—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Geology ↔ relates to ↔ Military

14 Wikipedia bridge articles confirmed in both vertical ledgers. 256 deterministic cross-vertical edges. 6,806 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
256 Cross Edges
6,806 External Sources
285 Wikipedia Articles
17 🌲 Evergreen
187 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Geology
× Military
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
256
External Sources Harvested
6,806
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Bureau of Land Management
score: 1.0000  ·  type: exact_title_cross  ·  40 shared tokens
QID Bridge Titles (14)
Bureau of Land ManagementIdahoTreasure ValleyBoise State UniversityCollege of Western IdahoSnake River PlainUnited States Forest ServiceBoise, IdahoNational Environmental Policy ActNampa, IdahoOwyhee County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmilesmetropolitanlandwesternmillionnationalrivervalleycollegecanyonamongapproximatelyfederalpubliccapitalnorthwestsnake
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:59:50 UTC
Content Hash
65aa12200cacbab0
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
Bureau of Land Management
EXACT TITLE 1.000
QID OVERLAP: Q1010556 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (40): "act", "agencies", "among", "approximately", "blm", "bureau", "conservation", "created", "department", "energy", "estate", "existing", "federal", "future", "general", "government", "groups", "headquartered", "health", "historic".... | EXACT TITLE in geology: "Bureau of Land Management". | EXACT TITLE in military: "Bureau of Land Management".
actagenciesamongapproximatelyblmbureauconservationcreateddepartmentenergyestateexistingfederalfuturegeneralgovernmentgroupsheadquarteredhealthhistoricidaholandlandslandscapemanagementmilesmillionmissionmontananational+10
ages the federal government's nearly 700 million acres (2,800,000 km2) of subsurface mineral estate located beneath federal, state and private lands severed from their surface rights by the Homestead Act of 1862. Most BLM public lands are located in these 12 western states: Alaska, Arizona, California, Colorado, Idaho, Montana, Nevada, New Mexico, Oregon, Utah, Washington and Wyoming. The mission of the BLM is "to sustain the health, diversity, and productivity of the public lands for the use and enjoyment of present and future generations." Originally BLM holdings were described as "land nobody wanted" because homesteaders had passed them by. All the same, ranchers hold nearly 18,000 permits and leases for livestock grazing on 155 million acres (630,000 km2) of BLM public lands. The agency manages 263 wilderness areas, 31 national monuments and some 710 other protected areas as part of the National Conservation Lands (formerly known as the National Landscape Conservation System), totaling about 39.5 million acres (160,000 km2). In addition the National Conservation Lands include nearly 2,700 miles of Wild and Scenic Rivers, and nearly 6,000 miles of National Scenic and Historic Trails. There are more than 63,000 oil and gas wells on BLM public lands.
The BLM's roots go back to the Land Ordinance of 1785 and the Northwest Ordinance of 1787. These laws provided for the survey and settlement of the lands that the original Thirteen Colonies ceded to the federal government after the American Revolution. As additional lands were acquired by the United States from Spain, France and other countries, the United States Congress directed that they be explored, surveyed, and made available for settlement. During the Revolutionary War, military bounty land was promised to soldiers who fought for the colonies. After the war, the Treaty of Paris of 1783, signed by the United States, the UK, France, and Spain, ceded territory to the United States. In the 1780s, other states relinquished their own claims to land in modern-day Ohio. By this time, the United States needed revenue to function and land was sold as a source of income for the government. In order to sell the land, surveys needed to be conducted. The Land Ordinance of 1785 instructed a geographer to oversee this work as undertaken by a group of surveyors. The first years of surveying were completed by trial and error; once the territory of Ohio had been surveyed, a modern public land survey system had been developed. In 1812, Congress established the United States General Land Office as part of the Department of the Treasury to oversee the disposition of these federal lands. By the early 1800s, promised bounty land claims were finally fulfilled. In the 19th century, other bounty land and homestead laws were enacted to dispose of federal land. Several different types of patents existed. These include cash entry, credit, homestead, Indian, military warrants, mineral certificates, private land claims, railroads, state selections, swamps, town sites, and town lots. A system of local land offices spread throughout the territories, patenting land that was surveyed via the corresponding Office of the Surveyor General of a particular territory. This pattern gradually spread across the entire United States. The laws that spurred this system with the exception of the General Mining Law of 1872 and the Desert Land Act of 1877 have since been repealed or superseded. In the early 20th century, Congress took additional steps toward recognizing the value of the assets on public lands and directed the Executive Branch to manage activities on the remaining public lands. The Mineral Leasing Act of 1920 allowed leasing, exploration, and production of selected commodities, such as coal, oil, gas, and sodium to take place on public lands. The Taylor Grazing Act of 1934 established the United States Grazing Service to manage the public rangelands by establishment of advisory boards that set grazing fees.
Establishment and early history In 1946, the Grazing Service was merged with the United States General Land Office to form the Bureau of Land Management within the Department of the Interior. It took several years for this new agency to integrate and reorganize. In the end, the Bureau of Land Management became less focused on land disposal and more focused on the long term management and preservation of the land. The agency achieved its current form by combining offices in the western states and creating a corresponding office for lands both east of and alongside the Mississippi River. As a matter of course, the BLM's emphasis fell on activities in the western states as most of the mining, land sales, and federally owned areas are located west of the Mississippi. BLM personnel on the ground have typically been oriented toward local interests, while bureau management in Washington are led by presidential guidance. By means of the Federal Land Policy and Management Act of 1976, Congress created a more unified bureau mission and recognized the value of the remaining public lands by declaring that these lands would remain in public ownership. The law directed that these lands be managed with a view toward "multiple use" defined as "management of the public lands and their various resource values so that they are utilized in the combination that will best meet the present and future needs of the American people." Since the Reagan administration in the 1980s, Republicans have often given priority to local control and to grazing, mining and petroleum production, while Democrats have more often emphasized environmental concerns even when granting mining and drilling leases. In September 1996, then President Bill Clinton used his authority under the Antiquities Act to establish the Grand Staircase–Escalante National Monument in southern Utah, the first of now 20 national monuments established on BLM lands and managed by the agency. The establishment of Grand Staircase–Escalante foreshadowed later creation of the BLM's National Landscape Conservation System in 2000.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (35): "approximately", "around", "associated", "boise", "capital", "contains", "distinct", "economy", "forest", "geographic", "idaho", "land", "linked", "manufacturing", "miles", "million", "mining", "montana", "mountain", "national".... | EXACT TITLE in geology: "Idaho". | EXACT TITLE in military: "Idaho".
approximatelyaroundassociatedboisecapitalcontainsdistincteconomyforestgeographicidaholandlinkedmanufacturingmilesmillionminingmontanamountainnationalnorthwestofficialorganizedpopulationpriorriversectorseparatesignificantsmall+5
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (15): "boise", "historically", "idaho", "land", "local", "metropolitan", "owyhee", "primarily", "resources", "river", "snake", "terrain", "treasure", "valley", "western". | EXACT TITLE in geology: "Treasure Valley". | EXACT TITLE in military: "Treasure Valley".
boisehistoricallyidaholandlocalmetropolitanowyheeprimarilyresourcesriversnaketerraintreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (21): "activity", "among", "boise", "college", "compete", "division", "economics", "education", "engineering", "health", "idaho", "institution", "million", "mountain", "program", "programs", "public", "reported", "research", "universities".... | EXACT TITLE in geology: "Boise State University". | EXACT TITLE in military: "Boise State University".
activityamongboisecollegecompetedivisioneconomicseducationengineeringhealthidahoinstitutionmillionmountainprogramprogramspublicreportedresearchuniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (26): "academic", "ada", "boise", "canyon", "career", "college", "community", "cwi", "development", "dual", "education", "idaho", "large", "population", "programs", "public", "reported", "southern", "southwest", "students".... | EXACT TITLE in geology: "College of Western Idaho". | EXACT TITLE in military: "College of Western Idaho".
academicadaboisecanyoncareercollegecommunitycwidevelopmentdualeducationidaholargepopulationprogramspublicreportedsouthernsouthweststudentstechnicaltransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Snake River Plain
Q1396049 EXACT TITLE 0.900
QID OVERLAP: Q1396049 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (10): "idaho", "land", "major", "miles", "northwest", "primarily", "river", "snake", "southern", "wide". | EXACT TITLE in geology: "Snake River Plain".
idaholandmajormilesnorthwestprimarilyriversnakesouthernwide
The Snake River Plain is a geologic feature located primarily within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain has a significant effect on the climate of Yellowstone National Park and the adjacent areas to the south and west of Yellowstone. Over time, the Yellowstone hotspot left a 70-mile (110 km) wide channel through the Rocky Mountains. This channel is in line with the gap between the Cascade Range and the Sierra Nevada. The result is a moisture channel extending from the Pacific Ocean to Yellowstone. Moisture from the Pacific Ocean streams onshore in the form of clouds and humid air. It passes through the gap between the Sierra and Cascades and into the Snake River Plain where it is channeled through most of the Rocky Mountains with no high plateaus or mountain ranges to impede its progress. It finally encounters upslope conditions at the head of the Snake River Valley at Ashton, Idaho; at Island Park, Idaho; at the Teton Range east of Driggs, Idaho; and at the Yellowstone Plateau of Yellowstone National Park where the channeled moisture precipitates out as rain and snow. The result is a localized climate on the eastern side of the Rockies that is akin to a climate on the west slope of the Cascades or the northern Sierra. The head of the Snake River Valley, the Tetons, and the Yellowstone Plateau receive much more precipitation than other areas of the region, and the area is known for being wet, green, having many streams, and having abundant snow in winter. Although the topography of the Plain has largely gone unchanged for several million years, this region's climate has not been so constant. Current climatic conditions began to characterize the region in the early Pleistocene (approximately 2.5 million years ago). However, the arid climate of today was born from the gradual dissipation of a climate defined by greater moisture and narrower ranges of annual temperatures.
United States Forest Service
Q1891156 QID OVERLAP 0.800
QID OVERLAP: Q1891156 in geology (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (18): "bureau", "covering", "department", "development", "federal", "forest", "land", "lands", "major", "management", "million", "national", "office", "operations", "private", "research", "system", "wildlife".
bureaucoveringdepartmentdevelopmentfederalforestlandlandsmajormanagementmillionnationalofficeoperationsprivateresearchsystemwildlife
ederal lands and is the sole major national land management agency not part of the U.S. Department of the Interior (which manages the National Park Service, the U.S. Fish and Wildlife Service and the Bureau of Land Management). History In 1876, Congress formed the office of Special Agent in the Department of Agriculture to assess the quality and conditions of forests in the United States. Franklin B. Hough was appointed the head of the office. In 1881, the office was expanded into the newly formed Division of Forestry. The Forest Reserve Act of 1891 authorized withdrawing land from the public domain as forest reserves managed by the Department of the Interior. In 1901, the Division of Forestry was renamed the Bureau of Forestry. The Transfer Act of 1905 transferred the management of forest reserves from the United States General Land Office of the Interior Department to the Bureau of Forestry, henceforth known as the United States Forest Service. Gifford Pinchot was the first United States chief forester in the presidency of Theodore Roosevelt. A historical note to include is that the National Park Service was created in 1916 to manage Yellowstone and several other parks; in 1956, the Fish and Wildlife Service became the manager of lands reserved for wildlife. The Grazing Service and the United States General Land Office were combined to create the Bureau of Land Management in 1946. Also of note was that it was not until 1976 that the Federal Land Policy and Management Act became the national policy for retaining public land for federal ownership. Significant federal legislation affecting the Forest Service includes the Weeks Act of 1911, the Taylor Grazing Act of 1934, P.L. 73-482; the Multiple Use – Sustained Yield Act of 1960, P.L. 86-517; the Wilderness Act, P.L. 88-577; the National Forest Management Act, P.L. 94-588; the National Environmental Policy Act, P.L. 91–190; the Cooperative Forestry Assistance Act, P.L. 95-313; and the Forest and Rangelands Renewable Resources Planning Act, P.L. 95-307. From the early 1900s to the present, there has been a fierce rivalry over control of forests between the Department of Agriculture and the Department of the Interior. Their roles overlap but numerous proposals to combine the two have failed. In 2009, the Government Accountability Office (GAO) evaluated whether the Forest Service should be moved from the Department of Agriculture to the Department of the Interior, which already manages some 438 million acres (1,770,000 km2) of public land through the National Park Service, the Fish and Wildlife Service, and the Bureau of Land Management. GAO ultimately did not offer a recommendation upon the conclusion of its performance audit. The Forest Service remains a part of the USDA. In March 2026, President Donald Trump announced his plans to move the Forest Service's headquarters from Washington D.C.
In 1876, Congress formed the office of Special Agent in the Department of Agriculture to assess the quality and conditions of forests in the United States. Franklin B. Hough was appointed the head of the office. In 1881, the office was expanded into the newly formed Division of Forestry. The Forest Reserve Act of 1891 authorized withdrawing land from the public domain as forest reserves managed by the Department of the Interior. In 1901, the Division of Forestry was renamed the Bureau of Forestry. The Transfer Act of 1905 transferred the management of forest reserves from the United States General Land Office of the Interior Department to the Bureau of Forestry, henceforth known as the United States Forest Service. Gifford Pinchot was the first United States chief forester in the presidency of Theodore Roosevelt. A historical note to include is that the National Park Service was created in 1916 to manage Yellowstone and several other parks; in 1956, the Fish and Wildlife Service became the manager of lands reserved for wildlife. The Grazing Service and the United States General Land Office were combined to create the Bureau of Land Management in 1946. Also of note was that it was not until 1976 that the Federal Land Policy and Management Act became the national policy for retaining public land for federal ownership. Significant federal legislation affecting the Forest Service includes the Weeks Act of 1911, the Taylor Grazing Act of 1934, P.L. 73-482; the Multiple Use – Sustained Yield Act of 1960, P.L. 86-517; the Wilderness Act, P.L. 88-577; the National Forest Management Act, P.L. 94-588; the National Environmental Policy Act, P.L. 91–190; the Cooperative Forestry Assistance Act, P.L. 95-313; and the Forest and Rangelands Renewable Resources Planning Act, P.L. 95-307. From the early 1900s to the present, there has been a fierce rivalry over control of forests between the Department of Agriculture and the Department of the Interior. Their roles overlap but numerous proposals to combine the two have failed. In 2009, the Government Accountability Office (GAO) evaluated whether the Forest Service should be moved from the Department of Agriculture to the Department of the Interior, which already manages some 438 million acres (1,770,000 km2) of public land through the National Park Service, the Fish and Wildlife Service, and the Bureau of Land Management. GAO ultimately did not offer a recommendation upon the conclusion of its performance audit. The Forest Service remains a part of the USDA. In March 2026, President Donald Trump announced his plans to move the Forest Service's headquarters from Washington D.C.
Admiralty Island National Monument – Alaska Giant Sequoia National Monument – California Misty Fjords National Monument – Alaska Mount St. Helens National Volcanic Monument – Washington Newberry National Volcanic Monument – Oregon Santa Rosa and San Jacinto Mountains National Monument – California (jointly with the Bureau of Land Management) The Forest Service also manages Grey Towers National Historic Site in Milford, Pennsylvania, the home and estate of its first Chief, Gifford Pinchot. Fighting fires By 1935, the U.S. Forest Service's fire management policy stipulated that all wildfires were to be suppressed by 10 am the morning after they were first spotted. In August 1944, to reduce the number of forest fires, the Forest Service and the Wartime Advertising Council began distributing fire education posters featuring a black bear. The poster campaign was a success; the black bear would later be named Smokey Bear, and would, for decades, be the "spokesbear" for the Forest Service. Smokey Bear has appeared in innumerable TV commercials; his popular catch phrase, "Only YOU can prevent forest fires"—later changed to wildfires—is one of the most widely recognized slogans in the United States. According to the Advertising Council, Smokey Bear is the most recognized icons in advertising history and has appeared almost everywhere via Public Service Announcements in print, radio, television. Smokey Bear, an icon protected by law, is jointly owned by the Forest Service, the Ad Council and the National Association of State Foresters. In 1965, at the request of the Joint Chiefs of Staff, the Forest Service was commissioned by the Advanced Research Projects Agency (ARPA) to research the use of forest fire as a military weapon. A report was published in June 1970 and declassified in May 1983. In September 2000, the Departments of Agriculture and the Interior developed a plan to respond to the fires of 2000, to reduce the impacts of these wildland fires on rural communities, and to ensure sufficient firefighting resources in the future. The report is entitled "Managing the Impacts of Wildfire on Communities and the Environment: A Report to the President In Response to the Wildfires of 2000"—The National Fire Plan for short. The National Fire Plan continues to be an integral part of the Forest Service today.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in geology (tier:branch) and military (tier:branch). | SHARED TOKENS (17): "ada", "annual", "block", "boise", "capital", "employers", "idaho", "locally", "major", "manufacturing", "metropolitan", "miles", "population", "river", "technology", "treasure", "valley".
adaannualblockboisecapitalemployersidaholocallymajormanufacturingmetropolitanmilespopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
National Environmental Policy Act
Q6972479 QID OVERLAP 0.800
QID OVERLAP: Q6972479 in geology (tier:evergreen) and military (tier:branch). | SHARED TOKENS (23): "act", "agencies", "around", "created", "decisions", "designed", "effects", "environment", "environmental", "federal", "government", "impacts", "law", "laws", "national", "policy", "potential", "proposed", "quality", "requirements"....
actagenciesaroundcreateddecisionsdesignedeffectsenvironmentenvironmentalfederalgovernmentimpactslawlawsnationalpolicypotentialproposedqualityrequirementsrequiresrequiringsignificant
The National Environmental Policy Act (NEPA) is a United States environmental law designed to promote the enhancement of the environment. It created new laws requiring U.S. federal government agencies to evaluate the environmental impacts of their actions and decisions, and it established the President's Council on Environmental Quality (CEQ). The act was passed by the U.S. Congress in December 1969 and signed into law by President Richard Nixon on January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
Environmental Quality (CEQ). The act was passed by the U.S. Congress in December 1969 and signed into law by President Richard Nixon on January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in geology (tier:branch) and military (tier:branch). | SHARED TOKENS (13): "according", "boise", "canyon", "college", "comes", "idaho", "metropolitan", "miles", "northwest", "population", "principal", "university", "western".
accordingboisecanyoncollegecomesidahometropolitanmilesnorthwestpopulationprincipaluniversitywestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Owyhee County, Idaho
Q491316 QID OVERLAP 0.740
QID OVERLAP: Q491316 in geology (tier:branch) and military (tier:branch). | SHARED TOKENS (12): "associated", "boise", "center", "contains", "extends", "federally", "idaho", "metropolitan", "owyhee", "population", "tribal", "valley".
associatedboisecentercontainsextendsfederallyidahometropolitanowyheepopulationtribalvalley
contains slightly more than half of the Duck Valley Indian Reservation, which extends over the Nevada border, into Elko County. The majority of the federally recognized Shoshone-Paiute Tribe that is associated with this reservation lives on the Nevada side; its tribal center is in Owyhee, Nevada. History This area was the territory of Western Shoshone, Northern Paiute, and Bannock peoples and their ancestors for thousands of years prior to the arrival of European settlers. Settler interests in securing land and resources spurred conflict and led to the indigenous peoples being forced onto reservations. On December 31, 1863, Owyhee County became the first county organized by the Idaho Territory Legislature. While Boise, Idaho, Nez Perce, and Shoshone counties were organized under the laws of Washington Territory, they were not recognized by the Idaho Territory until February 1864. The original county seat at Ruby City was moved to nearby Silver City in 1867. Owyhee County's original boundary was the portion of Idaho Territory south of the Snake River and west of the Rocky Mountains. Less than a month after the creation of Owyhee County, Oneida County was formed in January 1864 from the eastern portion of the county. The formation of Cassia County in 1879 took further territory in the east. Owyhee County's history is closely linked to the mining boom that dominated Idaho Territory in the second half of the 19th century. Silver City and Ruby City developed as boom towns. At its height in the 1880s, Owyhee County was among the most populous places in Idaho. Today it is among the least populous, at 1.4 persons per square mile (0.54 persons/km2). Because of pressure from miners and settlers, the federal government made a treaty in 1877 with the Western Shoshone to cede land, and established what is now known as the Duck Valley Indian Reservation in this county and across the border in Elko County, Nevada. The reservation was expanded in 1886 to accommodate people of the Northern Paiute. In the 20th century, the tribes combined and are federally recognized as a single government; the majority of the people live on the Nevada side of the reservation. There were two railroad lines extending into Owyhee County, the first was the Boise Nampa & Owyhee Railroad which built starting in 1896 from Nampa, Idaho south towards Melba, Idaho and eventually across the Snake River into Owyhee County in 1897, whereupon it crossed Rabbit Creek before arriving in Murphy, Idaho. The first train into Murphy occurred in 1899. The Boise, Nampa & Owyhee Railroad was acquired by the Idaho Northern Railroad in 1907; the line was taken over by the Oregon Short Line Railroad in 1913 following their purchase of the Idaho Northern Railroad, after which it became known as the Murphy Branch line. Daily passenger service to Murphy was discontinued in 1942. By 1947, shipping animals out of Murphy was no longer profitable for the railroad. The Murphy portion of the line was abandoned in 1947. In the 1950s, trucks and highways became the dominant mode of transportation. The last train left Melba in 1994, and all rails were torn out in that same year. The second railroad line was the Oregon Shortline Railroad which built south from Nyssa Oregon beginning in 1911, passing through Adrian Oregon the line ended after 25 miles in Homedale Idaho, in 1922 it was extended Marsing Idaho to accommodate additional agricultural traffic. In 1970, the Marsing and Homedale depots were closed by Union Pacific. In 1987, with declining carload, Union Pacific offered the line for sale but no buyers were found. Following the closure of the lumber mill in Homedale in the early 1990s, the Homedale branch (now reduced to the status of an "industrial lead") generated a total of 49 carloads in 1995 and 42 in 1996. In 1997, Union Pacific filed for permission to abandon the Idaho portion of the line and received no formal protest, the tracks were ripped up the following year. Owyhee County gained its present boundaries in 1930 after an election approved moving a portion of it near Glenns Ferry and King Hill to neighboring Elmore County. In 1934, the county seat was moved from the nearly abandoned Silver City to its present location in Murphy.
020 census, the population was 11,913. The county seat is Murphy, and its largest city is Homedale. In area it is the second-largest county in Idaho, behind Idaho County. Owyhee County is part of the Boise metropolitan area and contains slightly more than half of the Duck Valley Indian Reservation, which extends over the Nevada border, into Elko County.
History This area was the territory of Western Shoshone, Northern Paiute, and Bannock peoples and their ancestors for thousands of years prior to the arrival of European settlers. Settler interests in securing land and resources spurred conflict and led to the indigenous peoples being forced onto reservations. On December 31, 1863, Owyhee County became the first county organized by the Idaho Territory Legislature. While Boise, Idaho, Nez Perce, and Shoshone counties were organized under the laws of Washington Territory, they were not recognized by the Idaho Territory until February 1864. The original county seat at Ruby City was moved to nearby Silver City in 1867. Owyhee County's original boundary was the portion of Idaho Territory south of the Snake River and west of the Rocky Mountains. Less than a month after the creation of Owyhee County, Oneida County was formed in January 1864 from the eastern portion of the county. The formation of Cassia County in 1879 took further territory in the east. Owyhee County's history is closely linked to the mining boom that dominated Idaho Territory in the second half of the 19th century. Silver City and Ruby City developed as boom towns. At its height in the 1880s, Owyhee County was among the most populous places in Idaho. Today it is among the least populous, at 1.4 persons per square mile (0.54 persons/km2). Because of pressure from miners and settlers, the federal government made a treaty in 1877 with the Western Shoshone to cede land, and established what is now known as the Duck Valley Indian Reservation in this county and across the border in Elko County, Nevada. The reservation was expanded in 1886 to accommodate people of the Northern Paiute. In the 20th century, the tribes combined and are federally recognized as a single government; the majority of the people live on the Nevada side of the reservation. There were two railroad lines extending into Owyhee County, the first was the Boise Nampa & Owyhee Railroad which built starting in 1896 from Nampa, Idaho south towards Melba, Idaho and eventually across the Snake River into Owyhee County in 1897, whereupon it crossed Rabbit Creek before arriving in Murphy, Idaho. The first train into Murphy occurred in 1899. The Boise, Nampa & Owyhee Railroad was acquired by the Idaho Northern Railroad in 1907; the line was taken over by the Oregon Short Line Railroad in 1913 following their purchase of the Idaho Northern Railroad, after which it became known as the Murphy Branch line. Daily passenger service to Murphy was discontinued in 1942. By 1947, shipping animals out of Murphy was no longer profitable for the railroad. The Murphy portion of the line was abandoned in 1947. In the 1950s, trucks and highways became the dominant mode of transportation. The last train left Melba in 1994, and all rails were torn out in that same year. The second railroad line was the Oregon Shortline Railroad which built south from Nyssa Oregon beginning in 1911, passing through Adrian Oregon the line ended after 25 miles in Homedale Idaho, in 1922 it was extended Marsing Idaho to accommodate additional agricultural traffic. In 1970, the Marsing and Homedale depots were closed by Union Pacific. In 1987, with declining carload, Union Pacific offered the line for sale but no buyers were found. Following the closure of the lumber mill in Homedale in the early 1990s, the Homedale branch (now reduced to the status of an "industrial lead") generated a total of 49 carloads in 1995 and 42 in 1996. In 1997, Union Pacific filed for permission to abandon the Idaho portion of the line and received no formal protest, the tracks were ripped up the following year. Owyhee County gained its present boundaries in 1930 after an election approved moving a portion of it near Glenns Ferry and King Hill to neighboring Elmore County. In 1934, the county seat was moved from the nearly abandoned Silver City to its present location in Murphy.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in geology (tier:branch) and military (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in geology (tier:branch) and military (tier:evergreen). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "population".
boisecaldwellcanyonidahomakingmetropolitanpopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in geology (tier:branch) and military (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "making", "population".
adaamongboisecapitalidahomakingpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
242 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP242 edges
🌲 EVERGREEN3 edges
0.650
armyboiseelementsfieldformationgowenheadquarteredheadquartersidahomilitarymontananationalriversnakesupportunitunits
SHARED TOKENS (17): "army", "boise", "elements", "field", "formation", "gowen", "headquartered", "headquarters", "idaho", "military", "montana", "national", "river", "snake", "support", "unit", "units". | URL->B (1): https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "116th Cavalry Brigade Combat Team".
0.650
actapproximatelyarmybureauchaptercodecomponentcoordinationcreatedeligiblefederalidaholocalmilitarynationalorganizationorganizedpresentprotectionsection
SHARED TOKENS (24): "act", "approximately", "army", "bureau", "chapter", "code", "component", "coordination", "created", "eligible", "federal", "idaho", "local", "military", "national", "organization", "organized", "present", "protection", "section".... | URL->B (3): https://www.imd.idaho.gov/idaho-army-national-guard/, https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "Idaho Army National Guard".
0.630
airarmyboisegeneralheadquarteredidahojurisdictionmilitarynationalofficereservethoughunitunits
SHARED TOKENS (14): "air", "army", "boise", "general", "headquartered", "idaho", "jurisdiction", "military", "national", "office", "reserve", "though", "unit", "units". | URL->B (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in military: "Idaho Air National Guard".
🌿 BRANCH187 edges
0.590
airbaseboisefederalfieldgowenidahomilitarynationaloperatessupportunit
SHARED TOKENS (12): "air", "base", "boise", "federal", "field", "gowen", "idaho", "military", "national", "operates", "support", "unit". | URL->B (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in military: "124th Fighter Wing".
0.510
boisefieldgowenhistoryidahomilitaryneartraining
SHARED TOKENS (8): "boise", "field", "gowen", "history", "idaho", "military", "near", "training". | URL->B (1): https://www.idahomilitarymuseum.org/. | EXACT TITLE in military: "Idaho Military History Museum".
0.500
anotherconditionsconstructioncreatedevelopmentecologicalenvironmentalfieldhealthindustrylandmaterialmaterialsmediamunicipalphysicalprogramprogramsprojectsregulatory
SHARED TOKENS (25): "another", "conditions", "construction", "create", "development", "ecological", "environmental", "field", "health", "industry", "land", "material", "materials", "media", "municipal", "physical", "program", "programs", "projects", "regulatory".... | EXACT TITLE in military: "Environmental remediation".
0.500
amongapproximatelyboisecompetedivisionidaholaterofficesoperatesprimarilyprofessionalpublicresearchstatewidestudentsuniversity
SHARED TOKENS (16): "among", "approximately", "boise", "compete", "division", "idaho", "later", "offices", "operates", "primarily", "professional", "public", "research", "statewide", "students", "university". | EXACT TITLE in geology: "University of Idaho".
0.500
Geology ↗ Q1069 EXACT TITLE
academicanalysiscentralcomesdemonstratedescribesdescriptiondisciplineengineeringenvironmentalformationhistoryimportantintegratedmajormodernphysicalpropertiesprovidingresources
SHARED TOKENS (24): "academic", "analysis", "central", "comes", "demonstrate", "describes", "description", "discipline", "engineering", "environmental", "formation", "history", "important", "integrated", "major", "modern", "physical", "properties", "providing", "resources".... | EXACT TITLE in geology: "Geology".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherbeginsbroadconsistsconstructioncontainscreatecreateddrillingenvironmentalhistoricallymaterialmodernneedsoccurplacingpointpotentialprovide
SHARED TOKENS (30): "access", "another", "begins", "broad", "consists", "construction", "contains", "create", "created", "drilling", "environmental", "historically", "material", "modern", "needs", "occur", "placing", "point", "potential", "provide".... | EXACT TITLE in geology: "Well". | EXACT TITLE in military: "Well".
0.500
airbaseboiseidahomilesmissionmountainnearoperationspersonnelpopulationprovidesouthwestsupporttrainingunitwestern
SHARED TOKENS (17): "air", "base", "boise", "idaho", "miles", "mission", "mountain", "near", "operations", "personnel", "population", "provide", "southwest", "support", "training", "unit", "western". | EXACT TITLE in military: "Mountain Home Air Force Base".
0.500
Uranium ↗ Q1098 EXACT TITLE
anotherconcentrationconsistscostsdegreedensitydifferentdiscoveryelementsenergyenoughenvironmentalevenfacilitiesfuelfuturehealthindustrialindustrymaking
SHARED TOKENS (34): "another", "concentration", "consists", "costs", "degree", "density", "different", "discovery", "elements", "energy", "enough", "environmental", "even", "facilities", "fuel", "future", "health", "industrial", "industry", "making".... | EXACT TITLE in geology: "Uranium".
0.500
affectedconstructioncontinuingdirectlydisasteremergencyespeciallyestablishinggovernmenthealthimproveinfrastructureinitiallimitedmanagementneedspermanentplacespresentprovide
SHARED TOKENS (25): "affected", "construction", "continuing", "directly", "disaster", "emergency", "especially", "establishing", "government", "health", "improve", "infrastructure", "initial", "limited", "management", "needs", "permanent", "places", "present", "provide".... | EXACT TITLE in geology: "Disaster response". | EXACT TITLE in military: "Disaster response".
0.500
activitiesairapproximatelyconflictgroundindustrialissuespresentresourceresourcesriversmallsourcesourcessupply
SHARED TOKENS (15): "activities", "air", "approximately", "conflict", "ground", "industrial", "issues", "present", "resource", "resources", "river", "small", "source", "sources", "supply". | EXACT TITLE in geology: "Water resources".
0.500
additionalcapacitycombinesconditionscontinuedcostsdepartmentenergyformationgenerationindustrialindustrynearneedsoccursreduceresourcessourcespacesupply
SHARED TOKENS (20): "additional", "capacity", "combines", "conditions", "continued", "costs", "department", "energy", "formation", "generation", "industrial", "industry", "near", "needs", "occurs", "reduce", "resources", "source", "space", "supply". | EXACT TITLE in geology: "Geothermal energy".
0.500
activityanotherconcernsconservationdesigndesigneddevelopeddistributionenergyengineeringgoverningimpactslawslocalplacesqualitysuppliessystemsystemsthough
SHARED TOKENS (20): "activity", "another", "concerns", "conservation", "design", "designed", "developed", "distribution", "energy", "engineering", "governing", "impacts", "laws", "local", "places", "quality", "supplies", "system", "systems", "though". | EXACT TITLE in geology: "Hydrogeology".
0.500
Mining ↗ Q44497 EXACT TITLE
activitiesaffectedanalysisassociatedcannotcommunitiescommunitycontainscostsdependentenergyenvironmentalespeciallyevenhabitathealthimpactsinvestmentlaborland
SHARED TOKENS (41): "activities", "affected", "analysis", "associated", "cannot", "communities", "community", "contains", "costs", "dependent", "energy", "environmental", "especially", "even", "habitat", "health", "impacts", "investment", "labor", "land".... | EXACT TITLE in geology: "Mining". | EXACT TITLE in military: "Mining".
0.500
Silver ↗ Q1090 EXACT TITLE
basisbeyonddemanddigitalelectronicsformimportantindustrialinvestmentmaterialmaterialsminingrolesystemsuses
SHARED TOKENS (15): "basis", "beyond", "demand", "digital", "electronics", "form", "important", "industrial", "investment", "material", "materials", "mining", "role", "systems", "uses". | EXACT TITLE in geology: "Silver".
0.500
Wildfire ↗ Q169950 EXACT TITLE
controlledcreatecreatesdirectdisastereffectsequipmentespeciallyforestfundingglobalgrowthhealthimpactslandland-uselevelsmanagementmaterialmodern
SHARED TOKENS (30): "controlled", "create", "creates", "direct", "disaster", "effects", "equipment", "especially", "forest", "funding", "global", "growth", "health", "impacts", "land", "land-use", "levels", "management", "material", "modern".... | EXACT TITLE in geology: "Wildfire". | EXACT TITLE in military: "Wildfire".
0.500
World War II ↗ Q362 EXACT TITLE
advancedcentralcivilconflictcontinuedcreateddocumententerexpansionfoundationfutureglobalhistorymajormillionnearlypermanentsecuritysettingsocial
SHARED TOKENS (22): "advanced", "central", "civil", "conflict", "continued", "created", "document", "enter", "expansion", "foundation", "future", "global", "history", "major", "million", "nearly", "permanent", "security", "setting", "social".... | EXACT TITLE in military: "World War II".
0.500
activeairarmybecomebureaucomponentcomponentsfederaljurisdictionmakesmilitarynationalreserveroleunits
SHARED TOKENS (15): "active", "air", "army", "become", "bureau", "component", "components", "federal", "jurisdiction", "makes", "military", "national", "reserve", "role", "units". | EXACT TITLE in military: "Air National Guard".
0.500
Groundwater ↗ Q161598 EXACT TITLE
becomecapacitycentralcontaincontainsdistributioneffectsenvironmentalfieldformformationgroundindustrialissueslandmajormunicipaloperatingpresentprovide
SHARED TOKENS (30): "become", "capacity", "central", "contain", "contains", "distribution", "effects", "environmental", "field", "form", "formation", "ground", "industrial", "issues", "land", "major", "municipal", "operating", "present", "provide".... | EXACT TITLE in geology: "Groundwater".
0.500
activitiescreateseffectsenvironmentalhistoryindustriallandlandscapeminingmodernmunicipaloccuroccursphysicalplanningpracticepriorremediationresources
SHARED TOKENS (19): "activities", "creates", "effects", "environmental", "history", "industrial", "land", "landscape", "mining", "modern", "municipal", "occur", "occurs", "physical", "planning", "practice", "prior", "remediation", "resources". | EXACT TITLE in geology: "Mine reclamation".
0.500
activitiesaffectedcommunitydifferentdisasteremergencyfederalimpactslocalmanagementneedsoccurpreventionprofessionalprovidingreducerequiresresponse
SHARED TOKENS (18): "activities", "affected", "community", "different", "disaster", "emergency", "federal", "impacts", "local", "management", "needs", "occur", "prevention", "professional", "providing", "reduce", "requires", "response". | EXACT TITLE in geology: "Emergency management". | EXACT TITLE in military: "Emergency management".
0.500
Lake ↗ Q23397 EXACT TITLE
accountactivitiesapproximatelyaroundcontainingcontrolleddirectlydistinctdomesticecologicalevengenerationindustriallandlargelargermaterialnearofficialpatterns
SHARED TOKENS (23): "account", "activities", "approximately", "around", "containing", "controlled", "directly", "distinct", "domestic", "ecological", "even", "generation", "industrial", "land", "large", "larger", "material", "near", "official", "patterns".... | EXACT TITLE in geology: "Lake".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowingbuildingscompatibledensitydevelopeddevelopmentdifferentformgovernmentgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulatory
SHARED TOKENS (28): "activities", "allowing", "buildings", "compatible", "density", "developed", "development", "different", "form", "government", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "property", "regulatory".... | EXACT TITLE in geology: "Zoning". | EXACT TITLE in military: "Zoning".
0.500
Tungsten ↗ Q743 EXACT TITLE
conditionsconstructiondensitydistinctelementsespeciallyidentifiedimportantindustrialmajormakingmaterialmilitaryminingoccuroccurspointwork
SHARED TOKENS (18): "conditions", "construction", "density", "distinct", "elements", "especially", "identified", "important", "industrial", "major", "making", "material", "military", "mining", "occur", "occurs", "point", "work". | EXACT TITLE in geology: "Tungsten".
0.500
activitiesanalysisassessmentassociatedcivilconditionsconstructioncontentdesigndevelopmentengineeringenvironmentalexperienceinterpretationknowledgemaintenancematerialplanningpracticeprincipal
SHARED TOKENS (37): "activities", "analysis", "assessment", "associated", "civil", "conditions", "construction", "content", "design", "development", "engineering", "environmental", "experience", "interpretation", "knowledge", "maintenance", "material", "planning", "practice", "principal".... | EXACT TITLE in geology: "Engineering geology".
0.500
activeairarmyarticlebasiscomponentscontroldualfederalgovernmentlegallocalmilitarynationalorganizationorganizedpersonnelproposedrequirereserve
SHARED TOKENS (28): "active", "air", "army", "article", "basis", "components", "control", "dual", "federal", "government", "legal", "local", "military", "national", "organization", "organized", "personnel", "proposed", "require", "reserve".... | EXACT TITLE in military: "National Guard (United States)".
0.500
activitiesactivityadministrationadministrativeagenciesanotherchangescivilcontrolcoordinatecreateddecisionsdivisioneducationenforcementenvironmentenvironmentalgoverninggovernmentlaw
SHARED TOKENS (34): "activities", "activity", "administration", "administrative", "agencies", "another", "changes", "civil", "control", "coordinate", "created", "decisions", "division", "education", "enforcement", "environment", "environmental", "governing", "government", "law".... | EXACT TITLE in military: "Administrative law".
0.500
administrativeconservationdepartmentgovernmentidahoinstitutionslandlandsmillionminingofficesoperatespreventionprogramsprotectionprovidingpublicregulationstate-level
SHARED TOKENS (19): "administrative", "conservation", "department", "government", "idaho", "institutions", "land", "lands", "million", "mining", "offices", "operates", "prevention", "programs", "protection", "providing", "public", "regulation", "state-level". | EXACT TITLE in geology: "Idaho Department of Lands". | EXACT TITLE in military: "Idaho Department of Lands".
0.500
Weathering ↗ Q179177 EXACT TITLE
activitiescontactcreatedistincteffectselementsexposureimportantmaterialmaterialsoccursorganicphysicalprincipalthough
SHARED TOKENS (15): "activities", "contact", "create", "distinct", "effects", "elements", "exposure", "important", "material", "materials", "occurs", "organic", "physical", "principal", "though". | EXACT TITLE in geology: "Weathering".
0.500
Silicon ↗ Q670 EXACT TITLE
amongbasiscomponentsconstructiondigitaldistributedeconomyelectronicsformfoundationsgroupindustrialindustryinformationintegratedlargemakingmarketmaterialmodern
SHARED TOKENS (33): "among", "basis", "components", "construction", "digital", "distributed", "economy", "electronics", "form", "foundations", "group", "industrial", "industry", "information", "integrated", "large", "making", "market", "material", "modern".... | EXACT TITLE in geology: "Silicon".
0.500
Miocene ↗ Q76267 EXACT TITLE
affectingaroundboundarycomesconnectioncontinueddistinctextendsglobalmajormeansmillionmodernnorthernpatternsperiod
SHARED TOKENS (16): "affecting", "around", "boundary", "comes", "connection", "continued", "distinct", "extends", "global", "major", "means", "million", "modern", "northern", "patterns", "period". | EXACT TITLE in geology: "Miocene".
0.500
actassessmentcentralchangescommunitiescommunityconditionsconservationcostscreatingdependsdesigndevelopmentdistrictsenvironmentalexposurefacilitiesfuturehealthland
SHARED TOKENS (40): "act", "assessment", "central", "changes", "communities", "community", "conditions", "conservation", "costs", "creating", "depends", "design", "development", "districts", "environmental", "exposure", "facilities", "future", "health", "land".... | EXACT TITLE in geology: "Land-use planning". | EXACT TITLE in military: "Land-use planning".
0.500
accessamongbasisbusinessescapacitychangescommunitycompetedevelopmenteducationemployersformgovernmenthistoricallyhistoryindustryissuesjobslevelsneed
SHARED TOKENS (39): "access", "among", "basis", "businesses", "capacity", "changes", "community", "compete", "development", "education", "employers", "form", "government", "historically", "history", "industry", "issues", "jobs", "levels", "need".... | EXACT TITLE in military: "Workforce development".
0.500
Thorium ↗ Q1115 EXACT TITLE
airanalysisbecomeconcernsdevelopeddifferentelementsequipmentfieldfuelinstrumentationlargematerialnearoccurpointpropertiesreplacementsourceuses
SHARED TOKENS (20): "air", "analysis", "become", "concerns", "developed", "different", "elements", "equipment", "field", "fuel", "instrumentation", "large", "material", "near", "occur", "point", "properties", "replacement", "source", "uses". | EXACT TITLE in geology: "Thorium".
0.500
articlecomplexconsistsconsumercreatingdirectdirectlydistributionfacilitieslinkedmanagementmaterialsnetworkoccurorganizedpointpublishedstructuresupplysystem
SHARED TOKENS (23): "article", "complex", "consists", "consumer", "creating", "direct", "directly", "distribution", "facilities", "linked", "management", "materials", "network", "occur", "organized", "point", "published", "structure", "supply", "system".... | EXACT TITLE in geology: "Supply chain".
0.500
administrationairassetscivilcommercialcontrolcreateddepartmentfederalgovernmentneighboringorganizationpersonnelprotectionsettingspacestandardssurroundingtransportation
SHARED TOKENS (19): "administration", "air", "assets", "civil", "commercial", "control", "created", "department", "federal", "government", "neighboring", "organization", "personnel", "protection", "setting", "space", "standards", "surrounding", "transportation". | EXACT TITLE in military: "Federal Aviation Administration".
0.500
Landslide ↗ Q167903 EXACT TITLE
affectingconditionsdescribesdevelopmentdisasterenvironmentevenglobalgroundimpactslandminingmountainoccurpolicyresourceroadstabilityurbanvegetation
SHARED TOKENS (21): "affecting", "conditions", "describes", "development", "disaster", "environment", "even", "global", "ground", "impacts", "land", "mining", "mountain", "occur", "policy", "resource", "road", "stability", "urban", "vegetation".... | EXACT TITLE in geology: "Landslide".
0.500
Hydrology ↗ Q42250 EXACT TITLE
civildatadistributionengineeringenvironmentalimportantmanagementphysicalplanningpolicypreservationqualityrelatedresearchresources
SHARED TOKENS (15): "civil", "data", "distribution", "engineering", "environmental", "important", "management", "physical", "planning", "policy", "preservation", "quality", "related", "research", "resources". | EXACT TITLE in geology: "Hydrology".
0.500
Vanadium ↗ Q722 EXACT TITLE
activecentercontentdirectlyenergyformationfuelfutureimportantindustriallargelaterlayerminingoccurspresencespecialtystoragethoughwide
SHARED TOKENS (20): "active", "center", "content", "directly", "energy", "formation", "fuel", "future", "important", "industrial", "large", "later", "layer", "mining", "occurs", "presence", "specialty", "storage", "though", "wide". | EXACT TITLE in geology: "Vanadium".
0.500
Earthquake ↗ Q7944 EXACT TITLE
activitiesactivityairbeyondcannotcreatesculturaldesigndirectlyeffectsenergyengineeringenoughgeneralgroundhistoricalinfrastructureinitiallargemedia
SHARED TOKENS (29): "activities", "activity", "air", "beyond", "cannot", "creates", "cultural", "design", "directly", "effects", "energy", "engineering", "enough", "general", "ground", "historical", "infrastructure", "initial", "large", "media".... | EXACT TITLE in geology: "Earthquake".
0.500
Niobium ↗ Q1046 EXACT TITLE
comescontaincontainingcurrentelectronicselementsimportantmakesmaterialsphysicalpropertiesreflectsreportedsmallstabilitythem
SHARED TOKENS (16): "comes", "contain", "containing", "current", "electronics", "elements", "important", "makes", "materials", "physical", "properties", "reflects", "reported", "small", "stability", "them". | EXACT TITLE in geology: "Niobium".
0.500
accessadministrationaffectsauthoritiescoordinatecreateddepartmentdevelopmentdisasteremergencyentitiesfederalfundinggovernmenthousinginfrastructurelocalmajormanagementoccurs
SHARED TOKENS (33): "access", "administration", "affects", "authorities", "coordinate", "created", "department", "development", "disaster", "emergency", "entities", "federal", "funding", "government", "housing", "infrastructure", "local", "major", "management", "occurs".... | EXACT TITLE in geology: "Federal Emergency Management Agency".
0.500
armyaroundassignedcontaincontainsdivisiongeneralimproveintendedoperationsorganicplacessupporttrainingunitunits
SHARED TOKENS (16): "army", "around", "assigned", "contain", "contains", "division", "general", "improve", "intended", "operations", "organic", "places", "support", "training", "unit", "units". | EXACT TITLE in military: "Brigade Combat Team".
0.500
airbroadcivilconstructioncontrolcreatedesigndisciplineengineeringengineersenvironmentenvironmentalglobalhealthimproveindustrialissueslawlicensinglocal
SHARED TOKENS (37): "air", "broad", "civil", "construction", "control", "create", "design", "discipline", "engineering", "engineers", "environment", "environmental", "global", "health", "improve", "industrial", "issues", "law", "licensing", "local".... | EXACT TITLE in geology: "Environmental engineering".
0.500
Geophysics ↗ Q46255 EXACT TITLE
analysisassessmentbasisbroaderconnectsdatadevelopmentenergyenvironmentenvironmentalfieldformationframeworkintegrateslatermonitoringphysicalprimarilypropertiesproviding
SHARED TOKENS (27): "analysis", "assessment", "basis", "broader", "connects", "data", "development", "energy", "environment", "environmental", "field", "formation", "framework", "integrates", "later", "monitoring", "physical", "primarily", "properties", "providing".... | EXACT TITLE in geology: "Geophysics".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciescanyoncentralcommercialconflictconstructioncontrolcreateddevelopedhabitathistoryhostedidahoimportantlargelimitedmajormilesmilitary
SHARED TOKENS (41): "activities", "agencies", "canyon", "central", "commercial", "conflict", "construction", "control", "created", "developed", "habitat", "history", "hosted", "idaho", "important", "large", "limited", "major", "miles", "military".... | EXACT TITLE in geology: "Snake River". | EXACT TITLE in military: "Snake River".
0.500
airarmycorpsestablishmentgroundhistoricallylandmilitarynationalneedsoperationsorganicorganizedpriorprovidingseparatesupportunitunits
SHARED TOKENS (19): "air", "army", "corps", "establishment", "ground", "historically", "land", "military", "national", "needs", "operations", "organic", "organized", "prior", "providing", "separate", "support", "unit", "units". | EXACT TITLE in military: "Army aviation".
0.500
addingbasiscapacityconcentrationconditionscontrolconversioncreatingcurrentdevelopmentdifferentelectronicselementsenergyformgroupintegratedlevelsmaterialmaterials
SHARED TOKENS (31): "adding", "basis", "capacity", "concentration", "conditions", "control", "conversion", "creating", "current", "development", "different", "electronics", "elements", "energy", "form", "group", "integrated", "levels", "material", "materials".... | EXACT TITLE in geology: "Semiconductor". | EXACT TITLE in military: "Semiconductor".
0.500
Gold ↗ Q897 EXACT TITLE
aroundbaseconditionscontinuedelementsformgroundgrouphistoryindustrialindustryminingoccurspolicypresencepropertysystemthoughtogether
SHARED TOKENS (19): "around", "base", "conditions", "continued", "elements", "form", "ground", "group", "history", "industrial", "industry", "mining", "occurs", "policy", "presence", "property", "system", "though", "together". | EXACT TITLE in geology: "Gold".
0.500
Phosphate ↗ Q46220103 EXACT TITLE
amongaroundcomponentcontainenvironmentespeciallyformgroupgroupsgrowthimportantindustrymajormeansminingorganicremovalrolerolessource
SHARED TOKENS (20): "among", "around", "component", "contain", "environment", "especially", "form", "group", "groups", "growth", "important", "industry", "major", "means", "mining", "organic", "removal", "role", "roles", "source". | EXACT TITLE in geology: "Phosphate".
0.500
Ore ↗ Q102798 EXACT TITLE
complexconcentratedconcentrationcontainingcontainselementsgradehealthlevelsmaterialminingsurroundingthereforetreatedvalue
SHARED TOKENS (15): "complex", "concentrated", "concentration", "containing", "contains", "elements", "grade", "health", "levels", "material", "mining", "surrounding", "therefore", "treated", "value". | EXACT TITLE in geology: "Ore". | EXACT TITLE in military: "Ore".
0.500
adaairairportbaseboisecentercombinedcommercialdepartmentfieldforestfunctionsgeneralgowenidahomilesmilitarymillionnationaloperated
SHARED TOKENS (28): "ada", "air", "airport", "base", "boise", "center", "combined", "commercial", "department", "field", "forest", "functions", "general", "gowen", "idaho", "miles", "military", "million", "national", "operated".... | EXACT TITLE in geology: "Boise Airport". | EXACT TITLE in military: "Boise Airport".
0.500
aggregatebasebroadcomponentconstructionedgeformfoundationfoundationsmaterialmaterialspropertiesresultingretainingroadservessignificant
SHARED TOKENS (17): "aggregate", "base", "broad", "component", "construction", "edge", "form", "foundation", "foundations", "material", "materials", "properties", "resulting", "retaining", "road", "serves", "significant". | EXACT TITLE in geology: "Construction aggregate".
0.500
Neogene ↗ Q103924 EXACT TITLE
cannotconnectioncontinueddefineglobalgroupslatermillionmodernnearperiodpresentsignificantsystemtransfer
SHARED TOKENS (15): "cannot", "connection", "continued", "define", "global", "groups", "later", "million", "modern", "near", "period", "present", "significant", "system", "transfer". | EXACT TITLE in geology: "Neogene".
0.500
actarmychangesconservationcontrolcoordinationcorpsdirectlyengineersenvironmentalfederalformfundinggoverninglawlawsmajormodernphysicalprimarily
SHARED TOKENS (29): "act", "army", "changes", "conservation", "control", "coordination", "corps", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "law", "laws", "major", "modern", "physical", "primarily".... | EXACT TITLE in geology: "Clean Water Act".
0.500
Materials science ↗ EXACT TITLE
academicaroundcomponentscontrolcreateddesigndistinctelementsengineeringengineersfieldhistoryinstitutionsknowledgemajormaterialmaterialspracticepropertiesrelated
SHARED TOKENS (25): "academic", "around", "components", "control", "created", "design", "distinct", "elements", "engineering", "engineers", "field", "history", "institutions", "knowledge", "major", "material", "materials", "practice", "properties", "related".... | EXACT TITLE in geology: "Materials science".
0.500
Cobalt ↗ Q740 EXACT TITLE
accordingactivecentercombinedderivesformglobalgroupimportantindustryminingoccursprimarilyresourcessmall
SHARED TOKENS (15): "according", "active", "center", "combined", "derives", "form", "global", "group", "important", "industry", "mining", "occurs", "primarily", "resources", "small". | EXACT TITLE in geology: "Cobalt".
0.500
advancedaroundbridgecommercialcomponentsconcentratedconsumercontaincontainingdatadefensedemanddescribesdifferenteffectselectronicselementsenergyenvironmentalglobal
SHARED TOKENS (44): "advanced", "around", "bridge", "commercial", "components", "concentrated", "consumer", "contain", "containing", "data", "defense", "demand", "describes", "different", "effects", "electronics", "elements", "energy", "environmental", "global".... | EXACT TITLE in geology: "Rare-earth element".
0.500
airbuildingscomesconsistscontactcreatedhealthimpactsinfrastructurelargermaterialnetworksstructuressupplysystemstransportationwide
SHARED TOKENS (17): "air", "buildings", "comes", "consists", "contact", "created", "health", "impacts", "infrastructure", "larger", "material", "networks", "structures", "supply", "systems", "transportation", "wide". | EXACT TITLE in geology: "Volcanic ash".
0.500
affectsapproximatelybusinessescapablecomponentconstructioncontractsdirecteconomyglobalgovernmentgroupgrowthlawslocalorganizationprivatepublicqualityregulate
SHARED TOKENS (27): "affects", "approximately", "businesses", "capable", "component", "construction", "contracts", "direct", "economy", "global", "government", "group", "growth", "laws", "local", "organization", "private", "public", "quality", "regulate".... | EXACT TITLE in military: "Government procurement".
0.500
activitiescodeconditionscontroldefensefederalfundedgovernmentnationalorganizationpersonnelrolestatutessupplytitletraining
SHARED TOKENS (16): "activities", "code", "conditions", "control", "defense", "federal", "funded", "government", "national", "organization", "personnel", "role", "statutes", "supply", "title", "training". | EXACT TITLE in military: "Title 32 of the United States Code".
0.500
actadministrationcomplianceconditionscoveringdepartmentdifferentdistrictsdivisionfederalhealthlabormeansminingofficeoperationsorganizedreducesafetysmall
SHARED TOKENS (21): "act", "administration", "compliance", "conditions", "covering", "department", "different", "districts", "division", "federal", "health", "labor", "means", "mining", "office", "operations", "organized", "reduce", "safety", "small".... | EXACT TITLE in geology: "Mine Safety and Health Administration".
0.500
Airspace ↗ Q272730 EXACT TITLE
airauthoritiesboundarycivilcontrolcontrolleddefenseenforcementinformationlegalmanagementmilitarynationaloperationsorganizationregulatoryrestrictionsrulesspacetechnical
SHARED TOKENS (21): "air", "authorities", "boundary", "civil", "control", "controlled", "defense", "enforcement", "information", "legal", "management", "military", "national", "operations", "organization", "regulatory", "restrictions", "rules", "space", "technical".... | EXACT TITLE in military: "Airspace".
0.500
Fort Boise ↗ Q3077782 EXACT TITLE
becomeboiseboundarycanyoncapitaldevelopeddifferentgovernmenthistoricidahomilesmilitarynearnorthernriversettlementsnakewestern
SHARED TOKENS (18): "become", "boise", "boundary", "canyon", "capital", "developed", "different", "government", "historic", "idaho", "miles", "military", "near", "northern", "river", "settlement", "snake", "western". | EXACT TITLE in military: "Fort Boise".
0.500
additionaladvancedagenciesauthoritiesbusinessescontactcorpsdepartmentemergencyfacilitieshistoricallylevelsmodelpersonnelplacespointpresentprovideprovidingpublic
SHARED TOKENS (32): "additional", "advanced", "agencies", "authorities", "businesses", "contact", "corps", "department", "emergency", "facilities", "historically", "levels", "model", "personnel", "places", "point", "present", "provide", "providing", "public".... | EXACT TITLE in military: "Emergency medical services".
0.500
Erosion ↗ Q80026 EXACT TITLE
actactivitiesanothercombinedcontrolcontrolleddistinctecologicaleffectsenvironmentalespeciallyglobalhousesimpactslandmakingmaterialmaterialsphysicalprevention
SHARED TOKENS (26): "act", "activities", "another", "combined", "control", "controlled", "distinct", "ecological", "effects", "environmental", "especially", "global", "houses", "impacts", "land", "making", "material", "materials", "physical", "prevention".... | EXACT TITLE in geology: "Erosion".
0.500
activitycomponentsdefensedepartmenteducationalemployersgovernmentlawsnationaloperatesoutreachprogramreserveresourcessupportwork
SHARED TOKENS (16): "activity", "components", "defense", "department", "educational", "employers", "government", "laws", "national", "operates", "outreach", "program", "reserve", "resources", "support", "work". | EXACT TITLE in military: "Employer Support of the Guard and Reserve".
0.500
Cavalry ↗ Q47315 EXACT TITLE
acquisitionarmybeyonddesignedeconomygroupshistorichistoricallandlatermilitarymodernoperatingperiodplatformsprotectionpurposeretainingroleroles
SHARED TOKENS (24): "acquisition", "army", "beyond", "designed", "economy", "groups", "historic", "historical", "land", "later", "military", "modern", "operating", "period", "platforms", "protection", "purpose", "retaining", "role", "roles".... | EXACT TITLE in military: "Cavalry".
0.500
accordingactadaadditionalbaseblmboisebureaucanyonconservationcreatingdensitydifferentdocumentsgroundhistoricalidahoimportantlandlands
SHARED TOKENS (39): "according", "act", "ada", "additional", "base", "blm", "boise", "bureau", "canyon", "conservation", "creating", "density", "different", "documents", "ground", "historical", "idaho", "important", "land", "lands".... | EXACT TITLE in military: "Morley Nelson Snake River Birds of Prey National Conservation Area".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectscomponentcontainingenvironmentalespeciallyformgrouphealthimportantindustrylargeroccurspropertiesproposedprotectionresearchrolesemiconductorsmalltherefore
SHARED TOKENS (21): "affects", "component", "containing", "environmental", "especially", "form", "group", "health", "important", "industry", "larger", "occurs", "properties", "proposed", "protection", "research", "role", "semiconductor", "small", "therefore".... | EXACT TITLE in geology: "Arsenic".
0.500
acquisitionactiveamongcommercialcontactcurrentespeciallyinformationintelligencelandmakingmilitaryphysicalplanningsurveying
SHARED TOKENS (15): "acquisition", "active", "among", "commercial", "contact", "current", "especially", "information", "intelligence", "land", "making", "military", "physical", "planning", "surveying". | EXACT TITLE in geology: "Remote sensing".
0.480
advocacyapproximatelycommunitydevelopmenteducationissuesleadershiporganizationpolicyprogramspublicrelatedresearchuniversities
SHARED TOKENS (14): "advocacy", "approximately", "community", "development", "education", "issues", "leadership", "organization", "policy", "programs", "public", "related", "research", "universities". | EXACT TITLE in military: "American Council on Education".
0.480
accordingbaseeconomyengineersenvironmentenvironmentalindustrialknowledgematerialsprimarilyresourcessourcesstructuralvalue
SHARED TOKENS (14): "according", "base", "economy", "engineers", "environment", "environmental", "industrial", "knowledge", "materials", "primarily", "resources", "sources", "structural", "value". | EXACT TITLE in geology: "Economic geology".
0.480
actconcentrationconflictcontinuedcreatededucationgovernmentgroupsindustrymillionofficialorganicsouthernthem
SHARED TOKENS (14): "act", "concentration", "conflict", "continued", "created", "education", "government", "groups", "industry", "million", "official", "organic", "southern", "them". | EXACT TITLE in military: "Philippine–American War".
0.480
anothercontractcostsexistinggeneralneedobligationsprojectpublicreducerulessectorsmallsupport
SHARED TOKENS (14): "another", "contract", "costs", "existing", "general", "need", "obligations", "project", "public", "reduce", "rules", "sector", "small", "support". | EXACT TITLE in military: "Subcontractor".
0.480
Tectonics ↗ Q193343 EXACT TITLE
affectdirectlyextendsfieldframeworkglobalgrowthimportantpatternspopulationpropertiesprovideresourcesstructure
SHARED TOKENS (14): "affect", "directly", "extends", "field", "framework", "global", "growth", "important", "patterns", "population", "properties", "provide", "resources", "structure". | EXACT TITLE in geology: "Tectonics".
0.480
combinescompatibleconstraintscontextcontrolgeneralinitiativemanagementmilitarymissionmodernneedsprovidingrelated
SHARED TOKENS (14): "combines", "compatible", "constraints", "context", "control", "general", "initiative", "management", "military", "mission", "modern", "needs", "providing", "related". | EXACT TITLE in military: "Mission command".
0.480
approximatelyaroundcentralcontainscreatedgeographicallyidaholargermillionmontanariverseparateseparatedsurrounding
SHARED TOKENS (14): "approximately", "around", "central", "contains", "created", "geographically", "idaho", "larger", "million", "montana", "river", "separate", "separated", "surrounding". | EXACT TITLE in geology: "Idaho Batholith".
0.460
Manganese ↗ Q731 EXACT TITLE
activecomplexcomponentdefenseformformationimportantindustrialmakingoccurssystemstreatmentuses
SHARED TOKENS (13): "active", "complex", "component", "defense", "form", "formation", "important", "industrial", "making", "occurs", "systems", "treatment", "uses". | EXACT TITLE in geology: "Manganese".
0.460
Quartz ↗ Q43010 EXACT TITLE
differentespeciallyframeworkgrouplinkedmakingmaterialscalesharedsignificantstructurallythereforevalue
SHARED TOKENS (13): "different", "especially", "framework", "group", "linked", "making", "material", "scale", "shared", "significant", "structurally", "therefore", "value". | EXACT TITLE in geology: "Quartz".
0.460
basebroadchangesengineeringfieldformhistorynearoperatingphysicalresearchterrainwork
SHARED TOKENS (13): "base", "broad", "changes", "engineering", "field", "form", "history", "near", "operating", "physical", "research", "terrain", "work". | EXACT TITLE in geology: "Geomorphology".
0.450
airarmyboisebureauconsistsdepartmentgovernmentheadquartersidahomilitarynationalpotentialprotectsecuritystaff
SHARED TOKENS (15): "air", "army", "boise", "bureau", "consists", "department", "government", "headquarters", "idaho", "military", "national", "potential", "protect", "security", "staff". | URL->B (3): https://www.imd.idaho.gov/, https://www.imd.idaho.gov/idaho-air-national-guard/.
0.440
Quaternary ↗ Q26185 EXACT TITLE
associatedchangescurrentenvironmentalgoverninggrowthmillionperiodpresentproposedrelatedscale
SHARED TOKENS (12): "associated", "changes", "current", "environmental", "governing", "growth", "million", "period", "present", "proposed", "related", "scale". | EXACT TITLE in geology: "Quaternary".
0.440
Rift ↗ Q473935 EXACT TITLE
activeboundarycentralcontaincreatedformmajoroccurpointremainsystemsvalley
SHARED TOKENS (12): "active", "boundary", "central", "contain", "created", "form", "major", "occur", "point", "remain", "systems", "valley". | EXACT TITLE in geology: "Rift".
0.440
Gallium ↗ Q861 EXACT TITLE
becomescomplexelectronicselementsenoughnearoccurpointratherrolestructuresystems
SHARED TOKENS (12): "becomes", "complex", "electronics", "elements", "enough", "near", "occur", "point", "rather", "role", "structure", "systems". | EXACT TITLE in geology: "Gallium".
0.440
associateddesigndevelopmentdisciplinediscoveryengineeringgroundminingoperationsplansresourcessurveying
SHARED TOKENS (12): "associated", "design", "development", "discipline", "discovery", "engineering", "ground", "mining", "operations", "plans", "resources", "surveying". | EXACT TITLE in geology: "Mining engineering".
0.440
Copper ↗ Q753 EXACT TITLE
anotherassociatedbuildingscomplexcontaincreatedirectlyformhistoricallylatermaterialoccur
SHARED TOKENS (12): "another", "associated", "buildings", "complex", "contain", "create", "directly", "form", "historically", "later", "material", "occur". | EXACT TITLE in geology: "Copper".
0.440
articlefieldgeneralgroundgroupinformationmountainnationalspecialtyterrainunitsurban
SHARED TOKENS (12): "article", "field", "general", "ground", "group", "information", "mountain", "national", "specialty", "terrain", "units", "urban". | EXACT TITLE in military: "Search and rescue".
0.440
connectsdesignelementsengineeringfoundationfoundationsgroundlayermechanicsstructurestructuressupporting
SHARED TOKENS (12): "connects", "design", "elements", "engineering", "foundation", "foundations", "ground", "layer", "mechanics", "structure", "structures", "supporting". | EXACT TITLE in geology: "Foundation (engineering)". | EXACT TITLE in military: "Foundation (engineering)".
0.440
descriptiondistributionfieldhistoryimportantinformationinterpretationlinkedmountainpatternsstructuralunits
SHARED TOKENS (12): "description", "distribution", "field", "history", "important", "information", "interpretation", "linked", "mountain", "patterns", "structural", "units". | EXACT TITLE in geology: "Structural geology".
0.420
Pliocene ↗ Q76259 EXACT TITLE
boundarydefineextendsidentifiedmajormillionperiodpriorratherregionalscale
SHARED TOKENS (11): "boundary", "define", "extends", "identified", "major", "million", "period", "prior", "rather", "regional", "scale". | EXACT TITLE in geology: "Pliocene".
0.420
basecontainingequipmentgroundmaterialminingmodernpermanentlyseparatesourcethough
SHARED TOKENS (11): "base", "containing", "equipment", "ground", "material", "mining", "modern", "permanently", "separate", "source", "though". | EXACT TITLE in geology: "Placer mining".
0.420
assessmentcompliancecontacthealthphysicalqualitysafetysignificantstandardssupplytreatment
SHARED TOKENS (11): "assessment", "compliance", "contact", "health", "physical", "quality", "safety", "significant", "standards", "supply", "treatment". | EXACT TITLE in geology: "Water quality".
0.420
civilconstructionengineeringknowledgematerialsmechanicsmilitaryminingrelatedspecialtyuses
SHARED TOKENS (11): "civil", "construction", "engineering", "knowledge", "materials", "mechanics", "military", "mining", "related", "specialty", "uses". | EXACT TITLE in geology: "Geotechnical engineering".
0.420
actadministrationairarmybureaucreateddefensedepartmentfederalgeneralnational
SHARED TOKENS (11): "act", "administration", "air", "army", "bureau", "created", "defense", "department", "federal", "general", "national". | EXACT TITLE in military: "National Guard Bureau".
0.400
Tantalum ↗ Q1123 EXACT TITLE
componentsequipmentgroupgroupsindustrialmaterialoccurspointsourcestogether
SHARED TOKENS (10): "components", "equipment", "group", "groups", "industrial", "material", "occurs", "point", "sources", "together". | EXACT TITLE in geology: "Tantalum".
0.400
activeassociatedcreekdevelopmentfieldidahominingmountainowyheeriver
SHARED TOKENS (10): "active", "associated", "creek", "development", "field", "idaho", "mining", "mountain", "owyhee", "river". | EXACT TITLE in geology: "Owyhee Mountains".
0.400
Graphite ↗ Q5309 EXACT TITLE
amongconditionsconsistsenergyformlargemillionoccursscaleuses
SHARED TOKENS (10): "among", "conditions", "consists", "energy", "form", "large", "million", "occurs", "scale", "uses". | EXACT TITLE in geology: "Graphite".
0.400
anothercreatedcreekidaholargemontanaresultingriverscalesnake
SHARED TOKENS (10): "another", "created", "creek", "idaho", "large", "montana", "resulting", "river", "scale", "snake". | EXACT TITLE in geology: "Yellowstone hotspot".
0.400
boisedepartmentenvironmentalfederalgovernmentidaholawsofficesqualityregional
SHARED TOKENS (10): "boise", "department", "environmental", "federal", "government", "idaho", "laws", "offices", "quality", "regional". | EXACT TITLE in geology: "Idaho Department of Environmental Quality".
0.400
beyondextendsfieldformationimportantintegratedmajorsystemsystemsuses
SHARED TOKENS (10): "beyond", "extends", "field", "formation", "important", "integrated", "major", "system", "systems", "uses". | EXACT TITLE in geology: "Geochemistry".
0.400
Floodplain ↗ Q193110 EXACT TITLE
basecontroldevelopedexperienceimportantlandnearriverurbanvalley
SHARED TOKENS (10): "base", "control", "developed", "experience", "important", "land", "near", "river", "urban", "valley". | EXACT TITLE in geology: "Floodplain".
0.400
designeddevelopmenteducationleadershipmilitarypersonnelprofessionalprogramstraininguniversities
SHARED TOKENS (10): "designed", "development", "education", "leadership", "military", "personnel", "professional", "programs", "training", "universities". | EXACT TITLE in military: "Professional military education".
0.400
airarmydifferentfederalmilitarynationalorganizedreservesimultaneouslyunits
SHARED TOKENS (10): "air", "army", "different", "federal", "military", "national", "organized", "reserve", "simultaneously", "units". | EXACT TITLE in military: "Army National Guard".
0.400
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseforestidaholandsmilesriversnakeurbanwestern
SHARED TOKENS (10): "approximately", "boise", "forest", "idaho", "lands", "miles", "river", "snake", "urban", "western". | EXACT TITLE in geology: "Boise River".
0.380
buildingsconservationdevelopmentenvironmenthistorichistoricalmaintainspreservationprotect
SHARED TOKENS (9): "buildings", "conservation", "development", "environment", "historic", "historical", "maintains", "preservation", "protect". | EXACT TITLE in military: "Historic preservation".
0.380
activeassociateddistinctionenergylargemapsrepresentssignificantsingle
SHARED TOKENS (9): "active", "associated", "distinction", "energy", "large", "maps", "represents", "significant", "single". | EXACT TITLE in geology: "Fault (geology)".
0.380
aircapacitydesigndevelopmentmeansmilitarynationalprovidesupply
SHARED TOKENS (9): "air", "capacity", "design", "development", "means", "military", "national", "provide", "supply". | EXACT TITLE in military: "Military aviation".
0.380
activityamongidahoprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (9): "activity", "among", "idaho", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in military: "Idaho State University".
0.360
Volcanology ↗ Q102904 EXACT TITLE
activeactivitycurrentespeciallyformationhistoricmajorrelated
SHARED TOKENS (8): "active", "activity", "current", "especially", "formation", "historic", "major", "related". | EXACT TITLE in geology: "Volcanology".
0.360
departmentdevelopmentgrowthidahoimprovepublicresourcesstate-level
SHARED TOKENS (8): "department", "development", "growth", "idaho", "improve", "public", "resources", "state-level". | EXACT TITLE in military: "Idaho Department of Commerce".
0.340
Taxiway ↗ Q910386 EXACT TITLE
airportconnectingfacilitiesgeneralmovingoperatorsthough
SHARED TOKENS (7): "airport", "connecting", "facilities", "general", "moving", "operators", "though". | EXACT TITLE in military: "Taxiway".
0.340
airairportbasecivilcontainfacilitiesmilitary
SHARED TOKENS (7): "air", "airport", "base", "civil", "contain", "facilities", "military". | EXACT TITLE in military: "Joint-use airport".
0.340
Tellurium ↗ Q1100 EXACT TITLE
exposureformformationrelatedsignificantsourcespace
SHARED TOKENS (7): "exposure", "form", "formation", "related", "significant", "source", "space". | EXACT TITLE in geology: "Tellurium".
0.340
departmentdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (7): "department", "development", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in military: "Idaho Department of Labor".
0.340
Antimony ↗ Q1099 EXACT TITLE
directformhistoryindustrialoccurspropertiessemiconductor
SHARED TOKENS (7): "direct", "form", "history", "industrial", "occurs", "properties", "semiconductor". | EXACT TITLE in geology: "Antimony".
0.320
contractorsdirectlygeneralgovernmentlawwork
SHARED TOKENS (6): "contractors", "directly", "general", "government", "law", "work". | EXACT TITLE in military: "Prime contractor".
0.320
Basalt ↗ Q43338 EXACT TITLE
contentimportantmovingnearresultingsystem
SHARED TOKENS (6): "content", "important", "moving", "near", "resulting", "system". | EXACT TITLE in geology: "Basalt".
0.320
aggregateanotherconstructiongroupindustrymaterial
SHARED TOKENS (6): "aggregate", "another", "construction", "group", "industry", "material". | EXACT TITLE in geology: "Aggregate (geology)". | EXACT TITLE in military: "Aggregate (geology)".
0.320
Petrology ↗ Q163082 EXACT TITLE
conditionsformmakingmodernstructuretogether
SHARED TOKENS (6): "conditions", "form", "making", "modern", "structure", "together". | EXACT TITLE in geology: "Petrology".
0.320
formationlawlawsprimarilyrelatedrelationships
SHARED TOKENS (6): "formation", "law", "laws", "primarily", "related", "relationships". | EXACT TITLE in geology: "Stratigraphy".
0.300
actairarmyarticlebasischaptercodecomponentcomponentscorpscurrentdefensedepartmentdifferentfederalgenerallawlawslegalmilitary
SHARED TOKENS (31): "act", "air", "army", "article", "basis", "chapter", "code", "component", "components", "corps", "current", "defense", "department", "different", "federal", "general", "law", "laws", "legal", "military"....
0.300
activityanalysisassessmentbecomecodescomplexconditionsdependsdesigndifferenteconomicsengineerseveninformationmaterialsmechanismminingpotentialpresenceproperties
SHARED TOKENS (29): "activity", "analysis", "assessment", "become", "codes", "complex", "conditions", "depends", "design", "different", "economics", "engineers", "even", "information", "materials", "mechanism", "mining", "potential", "presence", "properties"....
0.300
Mineralogy ↗ Q83353 EXACT TITLE
distributionformationphysicalpropertiesstructure
SHARED TOKENS (5): "distribution", "formation", "physical", "properties", "structure". | EXACT TITLE in geology: "Mineralogy".
0.300
aircivilcombinedconflictcontinuedcontrolcoordinationdevelopedeffectsespeciallyextensiveformgroundidentifyinglatermajormilitarymissionneedoperations
SHARED TOKENS (30): "air", "civil", "combined", "conflict", "continued", "control", "coordination", "developed", "effects", "especially", "extensive", "form", "ground", "identifying", "later", "major", "military", "mission", "need", "operations"....
0.300
Rocky Mountains ↗ Q5463 KW CROSS HIGH
activitybroaddistinctespeciallyforestinitiallandsmajormetropolitanmillionmountainnearnorthernpointpopulationprotectpublicresourcesresultingriver
SHARED TOKENS (22): "activity", "broad", "distinct", "especially", "forest", "initial", "lands", "major", "metropolitan", "million", "mountain", "near", "northern", "point", "population", "protect", "public", "resources", "resulting", "river"....
0.300
Shooting range ↗ Q521839 KW CROSS HIGH
agenciesairdesignedenforcementevenfieldgroundlawlawsmilitaryoperatedpersonnelpracticeprovidequalificationsrelevantrulessafetyspecializedthough
SHARED TOKENS (21): "agencies", "air", "designed", "enforcement", "even", "field", "ground", "law", "laws", "military", "operated", "personnel", "practice", "provide", "qualifications", "relevant", "rules", "safety", "specialized", "though"....
0.300
academicanalysisanotherbroadercaptureconsistsdatadisciplineengineeringfoundationgeographicindustryinformationinstitutionalinsuranceintegratedintelligenceknowledgemanagementoperations
SHARED TOKENS (33): "academic", "analysis", "another", "broader", "capture", "consists", "data", "discipline", "engineering", "foundation", "geographic", "industry", "information", "institutional", "insurance", "integrated", "intelligence", "knowledge", "management", "operations"....
0.300
Holocene ↗ Q25445 KW CROSS HIGH
approximatelyaroundcontinuedcurrentdevelopmentdistinctequivalentformfutureglobalgrowthhistoryimpactslargemajoroutsideperiodpresentproposedsignificant
SHARED TOKENS (22): "approximately", "around", "continued", "current", "development", "distinct", "equivalent", "form", "future", "global", "growth", "history", "impacts", "large", "major", "outside", "period", "present", "proposed", "significant"....
0.300
accessculturalhistorichistoricalidahomaintainsmaterialofficeofficialplacespreservationprogrampublicrecordsstaff
SHARED TOKENS (15): "access", "cultural", "historic", "historical", "idaho", "maintains", "material", "office", "official", "places", "preservation", "program", "public", "records", "staff".
0.300
administrationanotherbroadcapitalconflictcontrolcreatinggovernmentgroupgroupshistorylargemajormeansmilitarymillionneighboringnorthernoperatingoperations
SHARED TOKENS (30): "administration", "another", "broad", "capital", "conflict", "control", "creating", "government", "group", "groups", "history", "large", "major", "means", "military", "million", "neighboring", "northern", "operating", "operations"....
0.300
Civil service ↗ KW CROSS HIGH
administrativeauthoritiescareercivilconditionscoordinatecreateddepartmentdevelopeddistinctionfieldformgeneralgovernmentinstitutionaljurisdictionleadershiplocalmodernnational
SHARED TOKENS (34): "administrative", "authorities", "career", "civil", "conditions", "coordinate", "created", "department", "developed", "distinction", "field", "form", "general", "government", "institutional", "jurisdiction", "leadership", "local", "modern", "national"....
0.300
acquisitionadministrativeagencieschaptercodecostsdefensedescribesdocumentfederalgovernmentprincipalregulationrulessystemtitlevalue
SHARED TOKENS (17): "acquisition", "administrative", "agencies", "chapter", "code", "costs", "defense", "describes", "document", "federal", "government", "principal", "regulation", "rules", "system", "title", "value".
0.300
associatedconcentrateconflictcontextdocumentseducationhistoryinstitutioninstitutionsmilitarynationalpreservationregionalrelatedtechnologyunit
SHARED TOKENS (16): "associated", "concentrate", "conflict", "context", "documents", "education", "history", "institution", "institutions", "military", "national", "preservation", "regional", "related", "technology", "unit".
0.300
Soil mechanics ↗ Q471872 KW CROSS HIGH
airanalysisarticlebasisbridgecapacitycivilconsolidationcontainsdependentdescribesdistinctionengineeringfoundationsmechanicsorganicpipelineprimarilyrelatedretaining
SHARED TOKENS (23): "air", "analysis", "article", "basis", "bridge", "capacity", "civil", "consolidation", "contains", "dependent", "describes", "distinction", "engineering", "foundations", "mechanics", "organic", "pipeline", "primarily", "related", "retaining"....
0.300
civilconstructioncurrentdisciplineengineeringexistingextensivehistoryhousesimportantinformationlandlargeoccurorganicphysicalpropertiesresourcessourcesources
SHARED TOKENS (23): "civil", "construction", "current", "discipline", "engineering", "existing", "extensive", "history", "houses", "important", "information", "land", "large", "occur", "organic", "physical", "properties", "resources", "source", "sources"....
0.300
Pleistocene ↗ Q25546 KW CROSS HIGH
allowingaroundbridgecomesconnectioncontinuedcoveringexpansionlandlargelevelsmakingmillionmodernnorthernotherwiseoutsidepatternsperiodpresent
SHARED TOKENS (22): "allowing", "around", "bridge", "comes", "connection", "continued", "covering", "expansion", "land", "large", "levels", "making", "million", "modern", "northern", "otherwise", "outside", "patterns", "period", "present"....
0.300
Drilling rig ↗ Q12688575 KW CROSS HIGH
basecapablecomplexconstructioncontaincrewsdrilldrillingenoughenvironmentalequipmentevenhousinginstrumentationintegratedlandlargelargermilespermanent
SHARED TOKENS (29): "base", "capable", "complex", "construction", "contain", "crews", "drill", "drilling", "enough", "environmental", "equipment", "even", "housing", "instrumentation", "integrated", "land", "large", "larger", "miles", "permanent"....
0.300
actcivildefensedefinedepartmentfederalgovernmentlawmilitarynationalprotectpublicationrequiresrestrictionssecuritystatutorythereforetitleunits
SHARED TOKENS (19): "act", "civil", "defense", "define", "department", "federal", "government", "law", "military", "national", "protect", "publication", "requires", "restrictions", "security", "statutory", "therefore", "title", "units".
0.300
actactiveactivityairarmybasisbecomecannotcapacitycomponentcontroldefensedifferentdistinctemergencyentitiesfederalgovernmentgroundlaw
SHARED TOKENS (34): "act", "active", "activity", "air", "army", "basis", "become", "cannot", "capacity", "component", "control", "defense", "different", "distinct", "emergency", "entities", "federal", "government", "ground", "law"....
0.300
Military engineering ↗ KW CROSS HIGH
academicaccordingactivitiesactivitycivilcomponentconstructioncontroldefenseengineeringengineersenvironmentenvironmentalequipmentfunctionsintelligencemilitarymodernoperatingphysical
SHARED TOKENS (30): "academic", "according", "activities", "activity", "civil", "component", "construction", "control", "defense", "engineering", "engineers", "environment", "environmental", "equipment", "functions", "intelligence", "military", "modern", "operating", "physical"....
0.300
Fracking ↗ Q890794 KW CROSS HIGH
becomescontainingcreatedivisionformationgeneralhistoryindustrymediapathwayspermanentlyprimarilypublicsmallsourcetreatment
SHARED TOKENS (16): "becomes", "containing", "create", "division", "formation", "general", "history", "industry", "media", "pathways", "permanently", "primarily", "public", "small", "source", "treatment".
0.300
alongsideamongassociatedchildcomplexconflictdevelopeddisasterdocumenteddomesticenoughexperiencelargemilitaryoccurpartnerphysicalpointpresentprevention
SHARED TOKENS (26): "alongside", "among", "associated", "child", "complex", "conflict", "developed", "disaster", "documented", "domestic", "enough", "experience", "large", "military", "occur", "partner", "physical", "point", "present", "prevention"....
0.300
actadministrationenvironmentalfederalintendedlawprivateprotectionprovidingpublicqualityregulatedstandardssystemsystems
SHARED TOKENS (15): "act", "administration", "environmental", "federal", "intended", "law", "private", "protection", "providing", "public", "quality", "regulated", "standards", "system", "systems".
0.300
alongsidebecomechangescommunityconsequencesformfuelhabitatimportantlandlandscapelocalotherwisepresencequalitysourcewildlife
SHARED TOKENS (17): "alongside", "become", "changes", "community", "consequences", "form", "fuel", "habitat", "important", "land", "landscape", "local", "otherwise", "presence", "quality", "source", "wildlife".
0.300
communitiescommunitycomponentconnectingdefensedepartmentdirectestablishinstructionlawmillionnationalneedsofficepolicyprogramprogramspublicreserveresources
SHARED TOKENS (23): "communities", "community", "component", "connecting", "defense", "department", "direct", "establish", "instruction", "law", "million", "national", "needs", "office", "policy", "program", "programs", "public", "reserve", "resources"....
0.300
Core sample ↗ Q1942237 KW CROSS HIGH
conditionscontinuingcoredatadevelopmentdifferentdrilldrillingequipmentespeciallymaterialsmediapropertiessectiontechnology
SHARED TOKENS (15): "conditions", "continuing", "core", "data", "development", "different", "drill", "drilling", "equipment", "especially", "materials", "media", "properties", "section", "technology".
0.300
activitiesanalysisassessmentbroadercapabilitiescapabilitydatadecisionsdisciplineenvironmentguidanceidentifiedinformationintelligencelevelsmilitarymissionoperationaloperationsperiod
SHARED TOKENS (31): "activities", "analysis", "assessment", "broader", "capabilities", "capability", "data", "decisions", "discipline", "environment", "guidance", "identified", "information", "intelligence", "levels", "military", "mission", "operational", "operations", "period"....
0.300
accordingarmyassignedcontroldefinedevelopmentfieldinformationmilitarymissionorganizationpersonnelphysicalpotentialresourcessystemtechnical
SHARED TOKENS (17): "according", "army", "assigned", "control", "define", "development", "field", "information", "military", "mission", "organization", "personnel", "physical", "potential", "resources", "system", "technical".
0.300
actairarmycapacitycomescorpsdefensedepartmentenforcementfederalgrouplawlawslegalmakesmilitarymissionnationalofficialprimarily
SHARED TOKENS (23): "act", "air", "army", "capacity", "comes", "corps", "defense", "department", "enforcement", "federal", "group", "law", "laws", "legal", "makes", "military", "mission", "national", "official", "primarily"....
0.300
acquisitionactaircodecommandscontroldefensedepartmentenergyenvironmentfinancialgeneralmanagementmilitarynationalofficeoperationsorganizedotherwiseprincipal
SHARED TOKENS (28): "acquisition", "act", "air", "code", "commands", "control", "defense", "department", "energy", "environment", "financial", "general", "management", "military", "national", "office", "operations", "organized", "otherwise", "principal"....
0.300
advancedanalysisaroundcodescreatingcurrentequipmentinformationinstitutionslaterlevelsmilitarypresentsecuritysocialsystemsthem
SHARED TOKENS (17): "advanced", "analysis", "around", "codes", "creating", "current", "equipment", "information", "institutions", "later", "levels", "military", "present", "security", "social", "systems", "them".
0.300
Memorial Day ↗ Q371781 KW CROSS HIGH
administrationamongannualarmybecomecivildepartmentdivisionfederallegallocalmilitarynationalofficialorganizationpersonnelserving
SHARED TOKENS (17): "administration", "among", "annual", "army", "become", "civil", "department", "division", "federal", "legal", "local", "military", "national", "official", "organization", "personnel", "serving".
0.300
actarmycollegecomponentcomponentscorpscreateddefenseformgrouplandmilitarymissionmodernnationalprogramprogramsreservestudentstrain
SHARED TOKENS (25): "act", "army", "college", "component", "components", "corps", "created", "defense", "form", "group", "land", "military", "mission", "modern", "national", "program", "programs", "reserve", "students", "train"....
0.300
Plate tectonics ↗ Q7950 KW CROSS HIGH
activeactivityboundarydensitydevelopededgeformformationinsidelargemajormodelmovingproposedshowsstrongestthoughvalidated
SHARED TOKENS (18): "active", "activity", "boundary", "density", "developed", "edge", "form", "formation", "inside", "large", "major", "model", "moving", "proposed", "shows", "strongest", "though", "validated".
0.300
Gold rush ↗ Q273182 KW CROSS HIGH
activitiesassociatedbecomebeyondcostsdefinediscoverydistributedelsewhereentryenvironmentalfacilitiesgeneralglobalhistoryimportantinvestmentlargelocalmajor
SHARED TOKENS (32): "activities", "associated", "become", "beyond", "costs", "define", "discovery", "distributed", "elsewhere", "entry", "environmental", "facilities", "general", "global", "history", "important", "investment", "large", "local", "major"....
0.300
activitiesadministrationcodecommercialdesigndesignedfederalgeneralgoverningmaintenancemodeloperationspublicregulatedrulesspacestructuresystemstitletraining
SHARED TOKENS (21): "activities", "administration", "code", "commercial", "design", "designed", "federal", "general", "governing", "maintenance", "model", "operations", "public", "regulated", "rules", "space", "structure", "systems", "title", "training"....
0.300
Cyberwarfare ↗ Q849340 KW CROSS HIGH
activeamongassociatedcapabilitiesdefensedigitalevenintendedmilitaryoperationsphysicalrealresponseresultingscalesignificant
SHARED TOKENS (16): "active", "among", "associated", "capabilities", "defense", "digital", "even", "intended", "military", "operations", "physical", "real", "response", "resulting", "scale", "significant".
0.300
accountadministrativeassessmentconsequencescontextdecisiondecisionsdevelopmentdocumentationeffectsenvironmentalidentifyingimpactsjustifymajormakingmanagementplanplanspolicy
SHARED TOKENS (35): "account", "administrative", "assessment", "consequences", "context", "decision", "decisions", "development", "documentation", "effects", "environmental", "identifying", "impacts", "justify", "major", "making", "management", "plan", "plans", "policy"....
0.300
acquisitionactactivityanotherassetscapitalcentralcombinedconsolidatedconsolidationcontrolcreatedepartmentdirecteffectsentitiesfederalgovernmentlawlegal
SHARED TOKENS (41): "acquisition", "act", "activity", "another", "assets", "capital", "central", "combined", "consolidated", "consolidation", "control", "create", "department", "direct", "effects", "entities", "federal", "government", "law", "legal"....
0.300
aroundassessmentconservationdepartmenteducationenergyenforcementengineersenvironmentalequivalentestablishingestablishmentfederalfederallyfinancialgovernmentheadquartersinformationlawslegal
SHARED TOKENS (37): "around", "assessment", "conservation", "department", "education", "energy", "enforcement", "engineers", "environmental", "equivalent", "establishing", "establishment", "federal", "federally", "financial", "government", "headquarters", "information", "laws", "legal"....
0.300
actactiveamongcontrolcreateddepartmenteffectsenvironmentalfederallandslawminingofficeprogramsregulatory
SHARED TOKENS (15): "act", "active", "among", "control", "created", "department", "effects", "environmental", "federal", "lands", "law", "mining", "office", "programs", "regulatory".
0.300
administrationaroundassetscapitalcomesconcernscontractcontractingcostscoursedevelopmentfinancialfinancingfundinggovernmentinfrastructureinstitutionsinvestmentissueslong-term
SHARED TOKENS (38): "administration", "around", "assets", "capital", "comes", "concerns", "contract", "contracting", "costs", "course", "development", "financial", "financing", "funding", "government", "infrastructure", "institutions", "investment", "issues", "long-term"....
0.300
Military base ↗ Q245016 KW CROSS HIGH
airbasecentercomplexdirectlyequipmentgroundmilitaryoperatedoperationsoutsidepersonnelprovidetrainingunits
SHARED TOKENS (15): "air", "base", "center", "complex", "directly", "equipment", "ground", "military", "operated", "operations", "outside", "personnel", "provide", "training", "units".
0.300
administrationcostsdepartmenteducationeligibleemergencyfacilitiesfederalfuturegovernmentinsurancelong-termmilitarymissionnationalnetofficesprogramprovidingrehabilitation
SHARED TOKENS (20): "administration", "costs", "department", "education", "eligible", "emergency", "facilities", "federal", "future", "government", "insurance", "long-term", "military", "mission", "national", "net", "offices", "program", "providing", "rehabilitation".
0.300
becomescomponentsdatadigitalfieldfunctionsinformationinfrastructuremodernnetworknetworksphysicalprotectionprovidereflectssecuritysoftwarestandardssystemstechnology
SHARED TOKENS (21): "becomes", "components", "data", "digital", "field", "functions", "information", "infrastructure", "modern", "network", "networks", "physical", "protection", "provide", "reflects", "security", "software", "standards", "systems", "technology"....
0.300
actactiveadministrativeairapproximatelyarmyassignedcivilcommandscomponentscontrolcorecorpsdefensedepartmentfieldglobalheadquartersintegratedintelligence
SHARED TOKENS (37): "act", "active", "administrative", "air", "approximately", "army", "assigned", "civil", "commands", "components", "control", "core", "corps", "defense", "department", "field", "global", "headquarters", "integrated", "intelligence"....
0.300
accordingactivitiesassessmentbasecannotcodecombinedcomplexconditionsconflictcontrolledcoordinationdecisiondecisionsdistinctiondrilleffectsemploymentequipmentgeographic
SHARED TOKENS (40): "according", "activities", "assessment", "base", "cannot", "code", "combined", "complex", "conditions", "conflict", "controlled", "coordination", "decision", "decisions", "distinction", "drill", "effects", "employment", "equipment", "geographic"....
0.300
airconditionscontainingcreatesenvironmentevenhealthidentificationmaterialspersonnelphysicalpropertypublicsafetysystemthemtrained
SHARED TOKENS (17): "air", "conditions", "containing", "creates", "environment", "even", "health", "identification", "materials", "personnel", "physical", "property", "public", "safety", "system", "them", "trained".
0.300
alteramongarmyarticlebasisbecomecapitalconsistscontractsdefensedirectestablishestablishesestablishingfederalgeneralgoverninggovernmenthouseslaw
SHARED TOKENS (38): "alter", "among", "army", "article", "basis", "become", "capital", "consists", "contracts", "defense", "direct", "establish", "establishes", "establishing", "federal", "general", "governing", "government", "houses", "law"....
0.300
advancedagenciesairarmycollegecommandscontractcontractsdefensedepartmentdevelopmentdirectlyfederalfunctionsgovernmentheadquarteredhealthintelligencemanagementmilitary
SHARED TOKENS (37): "advanced", "agencies", "air", "army", "college", "commands", "contract", "contracts", "defense", "department", "development", "directly", "federal", "functions", "government", "headquartered", "health", "intelligence", "management", "military"....
0.300
actactiveassignedcorpsdesignedemergencymilitarynationaloccupationaloperationsorganizationpersonnelprimarilyprovidingreserveroletrainedtrainingunitswork
SHARED TOKENS (20): "act", "active", "assigned", "corps", "designed", "emergency", "military", "national", "occupational", "operations", "organization", "personnel", "primarily", "providing", "reserve", "role", "trained", "training", "units", "work".
0.300
Iraq War ↗ Q545449 KW CROSS HIGH
additionaladministrationamongaroundbroadercenteredcivilclaimscombinedconflictcreatedeffectsgovernmentgroundlawmilitarymillionpositionpriorreport
SHARED TOKENS (24): "additional", "administration", "among", "around", "broader", "centered", "civil", "claims", "combined", "conflict", "created", "effects", "government", "ground", "law", "military", "million", "position", "prior", "report"....
0.300
airarmycivilconflictdefensedepartmentfieldlandmajormaterialsmilitarynationaloperatedoperatesprimarilyprojectedreserverolesstaffsystems
SHARED TOKENS (22): "air", "army", "civil", "conflict", "defense", "department", "field", "land", "major", "materials", "military", "national", "operated", "operates", "primarily", "projected", "reserve", "roles", "staff", "systems"....
0.300
acquisitioncannotconstructiondesigndevelopmentdisciplinedistributionevenfacilitieshealthmaintenancemilitaryoperationspersonnelplanningpurposestoragesupplysupport
SHARED TOKENS (19): "acquisition", "cannot", "construction", "design", "development", "discipline", "distribution", "even", "facilities", "health", "maintenance", "military", "operations", "personnel", "planning", "purpose", "storage", "supply", "support".
0.300
complexdefensedescribeseffectsespeciallyindustrialindustrymilitarypolicypublicrelationshipsignificantsuppliessupplythemtogether
SHARED TOKENS (16): "complex", "defense", "describes", "effects", "especially", "industrial", "industry", "military", "policy", "public", "relationship", "significant", "supplies", "supply", "them", "together".
0.300
administrationagenciesanotherarticlebuildingscentercentralcombinedcomplexconsequencesconstructioncontinuedcostsdefensedepartmentdesigndirectlyeconomyenforcementfederal
SHARED TOKENS (56): "administration", "agencies", "another", "article", "buildings", "center", "central", "combined", "complex", "consequences", "construction", "continued", "costs", "defense", "department", "design", "directly", "economy", "enforcement", "federal"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activecapitalchangescontroldevelopmentexpansionfinancialfinancingfirmfirmsgeneralinvestmentlimitedlong-termmanagementoperationalotherwiseownershipprivateprovide
SHARED TOKENS (26): "active", "capital", "changes", "control", "development", "expansion", "financial", "financing", "firm", "firms", "general", "investment", "limited", "long-term", "management", "operational", "otherwise", "ownership", "private", "provide"....
0.300
Ore genesis ↗ Q7100977 KW CROSS HIGH
actactiveanalysiscomponentsconcentrateconcentrationcurrentformindustrylargemechanismmovingphysicalpositionsource
SHARED TOKENS (15): "act", "active", "analysis", "components", "concentrate", "concentration", "current", "form", "industry", "large", "mechanism", "moving", "physical", "position", "source".
0.300
agenciesbuildingscivilcomponentsconstructiondesigndisciplineengineeringenvironmentfirmsglobalgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysicalprivate
SHARED TOKENS (25): "agencies", "buildings", "civil", "components", "construction", "design", "discipline", "engineering", "environment", "firms", "global", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical", "private"....
0.300
Outsourcing ↗ Q61515 KW CROSS HIGH
anotherassetsbasiscenterclaimscontractingcontrolculturaldomesticevenfirmfunctionsindustrialjobslaterlegallimitedmanagementmanufacturingoperational
SHARED TOKENS (30): "another", "assets", "basis", "center", "claims", "contracting", "control", "cultural", "domestic", "even", "firm", "functions", "industrial", "jobs", "later", "legal", "limited", "management", "manufacturing", "operational"....
0.300
centercurrentdatadepartmentfederalgovernmentheadquarteredlandscapemajormakesmapsnearofficesorganizationpublicregulatoryresearchresourcesspacework
SHARED TOKENS (20): "center", "current", "data", "department", "federal", "government", "headquartered", "landscape", "major", "makes", "maps", "near", "offices", "organization", "public", "regulatory", "research", "resources", "space", "work".
0.300
activitiesadditionalbeginscannotcapabilitiescareereducationestablishimproveinstitutionmilitarypersonnelrolesstafftraining
SHARED TOKENS (15): "activities", "additional", "begins", "cannot", "capabilities", "career", "education", "establish", "improve", "institution", "military", "personnel", "roles", "staff", "training".
0.300
basecodeconcerningdescriptiondevelopeddevelopmentevaluationframeworkhistoricalminingreportingresourceresourcessitestandardssystems
SHARED TOKENS (16): "base", "code", "concerning", "description", "developed", "development", "evaluation", "framework", "historical", "mining", "reporting", "resource", "resources", "site", "standards", "systems".
0.300
academicadditionaladvancedaroundassessmentcareerdescribesdevelopmentemployersemploymentevaluationexperiencefieldinstitutionsknowledgemanagementmilitaryoutsideplanningprimarily
SHARED TOKENS (31): "academic", "additional", "advanced", "around", "assessment", "career", "describes", "development", "employers", "employment", "evaluation", "experience", "field", "institutions", "knowledge", "management", "military", "outside", "planning", "primarily"....
0.300
Combined arms ↗ Q1418029 KW CROSS HIGH
accordingairanothercombinedconsistsdifferentdivisioneffectsenvironmentgroundlandmilitarymodernorganizationprotectrequiressimultaneouslyspacestructuresupport
SHARED TOKENS (26): "according", "air", "another", "combined", "consists", "different", "division", "effects", "environment", "ground", "land", "military", "modern", "organization", "protect", "requires", "simultaneously", "space", "structure", "support"....
0.300
airaroundcapabilitiesconflictdemonstratedesigndesigneddevelopeddirectfacilitiesgroundimproveintendedlandmaintenancemodernprimarilyprogramprotectprovide
SHARED TOKENS (25): "air", "around", "capabilities", "conflict", "demonstrate", "design", "designed", "developed", "direct", "facilities", "ground", "improve", "intended", "land", "maintenance", "modern", "primarily", "program", "protect", "provide"....
0.300
activitiesairarmycollegecombinedcorpscoveringdefensedegreedepartmenteducationeligiblefieldgroupgroupsmilitarymountainoperationsorganizedprogram
SHARED TOKENS (33): "activities", "air", "army", "college", "combined", "corps", "covering", "defense", "degree", "department", "education", "eligible", "field", "group", "groups", "military", "mountain", "operations", "organized", "program"....
🫐 BERRY52 edges
0.280
civildisciplinedistinctemergencygoverningissueslawlawslegalmilitarypopulationpreservationseparatesystems
SHARED TOKENS (14): "civil", "discipline", "distinct", "emergency", "governing", "issues", "law", "laws", "legal", "military", "population", "preservation", "separate", "systems".
0.280
accessdesigneddistinctequipmentgeneralimportantlandlimitedmilitarypublictechnologytraintrainingwildlife
SHARED TOKENS (14): "access", "designed", "distinct", "equipment", "general", "important", "land", "limited", "military", "public", "technology", "train", "training", "wildlife".
0.280
compliancecontinuingmaintenancereplacement
SHARED TOKENS (4): "compliance", "continuing", "maintenance", "replacement". | EXACT TITLE in military: "Aircraft maintenance".
0.280
aroundchangescoveringlargermajormillionmountainnationalpointsmallsnakesouthernvalleywestern
SHARED TOKENS (14): "around", "changes", "covering", "larger", "major", "million", "mountain", "national", "point", "small", "snake", "southern", "valley", "western".
0.280
Air rights ↗ Q4698374 KW CROSS HIGH
airdevelopmentestateimportantinterferencelandlawlawslegalownershippropertyrealrightsspace
SHARED TOKENS (14): "air", "development", "estate", "important", "interference", "land", "law", "laws", "legal", "ownership", "property", "real", "rights", "space".
0.280
additionalconditionsdesigneddevelopmentdifferentfuellargepropertyprotectprotectedsignificanturbanwildfirework
SHARED TOKENS (14): "additional", "conditions", "designed", "development", "different", "fuel", "large", "property", "protect", "protected", "significant", "urban", "wildfire", "work".
0.280
boiseidahomakingmilitary
SHARED TOKENS (4): "boise", "idaho", "making", "military". | EXACT TITLE in military: "Idaho State Veterans Cemetery".
0.280
adaboisecentercentralcontainshistoricidahometropolitanmountainnationalpopulationsectionvalleywestern
SHARED TOKENS (14): "ada", "boise", "center", "central", "contains", "historic", "idaho", "metropolitan", "mountain", "national", "population", "section", "valley", "western".
0.280
actairarmydefensedepartmentfederalgovernmentmilitarynationalofficialorganizedprincipalsecuritystaff
SHARED TOKENS (14): "act", "air", "army", "defense", "department", "federal", "government", "military", "national", "official", "organized", "principal", "security", "staff".
0.260
actclaimsdiscoveryentryfederalgenerallandlandslawlimitedminingpublicsystem
SHARED TOKENS (13): "act", "claims", "discovery", "entry", "federal", "general", "land", "lands", "law", "limited", "mining", "public", "system".
0.260
administrativegeneralmilitary
SHARED TOKENS (3): "administrative", "general", "military". | EXACT TITLE in military: "Adjutant general".
0.260
assetsbecomecontrolcontrolledcostsdevelopedenvironmentalforestinfrastructuremilitarymonitoringriversystem
SHARED TOKENS (13): "assets", "become", "control", "controlled", "costs", "developed", "environmental", "forest", "infrastructure", "military", "monitoring", "river", "system".
0.260
Colluvium ↗ Q1152275 EXACT TITLE
basegeneralmaterial
SHARED TOKENS (3): "base", "general", "material". | EXACT TITLE in geology: "Colluvium".
0.240
airarmycodecodescorpsidentifymilitaryoccupationalqualificationspecialtysystemtraining
SHARED TOKENS (12): "air", "army", "code", "codes", "corps", "identify", "military", "occupational", "qualification", "specialty", "system", "training".
0.240
airanotheremergencyequipmentgroundlocalmeansmilitarypersonnelrequiringtransfertreatment
SHARED TOKENS (12): "air", "another", "emergency", "equipment", "ground", "local", "means", "military", "personnel", "requiring", "transfer", "treatment".
0.240
approximatelychildcurrentdefensedepartmentdependentmilitarymillionpersonnelrelationshipresearchrights
SHARED TOKENS (12): "approximately", "child", "current", "defense", "department", "dependent", "military", "million", "personnel", "relationship", "research", "rights".
0.240
changescivilconstructionengineeringexistingforminformationlandlargelocallyoccurphysical
SHARED TOKENS (12): "changes", "civil", "construction", "engineering", "existing", "form", "information", "land", "large", "locally", "occur", "physical".
0.240
activeagenciescomponentcontrolcoordinationdevelopedemergencymanagementnationalprovidingresponsesystem
SHARED TOKENS (12): "active", "agencies", "component", "control", "coordination", "developed", "emergency", "management", "national", "providing", "response", "system".
0.220
combineddependsdescribesdistributedlargelimitedmodelmodelsneedpracticeresponse
SHARED TOKENS (11): "combined", "depends", "describes", "distributed", "large", "limited", "model", "models", "need", "practice", "response".
0.220
consiststogether
SHARED TOKENS (2): "consists", "together". | EXACT TITLE in geology: "Terrace (geology)".
0.220
Runway ↗ Q184590 EXACT TITLE
designedthough
SHARED TOKENS (2): "designed", "though". | EXACT TITLE in military: "Runway".
0.220
demandelementsenergyexpansionimportantmaterialsnationalrolesecuritystrategicsupply
SHARED TOKENS (11): "demand", "elements", "energy", "expansion", "important", "materials", "national", "role", "security", "strategic", "supply".
0.220
Sedimentology ↗ Q205768 KW CROSS HIGH
affectingbasisformationhistorylinkedmodernphysicalpreservedrecordrelationshipsstructures
SHARED TOKENS (11): "affecting", "basis", "formation", "history", "linked", "modern", "physical", "preserved", "record", "relationships", "structures".
0.220
actactivecomponentsemploymentfederallawmilitarypersonnelprotectreserverights
SHARED TOKENS (11): "act", "active", "components", "employment", "federal", "law", "military", "personnel", "protect", "reserve", "rights".
0.220
Alluvium ↗ Q6185405 EXACT TITLE
consolidatedsetting
SHARED TOKENS (2): "consolidated", "setting". | EXACT TITLE in geology: "Alluvium".
0.210
Graben ↗ Q192810 EXACT TITLE
block
SHARED TOKENS (1): "block". | EXACT TITLE in geology: "Graben".
0.200
accessallowinginformationneedsorganizationpositionprivatesecuritystatusthem
SHARED TOKENS (10): "access", "allowing", "information", "needs", "organization", "position", "private", "security", "status", "them".
0.200
Watershed ↗ Q4018542 EXACT TITLE
topicswatershed
EXACT TITLE in geology: "Watershed".
0.200
administrationdepartmenteducationalinsurancemilitaryoccupationalpersonnelseparatedsocialwide
SHARED TOKENS (10): "administration", "department", "educational", "insurance", "military", "occupational", "personnel", "separated", "social", "wide".
0.200
basechangescreateformlandpointriverseparatedsystemtoward
SHARED TOKENS (10): "base", "changes", "create", "form", "land", "point", "river", "separated", "system", "toward".
0.200
adaboisecapitalidahojurisdictionlocalmetropolitannorthwestpopulationprivate
SHARED TOKENS (10): "ada", "boise", "capital", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
0.180
approximatelyboisedatadistrictsevengovernmentidahopopulationsingle
SHARED TOKENS (9): "approximately", "boise", "data", "districts", "even", "government", "idaho", "population", "single".
0.180
differentmeansmilitarymodelmodelsneedoutsideprofessionalsocial
SHARED TOKENS (9): "different", "means", "military", "model", "models", "need", "outside", "professional", "social".
0.180
changesdifferentdisciplineexamineshistoricalhistoryscalestructuraluses
SHARED TOKENS (9): "changes", "different", "discipline", "examines", "historical", "history", "scale", "structural", "uses".
0.160
controlgovernmentleadershipmilitaryofficialprofessionaltechnicaltitle
SHARED TOKENS (8): "control", "government", "leadership", "military", "official", "professional", "technical", "title".
0.160
Fluorite ↗ Q102151 KW CROSS HIGH
complexdensityformmakingscalesourceusesvalue
SHARED TOKENS (8): "complex", "density", "form", "making", "scale", "source", "uses", "value".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahometropolitanneighboringpopulationshared
SHARED TOKENS (8): "ada", "boise", "canyon", "idaho", "metropolitan", "neighboring", "population", "shared".
0.160
environmentformhealthlargerminingnearsafetysignificant
SHARED TOKENS (8): "environment", "form", "health", "larger", "mining", "near", "safety", "significant".
0.140
becomeemploymentfinancialhealthoccupationsrehabilitationsupport
SHARED TOKENS (7): "become", "employment", "financial", "health", "occupations", "rehabilitation", "support".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitannearlypopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "metropolitan", "nearly", "population".
0.140
articlecurrentgovernmentidaholawsmilitaryoffice
SHARED TOKENS (7): "article", "current", "government", "idaho", "laws", "military", "office".
0.140
Igneous rock ↗ Q42045 KW CROSS HIGH
existingformlargeoccuroccursplatformswide
SHARED TOKENS (7): "existing", "form", "large", "occur", "occurs", "platforms", "wide".
0.140
acquisitionagenciesdatagovgovernmentmanagementsystem
SHARED TOKENS (7): "acquisition", "agencies", "data", "gov", "government", "management", "system".
0.140
approximatelyassociatedcontainsequivalentlaterpresentsignificant
SHARED TOKENS (7): "approximately", "associated", "contains", "equivalent", "later", "present", "significant".
0.140
cannotconservationgroupshabitatmanagementpracticeprotect
SHARED TOKENS (7): "cannot", "conservation", "groups", "habitat", "management", "practice", "protect".
0.140
Great Basin ↗ Q966943 KW CROSS HIGH
idaholargemilesnearlypointvalleywestern
SHARED TOKENS (7): "idaho", "large", "miles", "nearly", "point", "valley", "western".
0.120
actconservationfederalgoverninglawresource
SHARED TOKENS (6): "act", "conservation", "federal", "governing", "law", "resource".
0.120
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahomilesnorthwestpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "miles", "northwest", "population".
0.100
boisegroundidahometropolitanpopulation
SHARED TOKENS (5): "boise", "ground", "idaho", "metropolitan", "population".
0.100
armycomponentsnationalreservetogether
SHARED TOKENS (5): "army", "components", "national", "reserve", "together".
0.100
Air base ↗ Q695850 KW CROSS HIGH
airairportbasemilitaryoperating
SHARED TOKENS (5): "air", "airport", "base", "military", "operating".
0.100
Columbia Plateau ↗ KW CROSS HIGH
geographicidahoimportantriverwide
SHARED TOKENS (5): "geographic", "idaho", "important", "river", "wide".
◈ Frequently Asked Questions
Geology × Military — Treasure Valley
HAIKU · HIGH GATE
How does Snake River Plain geology affect military operations in the Treasure Valley?
The Snake River Plain's volcanic geology and composition determine trafficability and construction feasibility for military installations across Idaho's Treasure Valley region. The United States Forest Service and Bureau of Land Management manage approximately 12 million acres of this geologically distinct landscape, requiring military planners to account for basalt formations and soil conditions when establishing facilities near Boise, Nampa, and Caldwell.
Why do military facilities in the Treasure Valley require geological assessments under federal law?
The National Environmental Policy Act mandates that military development in Canyon County, Ada County, and Owyhee County undergo geological evaluation before construction. Boise State University and College of Western Idaho provide geological expertise to assess hazards including seismic activity and groundwater impacts along the Snake River Plain.
What geological features near Meridian and Boise influence military infrastructure siting?
The Treasure Valley's proximity to the Snake River and underlying aquifer systems requires military planners to conduct subsurface geological surveys in Meridian and Boise metropolitan areas. The Bureau of Land Management coordinates geological baseline studies with military agencies to prevent contamination and ensure facility stability across the region's approximately 3,700 square miles.
How do volcanic deposits in the Treasure Valley affect military construction standards?
Basalt and rhyolite deposits beneath Nampa, Caldwell, and the greater Boise area require specialized foundation engineering standards for military buildings and runways. The United States Forest Service and geological surveys conducted by Boise State University inform these construction protocols across western Idaho's 110-mile-long metropolitan corridor.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Geology × Military 14 QID bridges 256 edges 6,806 ext links 2026-07-17 20:59:50 UTC 522f429fee686245
Geology corridor ↗ Military corridor ↗ Military × Geology ↗ boisestandard.org/standard ↗
Parent Corridors
Geology × All Other Verticals