology infrastructure withstands Treasure Valley physical conditions.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Geology × Technology 11 QID bridges 211 edges 5,704 ext links 2026-07-17 21:01:12 UTC 5d7dec54e2f4d033
Geology corridor ↗ Technology corridor ↗ Technology × Geology ↗ boisestandard.org/standard ↗
Parent Corridors
Geology × All Other Verticals