—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Energy Utilities ↔ relates to ↔ Water Rights

47 Wikipedia bridge articles confirmed in both vertical ledgers. 239 deterministic cross-vertical edges. 6,028 external source links harvested. Every edge provenance-stamped. Every claim auditable.

47 QID Bridge Articles
239 Cross Edges
6,028 External Sources
304 Wikipedia Articles
47 🌲 Evergreen
153 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Energy Utilities
× Water Rights
QID Bridge Articles
47
confirmed Wikipedia overlap
Total Cross Edges
239
External Sources Harvested
6,028
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
New York Canal
score: 1.1500  ·  type: exact_title_cross  ·  22 shared tokens
QID Bridge Titles (20)
New York CanalLucky Peak DamWellGeothermal energyNewlands Reclamation ActGroundwaterBureau of ReclamationDamTreasure ValleyStormwaterWastewater treatmentArrowrock DamAquiferWater treatmentSnake RiverBoise State UniversityPublic utilityClean Water ActGeothermal heatingSanitary sewer
Shared Semantics (20 tokens)
idahoboiseriverirrigationwesternsupplysourcesystemsdammilesenvironmentalgroundwaterindustrialpopulationsurfacetreatmentpubliccapacityvalleyconstruction
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:42:41 UTC
Content Hash
9ae0bf641e4129c1
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
47 BRIDGES
New York Canal
Q49264247 EXACT TITLE 1.150
QID OVERLAP: Q49264247 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (22): "acres", "ada", "approximately", "boise", "canal", "canals", "canyon", "capacity", "channel", "dam", "diversion", "idaho", "irrigation", "lake", "lowell", "miles", "river", "system", "treasure", "valley".... | URL->A (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in energy_utilities: "New York Canal". | EXACT TITLE in water_rights: "New York Canal".
acresadaapproximatelyboisecanalcanalscanyoncapacitychanneldamdiversionidahoirrigationlakelowellmilesriversystemtreasurevalleywesternyork
es at the Diversion Dam in Ada County and ends after 41 miles (66 km) at Lake Lowell in Canyon County. The canal system includes multiple lateral canals that distribute water to approximately 165,000 acres (260 mi2; 670 km2) of Treasure Valley farmland. The canal's concrete channel has a capacity of 2,400 cubic feet (68 m3) per second. History Completion of the Oregon Short Line Railroad in the early 1880s made possible the construction of farming settlements in the Boise Valley. In 1882, investors from New York founded the Idaho Mining and Irrigation Company in order to transform the desert into farmland between the Boise River and the Snake River in southern Idaho Territory. Investors hoped that the company could also begin mining operations in the region, financed by revenue from irrigation canals. Mining engineer Arthur De Wint Foote commenced a survey of the Boise Valley in 1883, and he envisioned a 75-mile (120 km) canal that would draw water from the south side of the Boise River and irrigate 500,000 acres (780 mi2; 2,020 km2) of desert through 5,000 lateral ditches. The main canal became known as the New York Canal, in deference to eastern investors. It was not the first irrigation system in the Boise Valley; in 1878, William H. Ridenbaugh began construction of the Ridenbaugh Canal from the north side of the Boise River, and smaller projects had existed beginning in the 1860s. In the 1880s, work on the New York Canal focused mainly on the Foote survey and on acquiring water rights. The Idaho Mining and Irrigation Company began construction near the Boise River Canyon, about ten miles (16 km) upstream and east of downtown Boise; work required moving boulders and cutting rock. The difficulty of work partially accounted for slow progress on the canal, but another factor was the Depression of 1882–85, and some eastern investors had been forced to divest their holdings in the company. Arthur Foote continued to work with little pay, and the company allowed only a minimum construction effort, this to retain its water rights. In 1888, the Idaho Statesman objected to claims that the New York Canal would be completed that year. The newspaper found that "maps and profiles" were the only work finished, and the editor projected that the canal would require 500 workers over five years before it was completed. In 1889, Idaho Mining and Irrigation Company manager Charles H. Tompkins Jr., estimated that the canal would be seventy miles (110 km) in length and irrigate about 350,000 acres (550 mi2; 1,400 km2), with an estimated capacity of 2,915 cubic feet (82.5 m3) per second, but he admitted that only two miles (3 km) of the canal had been completed. Another Boise River project undertaken by the company, the Phyllis Canal, named for investors from Philadelphia, also had completed about two miles. The Phyllis Canal later became part of the New York Canal system. In 1890, the company secured investment capital of $300,000 to complete work on the canal. The general contractor was Denver railroad builder William C. Bradbury, and the company believed the canal would be finished in 1891. By September, 1890, 220 workers were employed, and the company advertised employment for 1000 workers. But progress on the canal continued into 1892, when work stopped because of disagreements between investors; work resumed in 1893. The Idaho Mining and Irrigation Company became insolvent in 1891, and contractor Bradbury filed a lien against the company that year. Bradbury continued construction on the canal, apparently financed by his own money. He purchased the canal, right of way, and water rights in a sheriff's auction in 1894. Bradbury later sold the uncompleted canal to the Farmers' Canal Company, an association of about 175 local farmers, in 1896. The United States Congress created the U.S. Reclamation Service in 1902, and the bureau gained control of the New York Canal project. After trimming several miles from the former design and completing construction of the canal and diversion dam, the bureau opened the New York Canal on February 22, 1909.
History Completion of the Oregon Short Line Railroad in the early 1880s made possible the construction of farming settlements in the Boise Valley. In 1882, investors from New York founded the Idaho Mining and Irrigation Company in order to transform the desert into farmland between the Boise River and the Snake River in southern Idaho Territory. Investors hoped that the company could also begin mining operations in the region, financed by revenue from irrigation canals. Mining engineer Arthur De Wint Foote commenced a survey of the Boise Valley in 1883, and he envisioned a 75-mile (120 km) canal that would draw water from the south side of the Boise River and irrigate 500,000 acres (780 mi2; 2,020 km2) of desert through 5,000 lateral ditches. The main canal became known as the New York Canal, in deference to eastern investors. It was not the first irrigation system in the Boise Valley; in 1878, William H. Ridenbaugh began construction of the Ridenbaugh Canal from the north side of the Boise River, and smaller projects had existed beginning in the 1860s. In the 1880s, work on the New York Canal focused mainly on the Foote survey and on acquiring water rights. The Idaho Mining and Irrigation Company began construction near the Boise River Canyon, about ten miles (16 km) upstream and east of downtown Boise; work required moving boulders and cutting rock. The difficulty of work partially accounted for slow progress on the canal, but another factor was the Depression of 1882–85, and some eastern investors had been forced to divest their holdings in the company. Arthur Foote continued to work with little pay, and the company allowed only a minimum construction effort, this to retain its water rights. In 1888, the Idaho Statesman objected to claims that the New York Canal would be completed that year. The newspaper found that "maps and profiles" were the only work finished, and the editor projected that the canal would require 500 workers over five years before it was completed. In 1889, Idaho Mining and Irrigation Company manager Charles H. Tompkins Jr., estimated that the canal would be seventy miles (110 km) in length and irrigate about 350,000 acres (550 mi2; 1,400 km2), with an estimated capacity of 2,915 cubic feet (82.5 m3) per second, but he admitted that only two miles (3 km) of the canal had been completed. Another Boise River project undertaken by the company, the Phyllis Canal, named for investors from Philadelphia, also had completed about two miles. The Phyllis Canal later became part of the New York Canal system. In 1890, the company secured investment capital of $300,000 to complete work on the canal. The general contractor was Denver railroad builder William C. Bradbury, and the company believed the canal would be finished in 1891. By September, 1890, 220 workers were employed, and the company advertised employment for 1000 workers. But progress on the canal continued into 1892, when work stopped because of disagreements between investors; work resumed in 1893. The Idaho Mining and Irrigation Company became insolvent in 1891, and contractor Bradbury filed a lien against the company that year. Bradbury continued construction on the canal, apparently financed by his own money. He purchased the canal, right of way, and water rights in a sheriff's auction in 1894. Bradbury later sold the uncompleted canal to the Farmers' Canal Company, an association of about 175 local farmers, in 1896. The United States Congress created the U.S. Reclamation Service in 1902, and the bureau gained control of the New York Canal project. After trimming several miles from the former design and completing construction of the canal and diversion dam, the bureau opened the New York Canal on February 22, 1909.
les (66 km) at Lake Lowell in Canyon County. The canal system includes multiple lateral canals that distribute water to approximately 165,000 acres (260 mi2; 670 km2) of Treasure Valley farmland. The canal's concrete channel has a capacity of 2,400 cubic feet (68 m3) per second. History Completion of the Oregon Short Line Railroad in the early 1880s made possible the construction of farming settlements in the Boise Valley. In 1882, investors from New York founded the Idaho Mining and Irrigation Company in order to transform the desert into farmland between the Boise River and the Snake River in southern Idaho Territory. Investors hoped that the company could also begin mining operations in the region, financed by revenue from irrigation canals. Mining engineer Arthur De Wint Foote commenced a survey of the Boise Valley in 1883, and he envisioned a 75-mile (120 km) canal that would draw water from the south side of the Boise River and irrigate 500,000 acres (780 mi2; 2,020 km2) of desert through 5,000 lateral ditches. The main canal became known as the New York Canal, in deference to eastern investors. It was not the first irrigation system in the Boise Valley; in 1878, William H. Ridenbaugh began construction of the Ridenbaugh Canal from the north side of the Boise River, and smaller projects had existed beginning in the 1860s. In the 1880s, work on the New York Canal focused mainly on the Foote survey and on acquiring water rights. The Idaho Mining and Irrigation Company began construction near the Boise River Canyon, about ten miles (16 km) upstream and east of downtown Boise; work required moving boulders and cutting rock. The difficulty of work partially accounted for slow progress on the canal, but another factor was the Depression of 1882–85, and some eastern investors had been forced to divest their holdings in the company. Arthur Foote continued to work with little pay, and the company allowed only a minimum construction effort, this to retain its water rights. In 1888, the Idaho Statesman objected to claims that the New York Canal would be completed that year. The newspaper found that "maps and profiles" were the only work finished, and the editor projected that the canal would require 500 workers over five years before it was completed. In 1889, Idaho Mining and Irrigation Company manager Charles H. Tompkins Jr., estimated that the canal would be seventy miles (110 km) in length and irrigate about 350,000 acres (550 mi2; 1,400 km2), with an estimated capacity of 2,915 cubic feet (82.5 m3) per second, but he admitted that only two miles (3 km) of the canal had been completed. Another Boise River project undertaken by the company, the Phyllis Canal, named for investors from Philadelphia, also had completed about two miles. The Phyllis Canal later became part of the New York Canal system. In 1890, the company secured investment capital of $300,000 to complete work on the canal. The general contractor was Denver railroad builder William C. Bradbury, and the company believed the canal would be finished in 1891. By September, 1890, 220 workers were employed, and the company advertised employment for 1000 workers. But progress on the canal continued into 1892, when work stopped because of disagreements between investors; work resumed in 1893. The Idaho Mining and Irrigation Company became insolvent in 1891, and contractor Bradbury filed a lien against the company that year. Bradbury continued construction on the canal, apparently financed by his own money. He purchased the canal, right of way, and water rights in a sheriff's auction in 1894. Bradbury later sold the uncompleted canal to the Farmers' Canal Company, an association of about 175 local farmers, in 1896. The United States Congress created the U.S. Reclamation Service in 1902, and the bureau gained control of the New York Canal project. After trimming several miles from the former design and completing construction of the canal and diversion dam, the bureau opened the New York Canal on February 22, 1909.
Lucky Peak Dam
Q6697988 EXACT TITLE 1.150
QID OVERLAP: Q6697988 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (35): "ada", "arrowrock", "boise", "built", "bureau", "construction", "control", "dam", "directly", "downstream", "engineers", "federal", "flood", "full", "idaho", "irrigation", "lake", "level", "lucky", "miles".... | URL->B (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
adaarrowrockboisebuiltbureauconstructioncontroldamdirectlydownstreamengineersfederalfloodfullidahoirrigationlakelevelluckymilesoperatingoperationalpeakpowerprimaryprivatepurposereclamationreservoirriver+5
Lucky Peak Dam is a rolled earth and gravel fill embankment dam in the western United States, located on the Boise River in southwestern Idaho. In Ada County east of Boise, it is directly downstream of Arrowrock Dam, a concrete arch dam completed in 1915. At the time of its construction in the early 1950s, Lucky Peak's primary purpose was flood control, with a secondary purpose of irrigation. The normal operating elevation of the full reservoir is 3,055 feet (931 m) above sea level, the empty reservoir's elevation (Boise River) is 2,824 feet (861 m). Construction began in November 1949 by the U.S. Army Corps of Engineers. Most of the federal dams in southern Idaho, including the others on the Boise River, were built by the Bureau of Reclamation, not the Corps of Engineers. The Idaho Power Company, a private utility, built multiple hydroelectric dams on the Snake River. Located along State Highway 21, ten miles (16 km) upstream from the city of Boise, it was built without hydroelectric power generation. Construction of the powerhouse began in 1984 and it became operational in 1988, generating electricity primarily for Seattle City Light. The dam was named after a nearby mountain in the Boise Range, about four miles (6 km) north of the dam (43.605°N 116.062°W / 43.605; -116.062). The summit elevation of Lucky Peak mountain (a.k.a.
rimary purpose was flood control, with a secondary purpose of irrigation. The normal operating elevation of the full reservoir is 3,055 feet (931 m) above sea level, the empty reservoir's elevation (Boise River) is 2,824 feet (861 m). Construction began in November 1949 by the U.S. Army Corps of Engineers. Most of the federal dams in southern Idaho, including the others on the Boise River, were built by the Bureau of Reclamation, not the Corps of Engineers. The Idaho Power Company, a private utility, built multiple hydroelectric dams on the Snake River. Located along State Highway 21, ten miles (16 km) upstream from the city of Boise, it was built without hydroelectric power generation. Construction of the powerhouse began in 1984 and it became operational in 1988, generating electricity primarily for Seattle City Light. The dam was named after a nearby mountain in the Boise Range, about four miles (6 km) north of the dam (43.605°N 116.062°W / 43.605; -116.062). The summit elevation of Lucky Peak mountain (a.k.a.
rvoir's elevation (Boise River) is 2,824 feet (861 m). Construction began in November 1949 by the U.S. Army Corps of Engineers. Most of the federal dams in southern Idaho, including the others on the Boise River, were built by the Bureau of Reclamation, not the Corps of Engineers. The Idaho Power Company, a private utility, built multiple hydroelectric dams on the Snake River. Located along State Highway 21, ten miles (16 km) upstream from the city of Boise, it was built without hydroelectric power generation. Construction of the powerhouse began in 1984 and it became operational in 1988, generating electricity primarily for Seattle City Light. The dam was named after a nearby mountain in the Boise Range, about four miles (6 km) north of the dam (43.605°N 116.062°W / 43.605; -116.062). The summit elevation of Lucky Peak mountain (a.k.a.
Well
Q43483 EXACT TITLE 1.000
QID OVERLAP: Q43483 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (33): "another", "aquifer", "aquifers", "constructed", "construction", "contains", "create", "date", "developing", "drilling", "environmental", "excavation", "groundwater", "lake", "least", "pipe", "point", "potable", "potential", "provide".... | EXACT TITLE in energy_utilities: "Well". | EXACT TITLE in water_rights: "Well".
anotheraquiferaquifersconstructedconstructioncontainscreatedatedevelopingdrillingenvironmentalexcavationgroundwaterlakeleastpipepointpotablepotentialprovidepumprequireresourcesruralshallowsitestructuresupplysurfacetreatment+3
ly contains more minerals in solution than surface water and may require treatment before being potable. Soil salination can occur as the water table falls and the surrounding soil begins to dry out. Another environmental problem is the potential for methane to seep into the water. History Very early Neolithic wells are known from the Eastern Mediterranean. The oldest reliably dated well is from the pre-pottery neolithic (PPN) site of Kissonerga-Mylouthkia on Cyprus. At around 8400 BC a shaft (well 116) of circular diameter was driven through limestone to reach an aquifer at a depth of 8 metres (26 ft). Well 2070 from Kissonerga-Mylouthkia, dating to the late PPN, reaches a depth of 13 metres (43 ft). Other slightly younger wells are known from this site and from neighbouring Parekklisha-Shillourokambos. A first stone lined well of 5.5 metres (18 ft) depth is documented from a drowned final PPN (c. 7000 BC) site at 'Atlit-Yam off the coast near modern Haifa in Israel.
Rotary drilling machines use a segmented steel drilling string, typically made up of 3m (10ft), 6 m (20 ft) to 8m (26ft) sections of steel tubing that are threaded together, with a bit or other drilling device at the bottom end. Some rotary drilling machines are designed to install (by driving or drilling) a steel casing into the well in conjunction with the drilling of the actual bore hole. Air and/or water is used as a circulation fluid to displace cuttings and cool bits during the drilling. Another form of rotary-style drilling, termed mud rotary, makes use of a specially made mud, or drilling fluid, which is constantly being altered during the drill so that it can consistently create enough hydraulic pressure to hold the side walls of the bore hole open, regardless of the presence of a casing in the well. Typically, boreholes drilled into solid rock are not cased until after the drilling process is completed, regardless of the machinery used. The oldest form of drilling machinery is the cable tool, still used today. Specifically designed to raise and lower a bit into the bore hole, the spudding of the drill causes the bit to be raised and dropped onto the bottom of the hole, and the design of the cable causes the bit to twist at approximately 1⁄4 revolution per drop, thereby creating a drilling action. Unlike rotary drilling, cable tool drilling requires the drilling action to be stopped so that the bore hole can be bailed or emptied of drilled cuttings. Cable tool drilling rigs are rare as they tend to be 10x slower to drill through materials compared to similar diameter rotary air or rotary mud equipped rigs. Drilled wells are usually cased with a factory-made pipe, typically steel (in air rotary or cable tool drilling) or plastic/PVC (in mud rotary wells, also present in wells drilled into solid rock). The casing is constructed by welding, either chemically or thermally, segments of casing together. If the casing is installed during the drilling, most drills will drive the casing into the ground as the bore hole advances, while some newer machines will actually allow for the casing to be rotated and drilled into the formation in a similar manner as the bit advancing just below. PVC or plastic is typically solvent welded and then lowered into the drilled well, vertically stacked with their ends nested and either glued or splined together. The sections of casing are usually 6 metres (20 ft) or more in length, and 4 to 12 in (10 to 30 cm) in diameter, depending on the intended use of the well and local groundwater conditions. Surface contamination of wells in the United States is typically controlled by the use of a surface seal. A large hole is drilled to a predetermined depth or to a confining formation (clay or bedrock, for example), and then a smaller hole for the well is completed from that point forward. The well is typically cased from the surface down into the smaller hole with a casing that is the same diameter as that hole. The annular space between the large bore hole and the smaller casing is filled with bentonite clay, concrete, or other sealant material. This creates an impermeable seal from the surface to the next confining layer that keeps contaminants from traveling down the outer sidewalls of the casing or borehole and into the aquifer. In addition, wells are typically capped with either an engineered well cap or seal that vents air through a screen into the well, but keeps insects, small animals, and unauthorized persons from accessing the well. At the bottom of wells, based on formation, a screening device, filter pack, slotted casing, or open bore hole is left to allow the flow of water into the well. Constructed screens are typically used in unconsolidated formations (sands, gravels, etc.), allowing water and a percentage of the formation to pass through the screen. Allowing some material to pass through creates a large area filter out of the rest of the formation, as the amount of material present to pass into the well slowly decreases and is removed from the well. Rock wells are typically cased with a PVC liner/casing and screen or slotted casing at the bottom, this is mostly present just to keep rocks from entering the pump assembly. Some wells use a filter pack method, where an undersized screen or slotted casing is placed inside the well and a filter medium is packed around the screen, between the screen and the borehole or casing.
Environmental problems A risk with the placement of water wells is soil salination which occurs when the water table of the soil begins to drop and salt begins to accumulate as the soil begins to dry out. Another environmental problem that is very prevalent in water well drilling is the potential for methane to seep through. Soil salination The potential for soil salination is a large risk when choosing the placement of water wells. Soil salination is caused when the water table of the soil drops over time and salt begins to accumulate. In turn, the increased amount of salt begins to dry the soil out.
Geothermal energy
Q127993 EXACT TITLE 1.000
QID OVERLAP: Q127993 in energy_utilities (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (24): "additional", "agricultural", "applications", "boundaries", "built", "capacity", "century", "continued", "cost", "costs", "department", "district", "energy", "formation", "geothermal", "heating", "industrial", "power", "processes", "rate".... | EXACT TITLE in water_rights: "Geothermal energy".
additionalagriculturalapplicationsboundariesbuiltcapacitycenturycontinuedcostcostsdepartmentdistrictenergyformationgeothermalheatingindustrialpowerprocessesratereduceresourcessourcesupply
ergy estimated that power from a newly built plant costs about $0.05/kWh. 16 gigawatts (GW) of geothermal power was available worldwide in 2025, which was less than 1% of renewable power capacity. An additional 28 gigawatts provided heat for district heating, space heating, spas, industrial processes, desalination, and agricultural applications as of 2010.
However, local effects of heat extraction must be considered. Over the course of decades, individual wells draw down local temperatures and water levels. The three oldest sites, at Larderello, Wairakei, and the Geysers experienced reduced output because of local depletion. Heat and water, in uncertain proportions, were extracted faster than they could be replenished. Reducing production and injecting additional water could allow these wells to return to their original capacity. Such strategies have been implemented at some sites, which continue to provide significant energy. The Wairakei power station was commissioned in November 1958, and it attained its peak generation of 173 MW in 1965, but already the supply of high-pressure steam was faltering. In 1982 it was down-rated to intermediate pressure and the output to 157 MW. In 2005, two 8 MW isopentane systems were added, boosting output by about 14 MW.
able worldwide in 2025, which was less than 1% of renewable power capacity. An additional 28 gigawatts provided heat for district heating, space heating, spas, industrial processes, desalination, and agricultural applications as of 2010.
Newlands Reclamation Act
Q9367416 EXACT TITLE 1.000
QID OVERLAP: Q9367416 in energy_utilities (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (31): "act", "among", "association", "authority", "bureau", "construction", "contracts", "department", "federal", "fund", "irrigated", "irrigation", "land", "lands", "law", "maintenance", "major", "meridian", "national", "program".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
actamongassociationauthoritybureauconstructioncontractsdepartmentfederalfundirrigatedirrigationlandlandslawmaintenancemajormeridiannationalprogramprojectprojectsprovisionspublicreceivingreclamationriverseparatesuppliedwest+1
The Reclamation Act (also known as the Lowlands Reclamation Act or National Reclamation Act) of 1902 (Pub. L. 57–161) is a United States federal law that funded irrigation projects for the arid lands of 17 states in the American West. The act at first covered only 16 of the western states, as delineated by the 100th meridian, as Texas had no federal lands. Texas was added later by a special act passed in 1906. The act set aside money from sales of semi-arid public lands for the construction and maintenance of irrigation projects. The newly irrigated land would be sold and money would be put into a revolving fund that supported more such projects. These irrigation projects led to the eventual damming of nearly every major western river. Under the act, the Secretary of the Interior created the United States Reclamation Service within the United States Geological Survey to administer the program. In 1907, the Service became a separate organization within the Department of the Interior and was renamed the United States Bureau of Reclamation. The Act was co-authored by Democratic Congressional Representative Francis G. Newlands of Nevada, Frederick H. Newell of the United States Geological Survey, and George H. Maxwell, head of the National Reclamation Association. Many of the loans made to farmers, funded by the sales of federal land, were never repaid. Amendments made by the Reclamation Project Act of 1939 gave the Department of the Interior, among other things, the authority to amend repayment contracts and to extend repayment for not more than 40 years. Amendments made by the Reclamation Reform Act of 1982 (P.L.
e American West. The act at first covered only 16 of the western states, as delineated by the 100th meridian, as Texas had no federal lands. Texas was added later by a special act passed in 1906. The act set aside money from sales of semi-arid public lands for the construction and maintenance of irrigation projects. The newly irrigated land would be sold and money would be put into a revolving fund that supported more such projects. These irrigation projects led to the eventual damming of nearly every major western river. Under the act, the Secretary of the Interior created the United States Reclamation Service within the United States Geological Survey to administer the program. In 1907, the Service became a separate organization within the Department of the Interior and was renamed the United States Bureau of Reclamation. The Act was co-authored by Democratic Congressional Representative Francis G. Newlands of Nevada, Frederick H. Newell of the United States Geological Survey, and George H. Maxwell, head of the National Reclamation Association. Many of the loans made to farmers, funded by the sales of federal land, were never repaid. Amendments made by the Reclamation Project Act of 1939 gave the Department of the Interior, among other things, the authority to amend repayment contracts and to extend repayment for not more than 40 years. Amendments made by the Reclamation Reform Act of 1982 (P.L.
land would be sold and money would be put into a revolving fund that supported more such projects. These irrigation projects led to the eventual damming of nearly every major western river. Under the act, the Secretary of the Interior created the United States Reclamation Service within the United States Geological Survey to administer the program. In 1907, the Service became a separate organization within the Department of the Interior and was renamed the United States Bureau of Reclamation. The Act was co-authored by Democratic Congressional Representative Francis G. Newlands of Nevada, Frederick H. Newell of the United States Geological Survey, and George H. Maxwell, head of the National Reclamation Association. Many of the loans made to farmers, funded by the sales of federal land, were never repaid. Amendments made by the Reclamation Project Act of 1939 gave the Department of the Interior, among other things, the authority to amend repayment contracts and to extend repayment for not more than 40 years. Amendments made by the Reclamation Reform Act of 1982 (P.L.
Groundwater
Q161598 EXACT TITLE 1.000
QID OVERLAP: Q161598 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (52): "agricultural", "agriculture", "aquifer", "aquifers", "become", "billion", "capacity", "central", "change", "clean", "contains", "discharge", "disposal", "distribution", "drinking", "environmental", "form", "formation", "geothermal", "ground".... | EXACT TITLE in energy_utilities: "Groundwater". | EXACT TITLE in water_rights: "Groundwater".
agriculturalagricultureaquiferaquifersbecomebillioncapacitycentralchangecleancontainsdischargedisposaldistributiondrinkingenvironmentalformformationgeothermalgroundgroundwaterindustriallandlevelmajormunicipaloperatingpercentprimaryprocess+22
d the water table. Groundwater is recharged from the surface; it may discharge from the surface naturally at springs and seeps, and can form oases or wetlands. Groundwater is also often withdrawn for agricultural, municipal, and industrial use by constructing and operating extraction wells. The study of the distribution and movement of groundwater is hydrogeology, also called groundwater hydrology. Typically, groundwater is thought of as water flowing through shallow aquifers, but, in the technical sense, it can also contain soil moisture, permafrost (frozen soil), immobile water in very low permeability bedrock, and deep geothermal or oil formation water. Groundwater is hypothesized to provide lubrication that can possibly influence the movement of faults. It is likely that much of Earth's subsurface contains some water, which may be mixed with other fluids in some instances. Groundwater is often cheaper, more convenient and less vulnerable to pollution than surface water. Therefore, it is commonly used for public drinking water supplies. For example, groundwater provides the largest source of usable water storage in the United States, and California annually withdraws the largest amount of groundwater of all the states. Underground reservoirs contain far more water than the capacity of all surface reservoirs and lakes in the US, including the Great Lakes. Many municipal water supplies are derived solely from groundwater. Over 2 billion people rely on it as their primary water source worldwide. Human use of groundwater causes environmental problems. For example, polluted groundwater is less visible and more difficult to clean up than pollution in rivers and lakes. Groundwater pollution most often results from improper disposal of wastes on land. Major sources include industrial and household chemicals and garbage landfills, excessive fertilizers and pesticides used in agriculture, industrial waste lagoons, tailings and process wastewater from mines, industrial fracking, oil field brine pits, leaking underground oil storage tanks and pipelines, sewage sludge and septic systems. Additionally, groundwater is susceptible to saltwater intrusion in coastal areas and can cause land subsidence when extracted unsustainably, leading to sinking cities (like Bangkok) and loss in elevation (such as the multiple meters lost in the Central Valley of California). These issues are made more complicated by sea level rise and other effects of climate change, particularly those on the water cycle.
Quantities Groundwater is the most accessed source of freshwater around the world, including as drinking water, irrigation, and manufacturing. Groundwater accounts for about half of the world's drinking water, 40% of its irrigation water, and a third of water for industrial purposes. Another estimate stated that globally groundwater accounts for about one third of all water withdrawals, and surface water for the other two thirds. Groundwater provides drinking water to at least 50% of the global population. About 2.5 billion people depend solely on groundwater resources to satisfy their basic daily water needs. A similar estimate was published in 2021 which stated that "groundwater is estimated to supply between a quarter and a third of the world's annual freshwater withdrawals to meet agricultural, industrial and domestic demands." Global freshwater withdrawal was probably around 600 km3 per year in 1900 and increased to 3,880 km3 per year in 2017. The rate of increase was especially high (around 3% per year) during the period 1950–1980, partly due to a higher population growth rate, and partly to rapidly increasing groundwater development, particularly for irrigation. The rate of increase is (as per 2022) approximately 1% per year, in tune with the current population growth rate. Global groundwater depletion has been calculated to be between 100 and 300 km3 per year. This depletion is mainly caused by "expansion of irrigated agriculture in drylands". The Asia-Pacific region is the largest groundwater abstractor in the world, containing seven out of the ten countries that extract most groundwater (Bangladesh, China, India, Indonesia, Iran, Pakistan and Turkey).
Municipal and industrial water supplies are provided through large wells. Multiple wells for one water supply source are termed "wellfields", which may withdraw water from confined or unconfined aquifers. Using groundwater from deep, confined aquifers provides more protection from surface water contamination. Some wells, termed "collector wells", are specifically designed to induce infiltration of surface (usually river) water. Aquifers that provide sustainable fresh groundwater to urban areas and for agricultural irrigation are typically close to the ground surface (within a couple of hundred metres) and have some recharge by fresh water. This recharge is typically from rivers or meteoric water (precipitation) that percolates into the aquifer through overlying unsaturated materials. In cases where the groundwater has unacceptable levels of salinity or specific ions, desalination is a common treatment,.
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (29): "acres", "act", "become", "built", "bureau", "delivery", "department", "development", "diversion", "federal", "irrigation", "lands", "law", "management", "million", "operation", "potential", "power", "program", "projects".... | EXACT TITLE in energy_utilities: "Bureau of Reclamation". | EXACT TITLE in water_rights: "Bureau of Reclamation".
acresactbecomebuiltbureaudeliverydepartmentdevelopmentdiversionfederalirrigationlandslawmanagementmillionoperationpotentialpowerprogramprojectsprovidingprovisionsreclamationresourcesourcestoragesupplythroughoutwestern
power generation. It is currently the U.S.'s largest wholesaler of water, bringing water to more than 31 million people, and providing one in five Western farmers with irrigation water for 10 million acres of farmland, which produce 60% of the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
Dam
Q12323 EXACT TITLE 1.000
QID OVERLAP: Q12323 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (47): "additional", "application", "around", "availability", "building", "built", "century", "clean", "construction", "critical", "dam", "design", "downstream", "engineering", "flood", "flow", "functions", "governing", "hydropower", "increase".... | EXACT TITLE in energy_utilities: "Dam". | EXACT TITLE in water_rights: "Dam".
additionalapplicationaroundavailabilitybuildingbuiltcenturycleanconstructioncriticaldamdesigndownstreamengineeringfloodflowfunctionsgoverninghydropowerincreaseindustrialirrigatedirrigationlandlargemaintenancemanagementprocessprojectprojects+17
ty of concrete and heavy construction machinery led to the creation of many large-scale dam projects worldwide. The most visible part of a dam is the barrier that retains water, but most dams contain additional structures that perform important functions. When a dam blocks a navigable river, locks may be incorporated into the project to allow ships to pass through. Fish ladders are included in many dams to enable fish to migrate upstream. Spillways are often included to safely release excess reservoir water downstream and prevent catastrophic overflows. Dam outlets allow reservoirs to be partially drained to purge sediment, perform maintenance, or increase water flow downstream. A dam may be deliberately removed for various reasons: if it poses a safety hazard, if the dam no longer fulfills its original purpose, to restore fish migration routes, or to improve the health of downstream rivers by improving sediment flow. Dams occasionally fail, resulting in flooding and loss of life.
Embankment dams and concrete dams use distinct construction methods. Embankment dams require vast amounts of soil and rock, which are usually excavated from "borrow areas" near the dam site. The soil and rocks are laid down in successive layers called lifts. After laying down a layer, it is compacted with heavy machinery. The layers must be carefully monitored to ensure that they contain the correct materials, are not overly wet, and are sufficiently compacted. Instruments are embedded within the dam as it is built, and are continually monitored so any defects can be quickly corrected. Concrete dams require a concrete plant to be built near the dam site. The plant combines aggregate (rocks), cement, fly ash, and water to produce concrete. The concrete is delivered from the concrete plant to the dam structure by means of conveyor belts, concrete buckets, dump trucks, or cranes. Formwork is built at the dam location to contain the concrete when it is placed. After it is placed into the dam structure, the concrete must be vibrated to eliminate any bubbles or air pockets. The dam is gradually built up by pouring individual "blocks" of concrete; each block is typically 1.5 to 3 m (5 to 10 ft) high, and 12 to 30 m (39 to 98 ft) wide and deep. Concrete of such thickness – called mass concrete – contracts and generates a large amount of heat as it cures, which can lead to cracks. To mitigate this issue, expansion joints can be included within the dam to permit the concrete to shrink without cracking. After the heat dissipates, the expansion joints are filled with grout, and their upstream edges are sealed with strips of metal, rubber, or plastic. Additionally, refrigeration systems may be employed that circulate coolant through the concrete by means of pipes. A recent innovation is roller compacted concrete (RCC), which has several benefits over conventional concrete. RCC uses less cement, permits the use of aggregate up to 100 mm in size, and does not generate as much heat as conventional concrete.
Journals, news, and websites Ayenalem, Abebe Yirga; et al. (28 December 2023). "Popular Culture and Nile Hydropolitics: Amharic Songs about the Grand Ethiopian Renaissance Dam". International Journal of Water Governance. 10 (1). Delft University of Technology. doi:10.59490/ijwg.10.2023.7359. ISSN 2211-4505. Bellmore, J. R.; et al. (2017) [2016]. "Status and Trends of Dam Removal Research in the United States". WIREs Water. 4 (2) e1164. Wiley-Blackwell. Bibcode:2017WIRWa...4E1164R. doi:10.1002/wat2.1164. ISSN 2049-1948. Retrieved 22 May 2026. Boulange, Julien; et al. (2021). "Role of Dams in Reducing Global Flood Exposure Under Climate Change". Nature Communications. 12 (1) 417. Springer Nature. Bibcode:2021NatCo..12..417B. doi:10.1038/s41467-020-20704-0. ISSN 2041-1723. PMC 7814128. PMID 33462241. Bulu, Atil. "Water Resources: Lecture Notes IV" (PDF). Istanbul Technical University. Retrieved 22 April 2026. Chanson, Hubert (1998). "Extreme Reservoir Sedimentation in Australia" (PDF). International Journal of Sediment Research. 13 (3). International Research and Training Centre on Erosion and Sedimentation: 55–63. ISSN 1001-6279. Retrieved 8 June 2026. Costa, Francisco; et al. (2025). "Local Economic Impacts of Hydroelectric Power Plants: Evidence from Brazil". Economía LACEA Journal. 24 (1). Latin American and Caribbean Economic Association: 105–123. doi:10.31389/eco.466. ISSN 1533-6239. El-Askary, Hesham; et al. (2026). "The World's Largest Saddle Dam at Risk". International Journal of Disaster Risk Reduction. 135 106045. Elsevier. doi:10.1016/j.ijdrr.2026.106045. ISSN 2212-4209. Fowkes, Maja; et al. (2025). "Mega-Dams In the Hydrologics of the Socialist Anthropocene". ARTMargins. 14 (2). The MIT Press: 11–38. doi:10.1162/artm_a_00411. ISSN 2162-2574. Retrieved 21 May 2026. Ghiasi, Behzad; et al. (2025). "Estimating the Volume of Evaporation from the Main Dams of Iran". Results in Engineering. 27 107057. Elsevier. doi:10.1016/j.rineng.2025.107057. ISSN 2590-1230. Retrieved 5 July 2026. Graves, Carl (29 August 2016). "Buhen: A Site Submerged". Egypt Exploration Society. Retrieved 29 May 2026. Gyau-Boakye, P. (2001). "Environmental Impacts of the Akosombo Dam and Effects of Climate Change on the Lake Levels". Environment, Development and Sustainability. 3 (1). Springer Nature: 17–29. Bibcode:2001EDSus...3...17G. doi:10.1023/A:1011402116047. ISSN 1573-2975. Retrieved 14 June 2026. Horn, John (1 May 2014). "Patagonia's New Line of Activism Is Documentary 'DamNation'". Los Angeles Times. Huang, Zhenli; et al. (2024). "Dams Trigger Exponential Population Declines of Migratory Fish". Science Advances. 10 (19) eadi6580. American Association for the Advancement of Science. doi:10.1126/sciadv.adi6580. ISSN 2375-2548. Retrieved 4 July 2026. Jeuland, Marc (2020). "The Economics of Dams" (PDF). Oxford Review of Economic Policy. 36 (1): 45–68. doi:10.1093/oxrep/grz028. ISSN 0266-903X. Retrieved 2 June 2026. Kakoyannis, Christina; et al. (2002). Assessing and Evaluating Recreational Uses of Water Resources: Implications for an Integrated Management Framework (PDF). PNW-GTR-536 (Report). US Department of Agriculture. doi:10.2737/pnw-gtr-536. Retrieved 5 July 2026. Kayiranga, Alphonse; et al. (2024). "Anthropogenic activities and the influence of desertification processes on the water cycle and water use in the Aral Sea basin". Journal of Hydrology: Regional Studies. 51 101598. Elsevier. doi:10.1016/j.ejrh.2023.101598. ISSN 2214-5818. Retrieved 9 July 2026. Keijzer, Tamara; et al. (2024). "Threats of Dams to the Persistence of the World's Freshwater Fishes". Global Change Biology. 30 (2) e17166. Wiley-Blackwell. doi:10.1111/gcb.17166. ISSN 1365-2486. Retrieved 4 July 2026. Krol, Debra (2 September 2024). "Largest Dam Removal Project in US: Klamath River Flows Freely". USA TODAY. Retrieved 22 May 2026. Larsen, Annegret; et al. (2021). "Dam Builders and Their Works: Beaver Influences on the Structure and Function of River Corridor Hydrology, Geomorphology, Biogeochemistry and Ecosystems". Earth-Science Reviews. 218 103623. Elsevier. Bibcode:2021ESRv..21803623L. doi:10.1016/j.earscirev.2021.103623. ISSN 0012-8252. Retrieved 9 June 2026. Lehner, Bernhard; et al. (2011). "High-Resolution Mapping of the World's Reservoirs and Dams for Sustainable River-Flow Management". Frontiers in Ecology and the Environment. 9 (9). Ecological Society of America: 494–502. Bibcode:2011FrEE....9..494L. doi:10.1890/100125. ISSN 1540-9295. Retrieved 30 April 2026. Lichtenstein, Grace (20 January 1976). "Edward Abbey, Voice of Southwest Wilds". The New York Times. Retrieved 17 May 2026. Liu, Xiongjun; et al. (2019). "Biodiversity Decline of Fish Assemblages After the Impoundment of the Three Gorges Dam in the Yangtze River Basin, China". Reviews in Fish Biology and Fisheries. 29 (1). doi:10.1007/s11160-019-09548-0. ISSN 1573-5184. Retrieved 21 June 2026. Marchetti, Nicolò; et al. (2019). "A Multi-scalar Approach for Assessing the Impact of Dams on the Cultural Heritage in the Middle East and North Africa". Journal of Cultural Heritage. 37. Elsevier: 17–28. doi:10.1016/j.culher.2018.10.007. ISSN 1296-2074. Retrieved 26 May 2026. McSweeney, Catherine (1 September 2023). "Rewilding Europe's Rivers with Dam Removal Boosts Biodiversity, Economy". European Investment Bank. Retrieved 22 May 2026. Morison, Conner A. G.; et al. (2023). "Mount Garibaldi: Hazard Potential from a Long-Dormant Volcanic System in the Pacific Northwest". Canadian Journal of Earth Sciences. 60 (5). Canadian Science Publishing: 464–484. doi:10.1139/cjes-2022-0067. ISSN 0008-4077. Niranjan, Ajit (21 May 2026). "Record Number of Dams Dismantled in Europe in Effort to Help Wildlife Thrive". The Guardian. Retrieved 22 May 2026. Onder, H.; Yilmaz, M. (2005). "Underground Dams: A Tool of Sustainable Development and Management of Ground Resources" (PDF). European Water. 11 (12). European Water Resources Association: 35–45. ISSN 1105-7580. Retrieved 9 May 2026. Author M. Yilmaz wrote a 2003 Masters thesis with additional detail and history on underground dams. Pearse-Smith, Scott W.D.; et al. (February 2014). "The Return of Large Dams to the Development Agenda: A Post-Development Critique". Consilience: The Journal of Sustainable Development. 11 (11). Columbia University Libraries: 123–131. ISSN 2333-9705. JSTOR 26188733. Ranjan, Amit (2024). "Grand Ethiopian Renaissance Dam Dispute: Implications, Negotiations, And Mediations". Journal of Contemporary African Studies. 42 (1). Routledge: 18–36. doi:10.1080/02589001.2023.2287425. ISSN 0258-9001. Ritchie, A. C.; et al. (2018). "Morphodynamic Evolution Following Sediment Release from the World's Largest Dam Removal". Scientific Reports. 8 (1) 13279. National Library of Medicine. Bibcode:2018NatSR...813279R. doi:10.1038/s41598-018-30817-8. ISSN 2045-2322. PMC 6125403. PMID 30185796. Ritchie, Hannah; et al. (2025). "Renewable Energy". Our World in Data. Retrieved 14 June 2026. Scott, K. F.; et al. (1968). "Farahnaz Pahlavi Dam at Layiyan". Proceedings of the Institution of Civil Engineers. 39 (3). Institution of Civil Engineers: 353–395. doi:10.1680/iicep.1968.8072. ISSN 1753-7789. Retrieved 3 July 2026. Sutor, Dave (24 March 2018). "Johnstown Flood: McCullough's 'Lucky Break' Launched Career". AP News. Retrieved 16 May 2026. Villamayor-Tomas, Sergio; et al. (2026). "Challenges and Opportunities for the Governance of Hydropower". Nature Sustainability. 9 (5). Nature Portfolio: 653–663. Bibcode:2026NatSu...9..653V. doi:10.1038/s41893-026-01782-2. ISSN 2398-9629. Retrieved 25 April 2026. Vogt, Berber (2019). "The Afsluitdijk as a Complex System". Insight. 22 (1). International Council on Systems Engineering: 32–36. doi:10.1002/inst.12235. ISSN 2156-485X. Retrieved 3 July 2026. Watts, Jonathan (25 February 2019). "Concrete: the Most Destructive Material on Earth". The Guardian. Retrieved 31 May 2026. Wieland, Martin (15 September 2023). "Comparing Vulnerabilities of CFRDs and ECRDs". International Water Power & Dam Construction. Wilmington plc. ISSN 0306-400X. Retrieved 31 May 2026. Zafarnejad, Fatemeh; et al. (2009). "The Contribution of Dams to Iran's Desertification". International Journal of Environmental Studies. 66 (3). Routledge: 327--341. doi:10.1080/00207230902798648. ISSN 0020-7233. Retrieved 5 July 2026. Zhang, Hui; et al. (2020). "Extinction of One of the World's Largest Freshwater Fishes: Lessons for Conserving the Endangered Yangtze Fauna". Science of The Total Environment. 710 136242. Elsevier. doi:10.1016/j.scitotenv.2019.13624. ISSN 0048-9697.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "rural", "snake", "treasure", "valley", "western". | EXACT TITLE in energy_utilities: "Treasure Valley". | EXACT TITLE in water_rights: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalmetropolitanregionresourcesriverruralsnaketreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Stormwater
Q1421263 EXACT TITLE 1.000
QID OVERLAP: Q1421263 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (23): "become", "create", "demand", "directly", "groundwater", "land", "large", "major", "natural", "population", "potential", "precipitation", "reduce", "related", "resource", "right", "storm", "stormwater", "surface", "timing".... | EXACT TITLE in energy_utilities: "Stormwater". | EXACT TITLE in water_rights: "Stormwater".
becomecreatedemanddirectlygroundwaterlandlargemajornaturalpopulationpotentialprecipitationreducerelatedresourcerightstormstormwatersurfacetimingtreatmenturbanvolume
Stormwater, also written storm water, is water that originates from precipitation (storm), including heavy rain and meltwater from hail and snow. Stormwater can soak into the soil (infiltrate) and become groundwater, be stored on depressed land surface in ponds and puddles, evaporate back into the atmosphere, or contribute to surface runoff. Most runoff is conveyed directly as surface water to nearby streams, rivers or other large water bodies (wetlands, lakes and oceans) without treatment. In natural landscapes, such as forests, soil absorbs much of the stormwater. Plants also reduce stormwater by improving infiltration, intercepting precipitation as it falls, and by taking up water through their roots. In developed environments, such as cities, unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
Stormwater creation of sinkhole collapses An example of urban stormwater creating a sinkhole collapse is the February 25, 2002 Dishman Lane collapse in Bowling Green, Kentucky where a sinkhole suddenly dropped the road under four traveling vehicles. The nine-month repair of the Dishman Lane collapse cost a million dollars but there remains the potential for future problems. In undisturbed areas with natural subsurface (karst) drainage, soil and rock fragments choke karst openings, thereby being a self-limitation to the growth of openings. The undisturbed karst drainage system becomes balanced with the climate so it can drain the water produced by most storms. However, problems occur when the landscape is altered by urban development. In urban areas with natural subsurface karst drainage there are no surface streams for the increased stormwater from impervious surfaces such as roofs, parking lots, and streets to receive drainage. Instead, the stormwater enters the subsurface drainage system by moving down through the ground. When the subsurface water flow becomes great enough to transport soil and rock fragments, the karst openings grow rapidly. Where karst openings are roofed by supportive (competent) limestone, there frequently is no surface warning that an opening has grown so large it will suddenly collapse catastrophically. It is recommended that land-use planning agencies avoid karst areas when considering new development projects.
so reduce stormwater by improving infiltration, intercepting precipitation as it falls, and by taking up water through their roots. In developed environments, such as cities, unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
Wastewater treatment
Q20127660 EXACT TITLE 1.000
QID OVERLAP: Q20127660 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (22): "agricultural", "another", "biological", "disposal", "domestic", "environment", "facility", "industrial", "main", "mean", "municipal", "process", "processes", "purpose", "resulting", "reuse", "separation", "treated", "treatment", "uses".... | EXACT TITLE in energy_utilities: "Wastewater treatment". | EXACT TITLE in water_rights: "Wastewater treatment".
agriculturalanotherbiologicaldisposaldomesticenvironmentfacilityindustrialmainmeanmunicipalprocessprocessespurposeresultingreuseseparationtreatedtreatmentuseswastewastewater
age treatment plant. In the latter case the industry typically performs on-site pretreatment of the waste, before it is sent to the municipal plant. Other types of wastewater treatment plants include agricultural wastewater treatment and leachate treatment plants. The term "wastewater treatment" is often used to mean "sewage treatment". Common processes in wastewater treatment include phase separation, such as sedimentation, various biological and chemical processes, such as oxidation, and polishing. The main by-product from wastewater treatment plants is a type of sludge that is usually treated in the same or another wastewater treatment plant. Biogas can be another by-product if the process uses anaerobic treatment. Treated wastewater can be reused as reclaimed water. The main purpose of wastewater treatment is for the treated wastewater to be able to be disposed or reused safely.
Types of treatment plants Wastewater treatment plants may be distinguished by the type of wastewater to be treated. There are numerous processes that can be used to treat wastewater depending on the type and extent of contamination. The treatment steps include physical, chemical and biological treatment processes. Types of wastewater treatment plants include: Sewage treatment plants Industrial wastewater treatment plants Agricultural wastewater treatment plants Leachate treatment plants Sewage treatment plants Industrial wastewater treatment plants Agricultural wastewater treatment plants Leachate treatment plants Leachate treatment plants are used to treat leachate from landfills.
mentation, various biological and chemical processes, such as oxidation, and polishing. The main by-product from wastewater treatment plants is a type of sludge that is usually treated in the same or another wastewater treatment plant. Biogas can be another by-product if the process uses anaerobic treatment. Treated wastewater can be reused as reclaimed water. The main purpose of wastewater treatment is for the treated wastewater to be able to be disposed or reused safely.
Arrowrock Dam
Q117911 EXACT TITLE 1.000
QID OVERLAP: Q117911 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (24): "agriculture", "arrowrock", "boise", "bureau", "civil", "counties", "dam", "engineering", "engineers", "idaho", "irrigation", "level", "lucky", "national", "operated", "peak", "primary", "provide", "purpose", "reclamation".... | EXACT TITLE in energy_utilities: "Arrowrock Dam". | EXACT TITLE in water_rights: "Arrowrock Dam".
agriculturearrowrockboisebureaucivilcountiesdamengineeringengineersidahoirrigationlevelluckynationaloperatedpeakprimaryprovidepurposereclamationreservoirriverupstreamwestern
nd Elmore counties, upstream of the Lucky Peak Dam and reservoir. The spillway elevation for Arrowrock is 3,219 feet (981 m) above sea level and its primary purpose is to provide irrigation water for agriculture. The dam was designated as a National Historic Civil Engineering Landmark by the American Society of Civil Engineers in 2016, and is operated by the U.S. Bureau of Reclamation. Preparations In 1910, the Reclamation Service began to consider another storage facility farther east on the Boise River. After several surveys, engineers decided upon the Arrowrock site which had previously been the site of a private irrigation venture under the direction of Arthur De Wint Foote yet failed for lack of funding. The Arrowrock site is at the confluence of the main channel and the south fork. That was to be the most ambitious project to date for Reclamation. At 348 feet (106 m), Arrowrock would be the largest concrete arch dam in the world. Prior to construction, considerable preparatory work would need to be completed. As the structure was some twenty miles (32 km) upstream from the Boise River Diversion Dam, routing supplies to the worksite would be a massive undertaking unto itself. The Reclamation Service elected to construct a new rail line on the old wagon road leading north to Idaho City. The railroad would begin at the Barberton mill near the Diversion Dam and extend to through a winding canyon up to Arrowrock. Even before the dam had been approved, Reclamation began work on the rail line. Some significant problems existed with construction of the railroad. The Barberton Lumber Company owned the road's right-of-way. That meant that the Reclamation Service needed to come to an agreement over ownership of the rail line. In an unprecedented move, the government agreed to lease the track from Barberton but run the actual locomotive. Part of this agreement stipulated that the line would remain a common carrier. That made the Arrowrock & Boise Railroad the first publicly owned line in the nation. The Service hid this fact from President William Howard Taft when it applied for the Arrowrock Dam's approval. Fortunately for Reclamation, Taft failed to recognize the loophole and in June 1910, the entire project went forward. However, when the Oregon Shortline refused to honor the pact between Barberton and Reclamation, the Arrowrock & Boise terminal was reduced to a field just outside the Barber lumberyard. On August 22, 1910, the entire deal was finalized and work began on the line to the Arrowrock site. Salt Lake City's Manly Brothers won the contract for grading the Arrowrock & Boise road in May 1911. The government called for force account to lay the track from Barber to the work site. Although the construction was delayed several times by the shortage of railroad ties, workers finished the track in early November. By most accounts, the trip through the canyon was a very long and harrowing event. For the first several months, riders were asked to disembark at the unfinished Gooseneck Bridge while the cars were winched across one at a time. However, once they arrived, most passengers were surprised by what they found. Not only was the view breathtaking but the "work" camp offered amenities that were unavailable to some residents of the Treasure Valley. Not only was the site fully powered, but also it provided a central heating plant, running water and an efficient sewage system. Along with the Reclamation offices, the Arrowrock camp carried a hospital, mess hall, post office, and hotel. Workers and visitors were offered lodging in the site's hotel, bunkhouses, or cottages. In addition to the outdoor recreational activities, the camp also operated a YMCA, school, and dancehall. At the peak of construction, some 1,400 people had called Arrowrock home, including some 200 families. To provide power for the site, Reclamation retrofitted The Boise River Diversion Dam with a small powerhouse. Finished in 1912, the plant's three generators produced 1,500 kilowatts of electricity for Arrowrock's camp, sawmills, and giant cement mixers. The German made Allis-Chalmers 725 horsepower (541 kW) turbines, the first in the world to be built with a vertical shaft design. Along with the power lines, government workers hung a two-way phone cable to connect Arrowrock with the outside world. In 1976, the power plant was added to the National Register of Historic Places. After being refurbished by the Bonneville Power Administration in 2002, it is now on ready reserve status and occasionally provides surplus power during times of peak demand. Special care was made to maintain the historic qualities of the powerhouse.
. Bureau of Reclamation. Preparations In 1910, the Reclamation Service began to consider another storage facility farther east on the Boise River. After several surveys, engineers decided upon the Arrowrock site which had previously been the site of a private irrigation venture under the direction of Arthur De Wint Foote yet failed for lack of funding. The Arrowrock site is at the confluence of the main channel and the south fork. That was to be the most ambitious project to date for Reclamation. At 348 feet (106 m), Arrowrock would be the largest concrete arch dam in the world. Prior to construction, considerable preparatory work would need to be completed. As the structure was some twenty miles (32 km) upstream from the Boise River Diversion Dam, routing supplies to the worksite would be a massive undertaking unto itself. The Reclamation Service elected to construct a new rail line on the old wagon road leading north to Idaho City. The railroad would begin at the Barberton mill near the Diversion Dam and extend to through a winding canyon up to Arrowrock. Even before the dam had been approved, Reclamation began work on the rail line. Some significant problems existed with construction of the railroad. The Barberton Lumber Company owned the road's right-of-way. That meant that the Reclamation Service needed to come to an agreement over ownership of the rail line. In an unprecedented move, the government agreed to lease the track from Barberton but run the actual locomotive. Part of this agreement stipulated that the line would remain a common carrier. That made the Arrowrock & Boise Railroad the first publicly owned line in the nation. The Service hid this fact from President William Howard Taft when it applied for the Arrowrock Dam's approval. Fortunately for Reclamation, Taft failed to recognize the loophole and in June 1910, the entire project went forward. However, when the Oregon Shortline refused to honor the pact between Barberton and Reclamation, the Arrowrock & Boise terminal was reduced to a field just outside the Barber lumberyard. On August 22, 1910, the entire deal was finalized and work began on the line to the Arrowrock site. Salt Lake City's Manly Brothers won the contract for grading the Arrowrock & Boise road in May 1911. The government called for force account to lay the track from Barber to the work site. Although the construction was delayed several times by the shortage of railroad ties, workers finished the track in early November. By most accounts, the trip through the canyon was a very long and harrowing event. For the first several months, riders were asked to disembark at the unfinished Gooseneck Bridge while the cars were winched across one at a time. However, once they arrived, most passengers were surprised by what they found. Not only was the view breathtaking but the "work" camp offered amenities that were unavailable to some residents of the Treasure Valley. Not only was the site fully powered, but also it provided a central heating plant, running water and an efficient sewage system. Along with the Reclamation offices, the Arrowrock camp carried a hospital, mess hall, post office, and hotel. Workers and visitors were offered lodging in the site's hotel, bunkhouses, or cottages. In addition to the outdoor recreational activities, the camp also operated a YMCA, school, and dancehall. At the peak of construction, some 1,400 people had called Arrowrock home, including some 200 families. To provide power for the site, Reclamation retrofitted The Boise River Diversion Dam with a small powerhouse. Finished in 1912, the plant's three generators produced 1,500 kilowatts of electricity for Arrowrock's camp, sawmills, and giant cement mixers. The German made Allis-Chalmers 725 horsepower (541 kW) turbines, the first in the world to be built with a vertical shaft design. Along with the power lines, government workers hung a two-way phone cable to connect Arrowrock with the outside world. In 1976, the power plant was added to the National Register of Historic Places. After being refurbished by the Bonneville Power Administration in 2002, it is now on ready reserve status and occasionally provides surplus power during times of peak demand. Special care was made to maintain the historic qualities of the powerhouse.
Work began on the Arrowrock Dam in early 1912 and moved along at a record-setting pace. As labor was becoming more plentiful with the completion of Deer Flat and the Diversion Dam, wage rates began to decrease. Common laborers were now offered $2.40 and day while skilled workers pulled in anywhere from $3.00 to $4.00. In addition, several deductions were made for room and board. Workers could choose between the dormitory style bunkhouses at $1.25 a month or a private room at $4.00. Seventy-five cents was deducted each day for meals and $1.00 a month went towards hospital costs. The work proved moderately dangerous and accounted for numerous injuries and twelve deaths. However, despite the hazards and reduction in pay, it appears there was a unique level of camaraderie at the Arrowrock site. As stated above, the workers set several construction records, not the least of which included the 527,300 cubic yards (403,100 m3) of concrete laid on the dam. The Reclamation Service spared no expense regarding the equipment at Arrowrock Dam. Along with the refurbished 70-ton Atlantic steam shovel from Deer Flat were two versatile 18-ton "dinkey" excavators and several brand new dump cars. The cement mixers produced over 2,000 barrels per day and ran uninterrupted for almost 30 months. Two 12-ton Lidgerwood cableways hovered over the site and moved material and concrete from their loading grounds to the dam site. Scores of horse teams helped carry equipment and gravel from the camp to the various work areas. Additionally, one Buick and seven Ford trucks serviced both crews and visitors and provided an unexpected level of mobility throughout the campsite. In an effort to alleviate some of the discomfort along the Boise & Arrowrock, Reclamation purchased a 60-ton locomotive and several new passenger cars. For almost five years, the train ran faithfully through the canyon, delivering over 89,500 visitors and crewmen.
Aquifer
Q208791 EXACT TITLE 1.000
QID OVERLAP: Q208791 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (23): "aquifer", "aquifers", "beyond", "characteristics", "environment", "flow", "formation", "groundwater", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "related", "solid", "source", "study".... | EXACT TITLE in energy_utilities: "Aquifer". | EXACT TITLE in water_rights: "Aquifer".
aquiferaquifersbeyondcharacteristicsenvironmentflowformationgroundwaterhomeindustriallandlayermajormaterialspressureregionrelatedsolidsourcestudyundergroundunderlyingwells
An aquifer is an underground layer of water-bearing material consisting of permeable or fractured rock, or of unconsolidated materials (gravel, sand, or silt). Aquifers vary greatly in their characteristics. The study of water flow in aquifers and the characterization of aquifers is called hydrogeology. Related concepts include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
aquifers is called hydrogeology. Related concepts include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
Water treatment
Q1058719 EXACT TITLE 1.000
QID OVERLAP: Q1058719 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (24): "advanced", "appropriate", "becomes", "components", "drinking", "energy", "environment", "environmental", "flow", "industrial", "irrigation", "maintenance", "materials", "process", "processes", "quality", "receiving", "recreation", "resource", "river".... | EXACT TITLE in energy_utilities: "Water treatment". | EXACT TITLE in water_rights: "Water treatment".
advancedappropriatebecomescomponentsdrinkingenergyenvironmentenvironmentalflowindustrialirrigationmaintenancematerialsprocessprocessesqualityreceivingrecreationresourceriversupplysystemstreatmentuses
ts, or reduces their concentration so that the water becomes fit for its desired end-use. This treatment is crucial to human health and allows humans to benefit from both drinking and irrigation use. Advanced water treatment methods have been developed in recent decades due to increased concerns about new pollutants like microplastics, pharmaceuticals, and per- and polyfluoroalkyl substances (PFAS). These include advanced oxidation processes, membrane filtration, and adsorption-based techniques utilizing materials like tailored nanomaterials and activated carbon.
eatment methods have been developed in recent decades due to increased concerns about new pollutants like microplastics, pharmaceuticals, and per- and polyfluoroalkyl substances (PFAS). These include advanced oxidation processes, membrane filtration, and adsorption-based techniques utilizing materials like tailored nanomaterials and activated carbon.
Water treatment is any process that improves the quality of water to make it appropriate for a specific end-use. The end use may be drinking, industrial water supply, irrigation, river flow maintenance, water recreation or many other uses, including being safely returned to the environment. Water treatment removes contaminants and undesirable components, or reduces their concentration so that the water becomes fit for its desired end-use. This treatment is crucial to human health and allows humans to benefit from both drinking and irrigation use. Advanced water treatment methods have been developed in recent decades due to increased concerns about new pollutants like microplastics, pharmaceuticals, and per- and polyfluoroalkyl substances (PFAS). These include advanced oxidation processes, membrane filtration, and adsorption-based techniques utilizing materials like tailored nanomaterials and activated carbon.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (45): "agencies", "altered", "canyon", "central", "century", "channel", "commercial", "constructed", "construction", "control", "dam", "downstream", "drains", "eastern", "flood", "habitat", "history", "idaho", "irrigation", "lake".... | EXACT TITLE in energy_utilities: "Snake River". | EXACT TITLE in water_rights: "Snake River".
agenciesalteredcanyoncentralcenturychannelcommercialconstructedconstructioncontroldamdownstreamdrainseasternfloodhabitathistoryidahoirrigationlakelargelimitedmajormilesnationalnorthwestpolicyprivateprogramsprojects+15
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Populations of anadromous fish began to decline in the late 1800s due to the impact of commercial fishing, logging, mining and agriculture, but even in the 1930s, returning fall chinook alone numbered 500,000. Populations further collapsed once dams were built on the lower Snake and Columbia Rivers, and Hells Canyon Dam blocked access to the upper Snake. Wild Snake River spring and summer chinook returns declined from 130,000 in the 1950s to less than 5,000 in the 1990s. Wild steelhead returns followed a similar pattern, falling from 110,000 in the 1960s to less than 10,000 in the 1990s. Spring, summer and fall-run chinook were all listed as threatened in 1992. Snake River steelhead were also listed as threatened in 1997. Wild chinook salmon and steelhead continued to decline into the 1990s, but have begun an unsteady recovery since 2000, with both chinook and steelhead returns up to 20,000–30,000 in some years. Coho salmon had disappeared from the Snake River by the 1980s, they were reintroduced to the watershed in 1995. Snake River sockeye once numbered to up 150,000 adults. Between 24,000 and 30,000 sockeye returned to Wallowa Lake in the Grande Ronde River watershed, but the run was eliminated by 1905 due to overharvest and unscreened irrigation diversions. The Payette Lake population once numbering up to 100,000 was blocked by the Black Canyon Dam in 1924. Sockeye in the Yellowbelly, Stanley, and Pettit Lakes of the Sawtooth basin were eradicated by management actions of the Idaho Department of Fish and Game in the 1950s, and irrigation diversions lead to the extirpation of the Pettit Lake population. Snake River sockeye returns declined to 4,500 in the 1950s and only a few dozen by the late 1960s. Snake River sockeye were listed as endangered in 1991. Numerous hatcheries are operated by agencies such as the Army Corps, Idaho Power, the Bonneville Power Administration, the U.S. Bureau of Indian Affairs and the U.S. Fish and Wildlife Service, to supplement wild fish populations. Hatcheries release about 33 million salmon and steelhead smolt into the Snake River watershed each year. However, the survival rate for hatchery fish is poor. Just 0.4 percent of hatchery chinook and 1.5 percent of hatchery steelhead returned as adults, as measured at Lower Granite Dam between 2007 and 2016. Upstream of the four lower dams, the Snake River watershed contains some of the best remaining spawning habitat in the Columbia River system, particularly along the Clearwater and Salmon Rivers; the latter is one of the longest undammed rivers in the continental US. A much depleted sockeye salmon run continues to spawn in Redfish Lake near Stanley, Idaho, more than 900 miles (1,400 km) inland from the Pacific Ocean.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (19): "among", "boise", "business", "college", "degrees", "division", "education", "engineering", "idaho", "independent", "institution", "million", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in energy_utilities: "Boise State University". | EXACT TITLE in water_rights: "Boise State University".
amongboisebusinesscollegedegreesdivisioneducationengineeringidahoindependentinstitutionmillionprogramprogramspublicreportedresearchuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Public utility
Q1951366 EXACT TITLE 1.000
QID OVERLAP: Q1951366 in energy_utilities (tier:evergreen) and water_rights (tier:branch). | SHARED TOKENS (36): "cannot", "characteristics", "clean", "communications", "competing", "control", "costs", "different", "disposal", "energy", "entity", "federal", "infrastructure", "institution", "issue", "large", "lines", "local", "maintains", "market".... | EXACT TITLE in energy_utilities: "Public utility".
cannotcharacteristicscleancommunicationscompetingcontrolcostsdifferentdisposalenergyentityfederalinfrastructureinstitutionissuelargelineslocalmaintainsmarketnaturaloperatespointproductionprovidingpublicregulationrepresentssubjectsupply+6
y, or natural gas pipelines, have natural monopoly characteristics. A monopoly can occur when it finds the best way to minimize its costs through economies of scale to the point where other companies cannot compete with it. If the infrastructure already exists in a given area, minimal benefit is gained through competing. In other words, these industries are characterized by economies of scale in production. Though it can be mentioned that these natural monopolies are handled or watched by a public utilities commission, or an institution that represents the government. There are many different types of public utilities. Some, especially large companies, offer multiple products, such as electricity and natural gas. Other companies specialize in a specific product, such as water. Modern public utilities may also be partially (or completely) sourced from clean and renewable energy in order to produce sustainable electricity. Of these, wind turbines and solar panels are those used most frequently. Whether broadband internet access should be a public utility is a question that was being discussed with the rise of internet usage. This is a question that was being asked due to the telephone service being considered a public utility. Since arguably broadband internet access has taken over telephone service, perhaps it should be a public utility. The Federal Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear.
isposal, and other communication systems represent much of the public utility market. The transmission lines used in the transportation of electricity, or natural gas pipelines, have natural monopoly characteristics. A monopoly can occur when it finds the best way to minimize its costs through economies of scale to the point where other companies cannot compete with it. If the infrastructure already exists in a given area, minimal benefit is gained through competing. In other words, these industries are characterized by economies of scale in production. Though it can be mentioned that these natural monopolies are handled or watched by a public utilities commission, or an institution that represents the government. There are many different types of public utilities. Some, especially large companies, offer multiple products, such as electricity and natural gas. Other companies specialize in a specific product, such as water. Modern public utilities may also be partially (or completely) sourced from clean and renewable energy in order to produce sustainable electricity. Of these, wind turbines and solar panels are those used most frequently. Whether broadband internet access should be a public utility is a question that was being discussed with the rise of internet usage. This is a question that was being asked due to the telephone service being considered a public utility. Since arguably broadband internet access has taken over telephone service, perhaps it should be a public utility. The Federal Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear.
The first public utility in the United States was a grist mill erected on Mother Brook in Dedham, Massachusetts, in 1640. In the U.S., public utilities provide services at the consumer level, be it residential, commercial, or industrial consumer. Utilities, merchant power producers and very large consumers buy and sell bulk electricity at the wholesale level through a network of regional transmission organizations (RTO) and independent system operators (ISO) within one of three grids, the Eastern Interconnection, the Texas Interconnection, which is a single ISO, and the Western Interconnection. U.S. utilities historically operated with a high degree of financial leverage and low interest coverage ratios compared to industrial companies. Investors accepted these credit characteristics because of the regulation of the industry and the belief that there was minimal bankruptcy risk because of the essential services they provide.
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (35): "act", "address", "addressing", "administered", "biological", "changes", "clean", "conservation", "control", "coordination", "directly", "drinking", "engineers", "environmental", "federal", "form", "governing", "groundwater", "law", "maintain".... | EXACT TITLE in energy_utilities: "Clean Water Act". | EXACT TITLE in water_rights: "Clean Water Act".
actaddressaddressingadministeredbiologicalchangescleanconservationcontrolcoordinationdirectlydrinkingengineersenvironmentalfederalformgoverninggroundwaterlawmaintainmajorownedphysicalprimaryprotectionprovidingprovisionsqualityregulatingresource+5
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Geothermal heating
Q10577628 EXACT TITLE 1.000
QID OVERLAP: Q10577628 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (22): "annual", "application", "applications", "approximately", "around", "boundaries", "capacity", "contains", "direct", "energy", "even", "formation", "geothermal", "ground", "groundwater", "heating", "mean", "needed", "primary", "pump".... | EXACT TITLE in energy_utilities: "Geothermal heating". | EXACT TITLE in water_rights: "Geothermal heating".
annualapplicationapplicationsapproximatelyaroundboundariescapacitycontainsdirectenergyevenformationgeothermalgroundgroundwaterheatingmeanneededprimarypumpsourcesurface
ith temperatures higher than the target temperature of the application. However, even cold ground contains heat. Below 6 metres (20 ft), the undisturbed ground temperature is consistently at the mean annual air temperature, and this heat can be extracted with a ground source heat pump. Applications There are a wide variety of applications for cheap geothermal heat including heating of houses, greenhouses, bathing and swimming or industrial uses. Most applications use geothermal in the form of hot fluids between 50 °C (122 °F) and 150 °C (302 °F). The suitable temperature varies for the different applications. For direct use of geothermal heat, the temperature range for the agricultural sector lies between 25 °C (77 °F) and 90 °C (194 °F), for space heating lies between 50 °C (122 °F) to 100 °C (212 °F). Heat pipes extend the temperature range down to 5 °C (41 °F) as they extract and "amplify" the heat. Geothermal heat exceeding 150 °C (302 °F) is typically used for geothermal power generation. In 2004 more than half of direct geothermal heat was used for space heating, and a third was used for spas. The remainder was used for a variety of industrial processes, desalination, domestic hot water, and agricultural applications. The cities of Reykjavík and Akureyri pipe hot water from geothermal plants under roads and pavements to melt snow. Geothermal desalination has been demonstrated. Geothermal systems tend to benefit from economies of scale, so space heating power is often distributed to multiple buildings, sometimes whole communities.
In regions without any high temperature geothermal resources, a ground-source heat pump (GSHP) can provide space heating and space cooling. Like a refrigerator or air conditioner, these systems use a heat pump to force the transfer of heat from the ground to the building. Heat can be extracted from any source, no matter how cold, but a warmer source allows higher efficiency. A ground-source heat pump uses the shallow ground or ground water (typically starting at 10–12 °C or 50–54 °F) as a source of heat, thus taking advantage of its seasonally moderate temperatures. In contrast, an air source heat pump draws heat from the air (colder outside air) and thus requires more energy. GSHPs circulate a carrier fluid (usually a mixture of water and small amounts of antifreeze) through closed pipe loops buried in the ground. Single-home systems can be "vertical loop field" systems with bore holes 50–400 feet (15–120 m) deep or, if adequate land is available for extensive trenches, a "horizontal loop field" is installed approximately six feet subsurface. As the fluid circulates underground it absorbs heat from the ground and, on its return, the warmed fluid passes through the heat pump which uses electricity to extract heat from the fluid. The re-chilled fluid is sent back into the ground thus continuing the cycle. The heat extracted and that generated by the heat pump appliance as a byproduct is used to heat the house. The addition of the ground heating loop in the energy equation means that significantly more heat can be transferred to a building than if electricity alone had been used directly for heating. Switching the direction of heat flow, the same system can be used to circulate the cooled water through the house for cooling in the summer months. The heat is exhausted to the relatively cooler ground (or groundwater) rather than delivering it to the hot outside air as an air conditioner does. As a result, the heat is pumped across a larger temperature difference and this leads to higher efficiency and lower energy use. This technology makes ground source heating economically viable in any geographical location. In 2004, an estimated million ground-source heat pumps with a total capacity of 15 GW extracted 88 PJ of heat energy for space heating. Global ground-source heat pump capacity is growing by 10% annually. History Hot springs have been used for bathing at least since Paleolithic times. The oldest known spa is a stone pool on China's Mount Li built in the Qin dynasty in the 3rd century BC, at the same site where the Huaqing Chi palace was later built. Geothermal energy supplied channeled district heating for baths and houses in Pompeii around 0 AD. In the first century AD, Romans conquered Aquae Sulis in England and used the hot springs there to feed public baths and underfloor heating. The admission fees for these baths probably represents the first commercial use of geothermal power. A 1,000-year-old hot tub has been located in Iceland, where it was built by one of the island's original settlers. The world's oldest working geothermal district heating system in Chaudes-Aigues, France, has been operating since the 14th century. The earliest industrial exploitation began in 1827 with the use of geyser steam to extract boric acid from volcanic mud in Larderello, Italy. In 1892, America's first district heating system in Boise, Idaho, was powered directly by geothermal energy, and was soon copied in Klamath Falls, Oregon, in 1900. A deep geothermal well was used to heat greenhouses in Boise in 1926, and geysers were used to heat greenhouses in Iceland and Tuscany at about the same time. Charlie Lieb developed the first downhole heat exchanger in 1930 to heat his house. Steam and hot water from the geysers began to be used to heat homes in Iceland in 1943. By this time, Lord Kelvin had already invented the heat pump in 1852, and Heinrich Zoelly had patented the idea of using it to draw heat from the ground in 1912. But it was not until the late 1940s that the geothermal heat pump was successfully implemented. The earliest one was probably Robert C. Webber's home-made 2.2 kW direct-exchange system, but sources disagree as to the exact timeline of his invention. J. Donald Kroeker designed the first commercial geothermal heat pump to heat the Commonwealth Building in Portland, Oregon, and demonstrated it in 1946. Professor Carl Nielsen of Ohio State University built the first residential open loop version in his home in 1948. The technology became popular in Sweden as a result of the 1973 oil crisis, and has been growing slowly in worldwide acceptance since then. The 1979 development of polybutylene pipe greatly augmented the heat pump's economic viability. Since 2000, a compelling body of research has been dedicated to numerically evidence the advantages and efficiency of using CO2, alternative to water, as heat transmission fluid for geothermal energy recovery from enhanced geothermal systems (EGS) where the permeability of the underground source is enhanced by hydrofracturing. As of 2004, there are over one million geothermal heat pumps installed worldwide providing 12 GW of thermal capacity.
A geochemical process called anhydrite swelling has been confirmed as the cause of these uplifts. This is a transformation of the mineral anhydrite (anhydrous calcium sulphate) into gypsum (hydrous calcium sulphate). A pre-condition for this transformation is that the anhydrite is in contact with water, which is then stored in its crystalline structure. There are other sources of potential risks, i.e.: cave enlargement or worsening of stability conditions, quality or quantity degradation of groundwater resources, Specific hazard worsening in the case of landslide-prone areas, worsening of rocky mechanical characteristics, soil and water pollution (i.e. due to antifreeze additives or polluting constructive and boring material).
Sanitary sewer
Q1805497 EXACT TITLE 1.000
QID OVERLAP: Q1805497 in energy_utilities (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (23): "commercial", "directly", "disposal", "drains", "groundwater", "industrial", "infrastructure", "municipalities", "pipe", "separate", "served", "serving", "sewer", "storm", "stormwater", "surface", "system", "systems", "treatment", "underground".... | EXACT TITLE in water_rights: "Sanitary sewer".
commercialdirectlydisposaldrainsgroundwaterindustrialinfrastructuremunicipalitiespipeseparateservedservingsewerstormstormwatersurfacesystemsystemstreatmentundergroundurbanwastewaterwaters
A sanitary sewer is an underground pipe or tunnel system for transporting sewage from houses and commercial buildings (but not stormwater) to a sewage treatment plant or disposal. Sanitary sewers are a type of gravity sewer and are part of an overall system called a "sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
In the developed world, sewers are pipes from buildings to one or more levels of larger underground trunk mains, which transport the sewage to sewage treatment facilities. Vertical pipes, usually made of precast concrete, called manholes, connect the mains to the surface. Depending upon site application and use, these vertical pipes can be cylindrical, eccentric, or concentric. The manholes are used for access to the sewer pipes for inspection and maintenance, and as a means to vent sewer gases. They also facilitate vertical and horizontal angles in otherwise straight pipelines. Pipes conveying sewage from an individual building to a common gravity sewer line are called laterals. Branch sewers typically run under streets receiving laterals from buildings along that street and discharge by gravity into trunk sewers at manholes. Larger cities may have sewers called interceptors, receiving flow from multiple trunk sewers. Design and sizing of sanitary sewers considers the population to be served over the anticipated life of the sewer, per capita wastewater production, and flow peaking from timing of daily routines. Minimum sewer diameters are often specified to prevent blockage by solid materials flushed down toilets; gradients may be selected to maintain flow velocities generating sufficient turbulence to minimize solids deposition within the sewer. Commercial and industrial wastewater flows are also considered, but diversion of surface runoff to storm drains eliminates wet weather flow peaks of inefficient combined sewers. Force mains A force main or rising main is a pumped sewer that may be necessary where gravity sewers serve areas at lower elevations than the sewage treatment plant, or distant areas at similar elevations. A lift station is a sewer sump that lifts accumulated sewage to a higher elevation. They may also be used to prime an inverted siphon used to cross underneath rivers or other obstructions. The pump may discharge to another gravity sewer or directly to a treatment plant. Force mains are typically constructed of welded steel or HDPE jointed to resist pressures within the pipe.
sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
Anderson Ranch Dam
Q4754153 EXACT TITLE 1.000
QID OVERLAP: Q4754153 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (41): "act", "agriculture", "anderson", "approximately", "arrowrock", "behind", "board", "boise", "bureau", "capacity", "completion", "construction", "dam", "design", "home", "idaho", "irrigation", "labor", "law", "level".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
actagricultureandersonapproximatelyarrowrockbehindboardboisebureaucapacitycompletionconstructiondamdesignhomeidahoirrigationlaborlawlevelmaterialsmilesnationaloperatedportionspowerprimaryprojectsprovidepurpose+11
began in 1941 and experienced numerous challenges with materials, fuel, and labor shortages during World War II. Work was halted for over nine months beginning in late December 1942. The Reclamation Act of 1902 had racial exclusions on labor which were strictly adhered to until Congress changed the law in 1943. This allowed Japanese American internees to work on Reclamation projects; Anderson Ranch utilized internees from the Minidoka War Relocation Center, northeast of Twin Falls. The South Fork of the Boise River originates in the Smoky Mountains north of Fairfield. Its watershed includes portions of the Smoky Mountains, Soldier Mountains, Boise National Forest, and Sawtooth National Forest. Below the dam, the South Fork flows northwestward into the reservoir behind the concrete Arrowrock Dam, completed in 1915. The Bureau of Reclamation and Idaho Water Resource Board are working on raising the dam by six feet (1.8 m), resulting in approximately 29,000 acre-feet (35,800,000 m3) of new storage space.
d operated by the U.S. Bureau of Reclamation. When completed 76 years ago in 1950, Anderson Ranch was the tallest dam of its type in the world. Its primary purpose is to provide irrigation water for agriculture, with a secondary purpose of hydroelectric power. Its generating capacity was increased from 27 to 40 MW in 1986. Its reservoir has a spillway elevation of 4,196 feet (1,280 m) above sea level. The construction of the dam began in 1941 and experienced numerous challenges with materials, fuel, and labor shortages during World War II. Work was halted for over nine months beginning in late December 1942. The Reclamation Act of 1902 had racial exclusions on labor which were strictly adhered to until Congress changed the law in 1943. This allowed Japanese American internees to work on Reclamation projects; Anderson Ranch utilized internees from the Minidoka War Relocation Center, northeast of Twin Falls. The South Fork of the Boise River originates in the Smoky Mountains north of Fairfield. Its watershed includes portions of the Smoky Mountains, Soldier Mountains, Boise National Forest, and Sawtooth National Forest. Below the dam, the South Fork flows northwestward into the reservoir behind the concrete Arrowrock Dam, completed in 1915. The Bureau of Reclamation and Idaho Water Resource Board are working on raising the dam by six feet (1.8 m), resulting in approximately 29,000 acre-feet (35,800,000 m3) of new storage space.
Anderson Ranch Dam is an earth rockfill type dam in the western United States, on the South Fork of the Boise River in southwestern Idaho. In Elmore County northeast of Mountain Home, it is several miles north of U.S. Route 20 and operated by the U.S. Bureau of Reclamation. When completed 76 years ago in 1950, Anderson Ranch was the tallest dam of its type in the world. Its primary purpose is to provide irrigation water for agriculture, with a secondary purpose of hydroelectric power. Its generating capacity was increased from 27 to 40 MW in 1986. Its reservoir has a spillway elevation of 4,196 feet (1,280 m) above sea level. The construction of the dam began in 1941 and experienced numerous challenges with materials, fuel, and labor shortages during World War II. Work was halted for over nine months beginning in late December 1942. The Reclamation Act of 1902 had racial exclusions on labor which were strictly adhered to until Congress changed the law in 1943. This allowed Japanese American internees to work on Reclamation projects; Anderson Ranch utilized internees from the Minidoka War Relocation Center, northeast of Twin Falls. The South Fork of the Boise River originates in the Smoky Mountains north of Fairfield. Its watershed includes portions of the Smoky Mountains, Soldier Mountains, Boise National Forest, and Sawtooth National Forest. Below the dam, the South Fork flows northwestward into the reservoir behind the concrete Arrowrock Dam, completed in 1915. The Bureau of Reclamation and Idaho Water Resource Board are working on raising the dam by six feet (1.8 m), resulting in approximately 29,000 acre-feet (35,800,000 m3) of new storage space.
Water supply
Q1061108 EXACT TITLE 1.000
QID OVERLAP: Q1061108 in energy_utilities (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (32): "agriculture", "around", "capital", "commercial", "community", "cost", "costs", "depend", "different", "drinking", "energy", "institutional", "irrigation", "large", "personnel", "policy", "pressure", "providers", "provision", "public".... | EXACT TITLE in water_rights: "Water supply".
agriculturearoundcapitalcommercialcommunitycostcostsdependdifferentdrinkingenergyinstitutionalirrigationlargepersonnelpolicypressureprovidersprovisionpublicpumpsqualityregulationresponsibilityruralseparatesupplysupplyingsystemsystems+2
harge tariffs to recover part of their costs. Water supply is a separate topic from irrigation, the practice and systems of water supply on a larger scale, for a wider variety of purposes, primarily agriculture. Technical overview Water supply systems get water from a variety of locations after appropriate treatment, including groundwater (aquifers), surface water (lakes and rivers), and the sea through desalination. The water treatment steps include, in most cases, purification, disinfection through chlorination and sometimes fluoridation. Treated water then either flows by gravity or is pumped to reservoirs, which can be elevated such as water towers or on the ground (for indicators related to the efficiency of drinking water distribution see non-revenue water).
vors or by individuals, usually via a system of pumps and pipes. Public water supply systems are crucial to properly functioning societies. These systems are what supply drinking water to populations around the globe. Aspects of service quality include continuity of supply, water quality and water pressure. The institutional responsibility for water supply is arranged differently in different countries and regions (urban versus rural). It usually includes issues surrounding policy and regulation, service provision and standardization. The cost of supplying water consists, to a very large extent, of fixed costs (capital costs and personnel costs) and only to a small extent of variable costs that depend on the amount of water consumed (mainly energy and chemicals).
Water supply policies and regulation are usually defined by one or several ministries, in consultation with the legislative branch. In the United States the United States Environmental Protection Agency, whose administrator reports directly to the President, is responsible for water and sanitation policy and standard setting within the executive branch. In other countries responsibility for sector policy is entrusted to a Ministry of Environment (such as in Mexico and Colombia), to a Ministry of Health (such as in Panama, Honduras and Uruguay), a Ministry of Public Works (such as in Ecuador and Haiti), a Ministry of Economy (such as in German states) or a Ministry of Energy (such as in Iran). A few countries, such as Jordan and Bolivia, even have a Ministry of Water. Often several ministries share responsibilities for water supply. In the European Union, important policy functions have been entrusted to the supranational level. Policy and regulatory functions include the setting of tariff rules and the approval of tariff increases; setting, monitoring and enforcing norms for quality of service and environmental protection; benchmarking the performance of service providers; and reforms in the structure of institutions responsible for service provision. The distinction between policy functions and regulatory functions is not always clear-cut. In some countries they are both entrusted to ministries, but in others regulatory functions are entrusted to agencies that are separate from ministries. Regulatory agencies Dozens of countries around the world have established regulatory agencies for infrastructure services, including often water supply and sanitation, in order to better protect consumers and to improve efficiency. Regulatory agencies can be entrusted with a variety of responsibilities, including in particular the approval of tariff increases and the management of sector information systems, including benchmarking systems. Sometimes they also have a mandate to settle complaints by consumers that have not been dealt with satisfactorily by service providers. These specialized entities are expected to be more competent and objective in regulating service providers than departments of government Ministries. Regulatory agencies are supposed to be autonomous from the executive branch of government, but in many countries have often not been able to exercise a great degree of autonomy. In the United States regulatory agencies for utilities have existed for almost a century at the level of states, and in Canada at the level of provinces. In both countries they cover several infrastructure sectors. In many US states they are called Public Utility Commissions. For England and Wales, a regulatory agency for water (OFWAT) was created as part of the privatization of the water industry in 1989. In many developing countries, water regulatory agencies were created during the 1990s in parallel with efforts at increasing private sector participation. (for more details on regulatory agencies in Latin America, for example, please see Water and sanitation in Latin America and the regional association of water regulatory agencies ADERASA.) Many countries do not have regulatory agencies for water. In these countries service providers are regulated directly by local government, or the national government.
Drinking water
Q7892 EXACT TITLE 0.980
QID OVERLAP: Q7892 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (14): "billion", "depends", "developing", "directly", "drinking", "environmental", "food", "form", "maintain", "major", "physical", "potable", "supplied", "work". | EXACT TITLE in energy_utilities: "Drinking water". | EXACT TITLE in water_rights: "Drinking water".
billiondependsdevelopingdirectlydrinkingenvironmentalfoodformmaintainmajorphysicalpotablesuppliedwork
, and depends on physical activity, age, health-related issues, and environmental conditions. For those who work in a hot climate, up to 16 liters (4.2 U.S. gal) a day may be required. As many as two billion people lack safe drinking water. Unsafe water can carry disease and is a major cause of death and illness worldwide. Developing countries are most affected by unsafe drinking water. Sources Potable water is available in almost all populated areas of the world, although it may be expensive, and the supply may not always be sustainable. Sources where drinking water is commonly obtained include springs, hyporheic zones and aquifers (groundwater), from rainwater harvesting, surface water (from rivers, streams, glaciers), or desalinated seawater. For these water sources to be consumed safely, they must receive adequate water treatment and meet drinking water quality standards. An experimental source is solar-powered atmospheric water generators. Bottled water is a source of drinking water, especially when consumers perceive other sources to be unsafe.
The most efficient and convenient way to transport potable water is through pipes. Plumbing can require significant capital investment. Some systems suffer high operating costs. The cost to replace the deteriorating water and sanitation infrastructure of industrialized countries may be as high as $200 billion a year. Leakage of untreated and treated water from pipes reduces access to water.
According to the World Health Organization (WHO), "access to safe drinking-water is essential to health, a basic human right and a component of effective policy for health protection." In 1990, only 76 percent of the global population had access to drinking water. By 2015 that number had increased to 91 percent. In 1990, most countries in Latin America, East and South Asia, and Sub-Saharan Africa were well below 90%. In Sub-Saharan Africa, where the rates are lowest, household access ranges from 40 to 80 percent. Countries that experience violent conflict can have reductions in drinking water access: One study found that a conflict with about 2,500 battle deaths deprives 1.8% of the population of potable water. Typically in developed countries, tap water meets drinking water quality standards, even though only a small proportion is actually consumed or used in food preparation. Other typical uses for tap water include washing, toilets, and irrigation. Greywater may also be used for toilets or irrigation. Its use for irrigation however may be associated with risks. Globally, by 2015, 89% of people had access to water from a source that is suitable for drinking – called improved water sources. In sub-Saharan Africa, access to potable water ranged from 40% to 80% of the population. Nearly 4.2 billion people worldwide had access to tap water, while another 2.4 billion had access to wells or public taps. By 2015, 5.2 billion people representing 71% of the global population used safely managed drinking water services. As of 2017, 90% of people having access to water from a source that is suitable for drinking – called improved water source – and 71% of the world could access safely managed drinking water that is clean and available on-demand. Estimates suggest that at least 25% of improved sources contain fecal contamination. 1.8 billion people still use an unsafe drinking water source which may be contaminated by feces. This can result in infectious diseases, such as gastroenteritis, cholera, and typhoid, among others. Reduction of waterborne diseases and development of safe water resources is a major public health goal in developing countries. In 2017, almost 22 million Americans drank from water systems that were in violation of public health standards, which could contribute to citizens developing water-borne illnesses. Safe drinking water is an environmental health concern. Bottled water is sold for public consumption in most parts of the world. Improved sources are also monitored based on whether water is available when needed (5.8 billion people), located on premises (5.4 billion), free from contamination (5.4 billion), and within a 30-minute round trip. While improved water sources such as protected piped water are more likely to provide safe and adequate water as they may prevent contact with human excreta, for example, this is not always the case. According to a 2014 study, approximately 25% of improved sources contained fecal contamination. The population in Australia, New Zealand, North America and Europe have achieved nearly universal basic drinking water services. Because of the high initial investments, many less wealthy nations cannot afford to develop or sustain appropriate infrastructure, and as a consequence people in these areas may spend a correspondingly higher fraction of their income on water. 2003 statistics from El Salvador, for example, indicate that the poorest 20% of households spend more than 10% of their total income on water.
Reservoir
Q131681 EXACT TITLE 0.960
QID OVERLAP: Q131681 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (13): "behind", "building", "built", "controlling", "dam", "drains", "existing", "form", "lake", "power", "reservoir", "reservoirs", "storage". | EXACT TITLE in energy_utilities: "Reservoir". | EXACT TITLE in water_rights: "Reservoir".
behindbuildingbuiltcontrollingdamdrainsexistingformlakepowerreservoirreservoirsstorage
A reservoir (; from French réservoir [ʁezɛʁvwaʁ]) is an enlarged lake behind a dam, usually built to store fresh water, often doubling for hydroelectric power generation. Reservoirs are created by controlling a watercourse that drains an existing body of water, interrupting a watercourse to form an embayment within it, excavating, or building any number of retaining walls or levees to enclose any area to store water.
Downstream water supply water may be released from an upland reservoir so that it can be abstracted for drinking water lower down the system, sometimes hundreds of miles further downstream. Irrigation water in an irrigation reservoir may be released into networks of canals for use in farmlands or secondary water systems. Irrigation may also be supported by reservoirs which maintain river flows, allowing water to be abstracted for irrigation lower down the river. Flood control also known as an "attenuation" or "balancing" reservoirs, flood control reservoirs collect water at times of very high rainfall, then release it slowly during the following weeks or months. Some of these reservoirs are constructed across the river line, with the onward flow controlled by an orifice plate. When river flow exceeds the capacity of the orifice plate, water builds up behind the dam; but as soon as the flow rate reduces, the water behind the dam is slowly released until the reservoir is empty again. In some cases, such reservoirs only function a few times in a decade, and the land behind the reservoir may be developed as community or recreational land. A new generation of balancing dams are being developed to combat the possible consequences of climate change. They are called "Flood Detention Reservoirs". Because these reservoirs will remain dry for long periods, there may be a risk of the clay core drying out, reducing its structural stability. Recent developments include the use of composite core fill made from recycled materials as an alternative to clay. Canals Where a natural watercourse's water is not available to be diverted into a canal, a reservoir may be built to guarantee the water level in the canal: for example, where a canal climbs through locks to cross a range of hills. Another use is to reduce costs or construction time when the canal must be dug through rock, as used on the Rideau Canal with The Narrows locks dividing the two Rideau's and essentially turning the upper Rideau into an enlarged reservoir, albeit only by two or three feet. Recreation water may be released from a reservoir to create or supplement white water conditions for kayaking and other white-water sports.
Hydroelectricity and climate change Depending upon the area flooded versus power produced, a reservoir built for hydro-electricity generation can either reduce or increase the net production of greenhouse gases when compared to other sources of power. A study for the National Institute for Research in the Amazon found that hydroelectric reservoirs release a large pulse of carbon dioxide from decay of trees left standing in the reservoirs, especially during the first decade after flooding. This elevates the global warming impact of the dams to levels much higher than would occur by generating the same power from fossil fuels. According to the World Commission on Dams report (Dams And Development), when the reservoir is relatively large and no prior clearing of forest in the flooded area was undertaken, greenhouse gas emissions from the reservoir could be higher than those of a conventional oil-fired thermal generation plant. For instance, In 1990, the impoundment behind the Balbina Dam in Brazil (inaugurated in 1987) had over 20 times the impact on global warming than would generating the same power from fossil fuels, due to the large area flooded per unit of electricity generated. Another study published in the Global Biogeochemical Cycles also found that newly flooded reservoirs released more carbon dioxide and methane than the pre-flooded landscape, noting that forest lands, wetlands, and preexisting water features all released differing amounts of carbon dioxide and methane both pre- and post-flooding. The Tucuruí Dam in Brazil (completed in 1984) had only 0.4 times the impact on global warming than would generating the same power from fossil fuels. A two-year study of carbon dioxide and methane releases in Canada concluded that while the hydroelectric reservoirs there do emit greenhouse gases, it is on a much smaller scale than thermal power plants of similar capacity.
Water quality
Q625376 EXACT TITLE 0.960
QID OVERLAP: Q625376 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (13): "assessment", "biological", "characteristics", "compliance", "contact", "drinking", "generally", "physical", "quality", "safety", "standards", "supply", "treatment". | EXACT TITLE in energy_utilities: "Water quality". | EXACT TITLE in water_rights: "Water quality".
assessmentbiologicalcharacteristicscompliancecontactdrinkinggenerallyphysicalqualitysafetystandardssupplytreatment
Making these complex measurements can be expensive. Because direct measurements of water quality can be expensive, ongoing monitoring programs are typically conducted and results released by government agencies. However, there are local volunteer programs and resources available for some general assessment. Tools available to the general public include on-site test kits, commonly used for home fish tanks, and biological assessment procedures. Biosensors Biosensors have the potential for "high sensitivity, selectivity, reliability, simplicity, low-cost and real-time response".
Biological monitoring metrics have been developed in many places, and one widely used family of measurements for freshwater is the presence and abundance of members of the insect orders Ephemeroptera, Plecoptera and Trichoptera (EPT) (of benthic macroinvertebrates whose common names are, respectively, mayfly, stonefly and caddisfly). EPT indexes will naturally vary from region to region, but generally, within a region, the greater the number of taxa from these orders, the better the water quality. Organisations in the United States, such as EPA. offer guidance on developing a monitoring program and identifying members of these and other aquatic insect orders. Many US wastewater dischargers (e.g., factories, power plants, refineries, mines, municipal sewage treatment plants) are required to conduct periodic whole effluent toxicity (WET) tests. Individuals interested in monitoring water quality who cannot afford or manage lab scale analysis can also use biological indicators to get a general reading of water quality. One example is the IOWATER volunteer water monitoring program of Iowa, which includes an EPT indicator key. Bivalve molluscs are largely used as bioindicators to monitor the health of aquatic environments in both fresh water and the marine environments. Their population status or structure, physiology, behaviour or the level of contamination with elements or compounds can indicate the state of contamination status of the ecosystem. They are particularly useful since they are sessile so that they are representative of the environment where they are sampled or placed. A typical project is the U.S. Mussel Watch Programme, but today they are used worldwide. The Southern African Scoring System (SASS) method is a biological water quality monitoring system based on the presence of benthic macroinvertebrates (EPT). The SASS aquatic biomonitoring tool has been refined over the past 30 years and is now on the fifth version (SASS5) which has been specifically modified in accordance with international standards, namely the ISO/IEC 17025 protocol. The SASS5 method is used by the South African Department of Water Affairs as a standard method for River Health Assessment, which feeds the national River Health Programme and the national Rivers Database. Climate change impacts Standards and reports In the setting of standards, agencies make political and technical/scientific decisions based on how the water will be used. In the case of natural water bodies, agencies also make some reasonable estimate of pristine conditions. Natural water bodies will vary in response to a region's environmental conditions, whereby water composition is influenced by the surrounding geological features, sediments, and rock types, topography, hydrology, and climate. Environmental scientists and aqueous geochemists work to interpret the parameters and environmental conditions that impact the water quality of a region, which in turn helps to identify the sources and fates of contaminants. Environmental lawyers and policymakers work to define legislation with the intention that water is maintained at an appropriate quality for its identified use. Another general perception of water quality is that of a simple property that tells whether water is polluted or not. In fact, water quality is a complex subject, in part because water is a complex medium intrinsically tied to the ecology, geology, and anthropogenic activities of a region. Industrial and commercial activities (e.g.
External links Global Freshwater Quality Database (GEMStat) – United Nations environment program Water policy in the European Union U.S. Centers for Disease Control and Prevention (CDC) – Drinking water quality and testing (United States) U.S. Environmental Protection Agency – Water Data and Tools of the USEPA U.S.
W
Q7973730 EXACT TITLE 0.960
QID OVERLAP: Q7973730 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (13): "different", "generally", "ground", "groundwater", "irrigation", "law", "legal", "physical", "right", "river", "source", "surface", "systems". | EXACT TITLE in energy_utilities: "Water right". | EXACT TITLE in water_rights: "Water right".
differentgenerallygroundgroundwaterirrigationlawlegalphysicalrightriversourcesurfacesystems
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
History In ancient Rome, the law was that people could obtain temporary usufructuary rights for running water. These rights were independent of land ownership, and lasted as long as use continued. Under English common law, all tidal waters were held by the Crown and all freshwater streams were included with title to the lands, with full accompanying rights. However, under the riparian doctrine, landowners had the right to receive water undiminished by upstream landowners. Over time, rights evolved from being strictly land-based to also include use-based, allowing non-landowners to hold enforceable rights to receive clean water. A reasonable use rule evolved in some countries. Finland In Finland, waterbodies are generally privately owned, but Finland also applies the Roman law principle of aqua profluens (flowing water), according to which the freely flowing water in waterbodies cannot be owned or possessed. This means that the owners of waterbodies cannot prohibit diversion of water for agricultural, industrial, municipal, or domestic use according to the provisions of the Finnish Water Law. A separate act regulates provision of water.
Boise River
Q891080 EXACT TITLE 0.940
QID OVERLAP: Q891080 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (12): "agricultural", "approximately", "boise", "drains", "idaho", "lands", "miles", "river", "snake", "square", "urban", "western". | EXACT TITLE in energy_utilities: "Boise River". | EXACT TITLE in water_rights: "Boise River".
agriculturalapproximatelyboisedrainsidaholandsmilesriversnakesquareurbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Idaho Department of Environmental Quality
Q5987351 EXACT TITLE 0.880
QID OVERLAP: Q5987351 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (9): "boise", "department", "environmental", "federal", "idaho", "main", "quality", "regional", "responsible". | EXACT TITLE in energy_utilities: "Idaho Department of Environmental Quality". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
boisedepartmentenvironmentalfederalidahomainqualityregionalresponsible
tment of Environmental Quality is the department of the Idaho state government responsible for administering state and federal environmental laws and regulations. The department's main offices are in Boise, and six regional offices are also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act.
also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act. Before 2000, DEQ in Idaho was a division of the Department of Health and Welfare. Structure and functions It is organized into five divisions: Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (17): "according", "boise", "canyon", "college", "footprint", "home", "idaho", "meridian", "metropolitan", "miles", "nampa", "northwest", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegefootprinthomeidahomeridianmetropolitanmilesnampanorthwestpopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Reclaimed water
Q3267830 QID OVERLAP 0.800
QID OVERLAP: Q3267830 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (39): "advanced", "agricultural", "agriculture", "businesses", "combination", "cost", "costs", "direct", "distribution", "drinking", "environmental", "fields", "groundwater", "importance", "increasing", "industrial", "irrigation", "management", "municipal", "natural"....
advancedagriculturalagriculturebusinessescombinationcostcostsdirectdistributiondrinkingenvironmentalfieldsgroundwaterimportanceincreasingindustrialirrigationmanagementmunicipalnaturalpotableprocessrechargereclamationreduceregionremainrequirereusesource+9
cally safe, meaning free from pathogens. The following are some of the typical technologies: Ozonation, ultrafiltration, aerobic treatment (membrane bioreactor), forward osmosis, reverse osmosis, and advanced oxidation, or activated carbon. Some water-demanding activities do not require high grade water. In this case, wastewater can be reused with little or no treatment. The cost of reclaimed water exceeds that of potable water in many regions of the world, where fresh water is plentiful. The costs of water reclamation options might be compared to the costs of alternative options which also achieve similar effects of freshwater savings, namely greywater reuse systems, rainwater harvesting and stormwater recovery, or seawater desalination. Water recycling and reuse is of increasing importance, not only in arid regions but also in cities and contaminated environments.
increasing water scarcity and stress, increasing populations and related food security issues, increasing environmental pollution from improper wastewater disposal, and increasing recognition of the resource value of wastewater, excreta and greywater. In some areas, one driving force is also the implementation of advanced wastewater treatment for the removal of organic micropollutants, which leads to an overall improved water quality. Water recycling and reuse is of increasing importance, not only in arid regions but also in cities and contaminated environments. Already, the groundwater aquifers that are used by over half of the world population are being over-drafted. Reuse will continue to increase as the world's population becomes increasingly urbanized and concentrated near coastlines, where local freshwater supplies are limited or are available only with large capital expenditure. Large quantities of freshwater can be saved by municipal wastewater reuse and recycling, reducing environmental pollution and improving carbon footprint. Reuse can be an alternative water supply option. Achieving more sustainable sanitation and wastewater management will require emphasis on actions linked to resource management, such as wastewater reuse or excreta reuse that will keep valuable resources available for productive uses.
Planned potable reuse Planned potable reuse is publicly acknowledged as an intentional project to recycle water for drinking water. There are two ways in which potable water can be delivered for reuse – "Indirect Potable Reuse" (IPR) and "Direct Potable Reuse". Both these forms of reuse are described below, and commonly involve a more formal public process and public consultation program than is the case with de facto or unacknowledged reuse. Some water agencies reuse highly treated effluent from municipal wastewater or resource recovery plants as a reliable, drought-proof source of drinking water. By using advanced purification processes, they produce water that meets all applicable drinking water standards. System reliability and frequent monitoring and testing are imperative to their meeting stringent controls. The water needs of a community, water sources, public health regulations, costs, and the types of water infrastructure in place— such as distribution systems, man-made reservoirs, or natural groundwater basins— determine if and how reclaimed water can be part of the drinking water supply. Some communities reuse water to replenish groundwater basins. Others put it into surface water reservoirs. In these instances the reclaimed water is blended with other water supplies and/or sits in storage for a certain amount of time before it is drawn out and gets treated again at a water treatment or distribution system. In some communities, the reused water is put directly into pipelines that go to a water treatment plant or distribution system. Modern technologies such as reverse osmosis and ultraviolet disinfection are commonly used when reclaimed water will be mixed with the drinking water supply. Many people associate a feeling of disgust with reclaimed water and 13% of a survey group said they would not even sip it. Nonetheless, the main health risk for potable use of reclaimed water is the potential for pharmaceutical and other household chemicals or their derivatives (environmental persistent pharmaceutical pollutants) to persist in this water.
Eutrophication
Q156698 QID OVERLAP 0.800
QID OVERLAP: Q156698 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (19): "agriculture", "controls", "development", "environment", "environmental", "growth", "industrial", "lake", "main", "point", "process", "program", "reduce", "result", "resulting", "river", "source", "surface", "wastewater".
agriculturecontrolsdevelopmentenvironmentenvironmentalgrowthindustriallakemainpointprocessprogramreduceresultresultingriversourcesurfacewastewater
ng the United Nations Development Program (UNDP)'s sustainability development goals. Approaches for prevention and reversal of eutrophication include minimizing point source pollution from sewage and agriculture as well as other nonpoint pollution sources.
Eutrophication is caused by excessive concentrations of nutrients, most commonly phosphates and nitrates, although this varies with location. Prior to their being phasing out in the 1970's, phosphate-containing detergents contributed to eutrophication. Since then, sewage and agriculture have emerged as the dominant phosphate sources. The main sources of nitrogen pollution are from agricultural runoff containing fertilizers and animal wastes, from sewage, and from atmospheric deposition of nitrogen originating from combustion or animal waste. The limitation of productivity in any aquatic system varies with the rate of supply (from external sources) and removal (flushing out) of nutrients from the body of water.
Cultural eutrophication Cultural or anthropogenic eutrophication is the process that causes eutrophication because of human activity. The problem became more apparent following the introduction of chemical fertilizers in agriculture (green revolution of the mid-1900s). Phosphorus and nitrogen are the two main nutrients that cause cultural eutrophication as they enrich the water, allowing for some aquatic plants, especially algae to grow rapidly and bloom in high densities. Algal blooms can shade out benthic plants thereby altering the overall plant community. When algae die off, their degradation by bacteria removes oxygen, potentially, generating anoxic conditions. This anoxic environment kills off aerobic organisms (e.g. fish and invertebrates) in the water body. This also affects terrestrial animals, restricting their access to affected water (e.g. as drinking sources). Selection for algal and aquatic plant species that can thrive in nutrient-rich conditions can cause structural and functional disruption to entire aquatic ecosystems and their food webs, resulting in loss of habitat and species biodiversity. There are several sources of excessive nutrients from human activity including run-off from fertilized fields, lawns, and golf courses, untreated sewage and wastewater and internal combustion of fuels creating nitrogen pollution. Cultural eutrophication can occur in fresh water and salt water bodies, shallow waters being the most susceptible. In shore lines and shallow lakes, sediments are frequently resuspended by wind and waves which can result in nutrient release from sediments into the overlying water, enhancing eutrophication.
Septic tank
Q386300 QID OVERLAP 0.800
QID OVERLAP: Q386300 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (19): "connected", "domestic", "environment", "facility", "groundwater", "primary", "processes", "rate", "reduce", "rural", "septic", "system", "systems", "therefore", "treated", "treatment", "underground", "waste", "wastewater".
connecteddomesticenvironmentfacilitygroundwaterprimaryprocessesratereduceruralsepticsystemsystemsthereforetreatedtreatmentundergroundwastewastewater
d organics, but the treatment efficiency is only moderate (referred to as "primary treatment"). Septic tank systems are a type of simple onsite sewage facility. They can be used in areas that are not connected to a sewerage system, such as rural areas. The treated liquid effluent is commonly disposed in a septic drain field, which provides further treatment. Nonetheless, groundwater pollution may occur and is a problem. The term "septic" refers to the anaerobic bacterial environment that develops in the tank that decomposes or mineralizes the waste discharged into the tank. Septic tanks can be coupled with other onsite wastewater treatment units such as biofilters or aerobic systems involving artificially forced aeration. The rate of accumulation of sludge—also called septage or fecal sludge—is faster than the rate of decomposition.
ved, which is commonly done with a vacuum truck. Description A septic tank consists of one or more concrete or plastic tanks of between 4,500 and 7,500 litres (1,000 and 2,000 gallons); one end is connected to an inlet wastewater pipe and the other to a septic drain field. Generally these pipe connections are made with a T pipe, allowing liquid to enter and exit without disturbing any crust on the surface. Today, the design of the tank usually incorporates two chambers, each equipped with an access opening and cover, and separated by a dividing wall with openings located about midway between the floor and roof of the tank. Wastewater enters the first chamber of the tank, allowing solids to settle and scum to float. The settled solids are anaerobically digested, reducing the volume of solids. The liquid component flows through the dividing wall into the second chamber, where further settlement takes place. One option for the effluent is the draining into the septic drain field, also referred to as a leach field, drain field or seepage field, depending upon locality. A percolation test is required prior to installation to ensure the porosity of the soil is adequate to serve as a drain field. Septic tank effluent can also be conveyed to a secondary treatment, typically constructed wetlands. Constructed wetlands benefit from the good performance of septic tanks at removing solids, which avoids them getting clogged quickly. Septic tank effluent can also be conveyed to a centralized treatment facility. The remaining impurities are trapped and eliminated in the soil, with the excess water eliminated through percolation into the soil, through evaporation, and by uptake through the root system of plants and eventual transpiration or entering groundwater or surface water. A piping network, often laid in a stone-filled trench (see weeping tile), distributes the wastewater throughout the field with multiple drainage holes in the network. The size of the drain field is proportional to the volume of wastewater and inversely proportional to the porosity of the drainage field. The entire septic system can operate by gravity alone or, where topographic considerations require, with inclusion of a lift pump. Certain septic tank designs include siphons or other devices to increase the volume and velocity of outflow to the drainage field. These help to fill the drainage pipe more evenly and extend the drainage field life by preventing premature clogging or bioclogging. An Imhoff tank is a two-stage septic system where the sludge is digested in a separate tank. This avoids mixing digested sludge with incoming sewage. Also, some septic tank designs have a second stage where the effluent from the anaerobic first stage is aerated before it drains into the seepage field. A properly designed and normally operating septic system is odour-free.
User's actions Excessive disposal of cooking oils and grease can cause the inlet drains to block. Oils and grease are often difficult to degrade and can cause odor problems and difficulties with the periodic emptying. Flushing non-biodegradable waste items down the toilet such as cigarette butts, cotton buds/swabs or menstrual hygiene products and condoms can cause a septic tank to clog and fill rapidly, so these materials should not be disposed of in that manner. The same applies when the toilet is connected to a sewer rather than a septic tank. Using the toilet for disposal of food waste can cause a rapid overload of the system with solids and contribute to failure. Certain chemicals may damage the components of a septic tank or kill the bacteria needed in the septic tank for the system to operate properly, such as pesticides, herbicides, materials with high concentrations of bleach or caustic soda (lye), or any other inorganic materials such as paints or solvents. Using water softeners – the brine discharge from water softeners may harm the bacteria responsible for breaking down the wastewater.
Deer Flat Upper Embankment
Q5250747 QID OVERLAP 0.800
QID OVERLAP: Q5250747 in energy_utilities (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (41): "among", "approximately", "aquifers", "association", "boise", "bureau", "canyon", "capacity", "conservation", "contains", "counties", "creates", "dam", "directly", "edge", "federal", "formation", "idaho", "lake", "level"....
amongapproximatelyaquifersassociationboisebureaucanyoncapacityconservationcontainscountiescreatesdamdirectlyedgefederalformationidaholakelevellocallowellmilesnampanationalofficeprojectprojectsprovidereclamation+11
Deer Flat Middle Dike (ID #ID00277), completed 1911, 18 feet (5.5 m) high, 1,262 feet (385 m) long Deer Flat Lower Dike (ID #ID00278), completed 1908, 48 feet (15 m) high, 7,270 feet (2,220 m) long Deer Flat East Dike (ID #ID82902), completed 1911, 18 feet (5.5 m) high, 3,806 feet (1,160 m) long The reservoir it creates, Lake Lowell, has a normal surface area of 16 square miles (41 km2), and a maximum capacity of 169,000 acre-feet (208,000,000 m3). Its surface elevation is approximately 2,520 feet (770 m) above sea level. The Boise Project was among the first undertaken by the Reclamation Service after its formation in 1902. Shortly before leaving office, President Theodore Roosevelt created a national bird refuge at Deer Flat Reservoir, now Lake Lowell, with an executive order on February 25, 1909. The refuge was one of 17 federal reclamation projects referenced in the order, each of which used manmade aquifers to provide safe havens for migratory birds. The effort to include the Canyon County site was spearheaded by James H. Lowell, the president of the local Payette-Boise Water Users Association. The "globally important" Deer Flat National Wildlife Refuge for migratory fowl and other wildlife consists of two sections which contains open water, edge wetlands, grasslands and riparian and forest habitats. The largest portion of the refuge consists of Lake Lowell and its environs. The second portion comprises the Snake River islands located in non-contiguous localities along the river in Canyon, Owyhee, Payette, and Washington counties (Idaho) and Malheur and Baker counties (Oregon).
w U.S. Bureau of Reclamation), with a height of 74 feet (23 m) and a crest length of 4,165 feet (1.27 km). The Upper Embankment is the largest of a set of four dikes here impounding the water of the Boise River in offstream storage. The other dams are: Deer Flat Middle Dike (ID #ID00277), completed 1911, 18 feet (5.5 m) high, 1,262 feet (385 m) long Deer Flat Lower Dike (ID #ID00278), completed 1908, 48 feet (15 m) high, 7,270 feet (2,220 m) long Deer Flat East Dike (ID #ID82902), completed 1911, 18 feet (5.5 m) high, 3,806 feet (1,160 m) long The reservoir it creates, Lake Lowell, has a normal surface area of 16 square miles (41 km2), and a maximum capacity of 169,000 acre-feet (208,000,000 m3). Its surface elevation is approximately 2,520 feet (770 m) above sea level. The Boise Project was among the first undertaken by the Reclamation Service after its formation in 1902. Shortly before leaving office, President Theodore Roosevelt created a national bird refuge at Deer Flat Reservoir, now Lake Lowell, with an executive order on February 25, 1909. The refuge was one of 17 federal reclamation projects referenced in the order, each of which used manmade aquifers to provide safe havens for migratory birds. The effort to include the Canyon County site was spearheaded by James H. Lowell, the president of the local Payette-Boise Water Users Association. The "globally important" Deer Flat National Wildlife Refuge for migratory fowl and other wildlife consists of two sections which contains open water, edge wetlands, grasslands and riparian and forest habitats. The largest portion of the refuge consists of Lake Lowell and its environs. The second portion comprises the Snake River islands located in non-contiguous localities along the river in Canyon, Owyhee, Payette, and Washington counties (Idaho) and Malheur and Baker counties (Oregon).
Flood management
Q1187968 QID OVERLAP 0.800
QID OVERLAP: Q1187968 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (32): "analysis", "assessment", "broader", "building", "change", "changes", "control", "engineering", "flood", "increase", "individual", "infrastructure", "level", "management", "measures", "mitigation", "natural", "physically", "potential", "practices"....
analysisassessmentbroaderbuildingchangechangescontrolengineeringfloodincreaseindividualinfrastructurelevelmanagementmeasuresmitigationnaturalphysicallypotentialpracticesprocessespropertiesprovidingreducereducingrelatedriskseparatestructuralsystems+2
ins, for handling the increase in water. Flood management can include flood risk management, which focuses on measures to reduce risk, vulnerability and exposure to flood disasters and providing risk analysis through, for example, flood risk assessment. Flood mitigation is a related but separate concept describing a broader set of strategies taken to reduce flood risk and potential impact while improving resilience against flood events. As climate change has led to increased flood risk an intensity, flood management is an important part of climate change adaptation and climate resilience. For example, to prevent or manage coastal flooding, coastal management practices have to handle natural processes like tides but also sea level rise due to climate change.
Structural flood management (i.e.: flood control) is the reduction of the effects of a flood using physical solutions, such as reservoirs, levees, dredging and diversions. Non-structural flood management includes land-use planning, advanced warning systems and flood insurance. Further examples are: "zoning ordinances and codes, flood forecasting, flood proofing, evacuation and channel clearing, flood fight activities, and upstream land treatment or management to control flood damages without physically restraining flood waters". There are several related terms that are closely connected or encompassed by flood management. Flood management can include flood risk management, which focuses on measures to reduce risk, vulnerability and exposure to flood disasters and providing risk analysis through, for example, flood risk assessment. In the context of natural hazards and disasters, risk management involves "plans, actions, strategies or policies to reduce the likelihood and/or magnitude of adverse potential consequences, based on assessed or perceived risks". Flood control, flood protection, flood defence and flood alleviation are all terms that mean "the detention and/or diversion of water during flood events for the purpose of reducing discharge or downstream inundation". Flood control is part of environmental engineering. It involves the management of water movement, such as redirecting flood run-off through the use of floodwalls and flood gates to prevent floodwaters from reaching a particular area. Flood mitigation is a related but separate concept describing a broader set of strategies taken to reduce flood risk and potential impact while improving resilience against flood events. These methods include prevention, prediction (which enables flood warnings and evacuation), proofing (e.g.: zoning regulations), physical control (nature-based solutions and physical structures like dams and flood walls) and insurance (e.g.: flood insurance policies). Flood relief methods are used to reduce the effects of flood waters or high water levels during a flooding event. They include evacuation plans and rescue operations.
There are several methods of non-structural flood management that form part of flood risk management strategies. These can involve policies that reduces the amount of urban structures built around floodplains or flood prone areas through land zoning regulations. This helps to reduce the amount of mitigation needed to protect humans and buildings from flooding events. Similarly, flood warning systems are important for reducing risks. Following the occurrence of flooding events, other measures such as rebuilding plans and insurance can be integrated into flood risk management plans. Flood risk management strategy diversification is needed to ensure that management strategies cover several different scenarios and ensure best practices. Flood risk management aims to reduce the human and socio-economic losses caused by flooding and is part of the larger field of risk management. Flood risk management analyzes the relationships between physical systems and socio-economic environments through flood risk assessment and tries to create understanding and action about the risks posed by flooding. The relationships cover a wide range of topics, from drivers and natural processes, to models and socio-economic consequences. This relationship examines management methods which includes a wide range of flood management methods including but are not limited to flood mapping and physical implication measures. Flood risk management looks at how to reduce flood risk and how to appropriately manage risks that are associated with flooding.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (33): "approved", "around", "assessment", "committee", "conservation", "department", "education", "energy", "enforcement", "engineers", "environmental", "federal", "independent", "information", "january", "legal", "level", "local", "measures", "monitoring"....
approvedaroundassessmentcommitteeconservationdepartmenteducationenergyenforcementengineersenvironmentalfederalindependentinformationjanuarylegallevellocalmeasuresmonitoringnationaloperationpermittingprogramsproposedprotectionpublicregionalresearchresponsibility+3
xon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Hydroelectricity
Q80638 QID OVERLAP 0.800
QID OVERLAP: Q80638 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (35): "among", "capacity", "clean", "constructed", "construction", "creating", "dam", "demand", "direct", "electrical", "energy", "environmental", "failure", "hydropower", "involved", "land", "large", "making", "natural", "population"....
amongcapacitycleanconstructedconstructioncreatingdamdemanddirectelectricalenergyenvironmentalfailurehydropowerinvolvedlandlargemakingnaturalpopulationpowerprincipallyproducesprovideregionreservoirresponseriverrolesource+5
n and erosion patterns. While dams can ameliorate the risks of flooding, dam failure can be catastrophic. In 2021, global installed hydropower electrical capacity reached almost 1,400 GW, the highest among all renewable energy technologies. Hydroelectricity plays a leading role in countries like Brazil, Norway and China. but there are geographical limits and environmental issues. Tidal power can be used in coastal regions. China added 24 GW in 2022, accounting for nearly three-quarters of global hydropower capacity additions. Europe added 2 GW, the largest amount for the region since 1990.
ffecting habitats and ecosystems, and siltation and erosion patterns. While dams can ameliorate the risks of flooding, dam failure can be catastrophic. In 2021, global installed hydropower electrical capacity reached almost 1,400 GW, the highest among all renewable energy technologies. Hydroelectricity plays a leading role in countries like Brazil, Norway and China. but there are geographical limits and environmental issues. Tidal power can be used in coastal regions. China added 24 GW in 2022, accounting for nearly three-quarters of global hydropower capacity additions. Europe added 2 GW, the largest amount for the region since 1990.
and China. but there are geographical limits and environmental issues. Tidal power can be used in coastal regions. China added 24 GW in 2022, accounting for nearly three-quarters of global hydropower capacity additions. Europe added 2 GW, the largest amount for the region since 1990.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "home", "idaho", "level", "locally", "major", "metropolitan", "miles", "population", "river", "treasure", "valley".
adaannualboisecapitalcountieshomeidaholevellocallymajormetropolitanmilespopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Water metering
Q268503 QID OVERLAP 0.800
QID OVERLAP: Q268503 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (16): "association", "building", "commercial", "determine", "flow", "outside", "process", "public", "requirements", "residential", "standards", "supplied", "supply", "system", "volume", "works".
associationbuildingcommercialdetermineflowoutsideprocesspublicrequirementsresidentialstandardssuppliedsupplysystemvolumeworks
Water metering is changing rapidly with the advent of smart metering technology and various innovations. In North America, standards for manufacturing water meters are set by the American Water Works Association. Outside of North America, most countries use ISO standards. Types of metering technologies There are two common approaches to flow measurement: displacement and velocity, each making use of a variety of technologies. Common displacement designs include oscillating piston and nutating disc meters. Velocity-based designs include single- and multi-jet meters and turbine meters. There are also non-mechanical designs, for example, electromagnetic and ultrasonic meters, and meters designed for special uses. Most meters in a typical water distribution system are designed to measure cold potable water only. Specialty hot water meters are designed with materials that can withstand higher temperatures. Meters for reclaimed water have special lavender register covers to signify that the water should not be used for drinking. Additionally, there are electromechanical meters, like prepaid water meters and automatic meter reading meters. The latter integrates an electronic measurement component and a LCD with a mechanical water meter. Mechanical water meters normally use a reed switch, hall or photoelectric coding register as the signal output. After processing by the microcontroller unit (MCU) in the electronic module, the data are transmitted to the LCD or output to an information management system. Water meters are generally owned, read and maintained by a public water provider such as a city, rural water association or private water company.
Types of metering technologies There are two common approaches to flow measurement: displacement and velocity, each making use of a variety of technologies. Common displacement designs include oscillating piston and nutating disc meters. Velocity-based designs include single- and multi-jet meters and turbine meters. There are also non-mechanical designs, for example, electromagnetic and ultrasonic meters, and meters designed for special uses. Most meters in a typical water distribution system are designed to measure cold potable water only. Specialty hot water meters are designed with materials that can withstand higher temperatures. Meters for reclaimed water have special lavender register covers to signify that the water should not be used for drinking. Additionally, there are electromechanical meters, like prepaid water meters and automatic meter reading meters. The latter integrates an electronic measurement component and a LCD with a mechanical water meter. Mechanical water meters normally use a reed switch, hall or photoelectric coding register as the signal output. After processing by the microcontroller unit (MCU) in the electronic module, the data are transmitted to the LCD or output to an information management system. Water meters are generally owned, read and maintained by a public water provider such as a city, rural water association or private water company.
Length The installation length (distance between the connection points) of a water meter varies between regions: United States: Residential meters: Standard lengths are 7½ inches, 9 inches, or 12 inches, as specified by the American Water Works Association (AWWA) Standard C700. Europe: Residential meters: Standard lengths include 110 mm, 165 mm, and 190 mm, conforming to ISO 4064 standards. Commercial/Industrial meters: In both regions, larger meters often have lengths exceeding 300 mm (12 inches), with exact dimensions tailored to the application and local plumbing requirements.
Civil engineering
Q77590 QID OVERLAP 0.800
QID OVERLAP: Q77590 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (25): "agencies", "built", "canals", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional"....
agenciesbuiltcanalscivilcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicsectorstructuralsystemsworks
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
Civil engineering is a professional engineering discipline that deals with the design, construction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Surveying existing conditions of the future work site, including topography, existing buildings and infrastructure, and underground infrastructure when possible; "lay-out" or "setting-out": placing reference points and markers that will guide the construction of new structures such as roads or buildings; Verifying the location of structures during construction; As-Built surveying: a survey conducted at the end of the construction project to verify that the work authorized was completed to the specifications set on plans. Transportation engineering Transportation engineering is concerned with moving people and goods efficiently, safely, and in a manner conducive to a vibrant community. This involves specifying, designing, constructing, and maintaining transportation infrastructure which includes streets, canals, highways, rail systems, airports, ports, and mass transit.
Diversion Dam and Deer Flat Embankments
Q19573781 QID OVERLAP 0.800
QID OVERLAP: Q19573781 in energy_utilities (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (23): "acres", "boise", "bureau", "canal", "capacity", "components", "dam", "designed", "district", "diversion", "idaho", "irrigation", "nampa", "national", "program", "project", "provide", "reclamation", "river", "treasure"....
acresboisebureaucanalcapacitycomponentsdamdesigneddistrictdiversionidahoirrigationnampanationalprogramprojectprovidereclamationrivertreasurevalleywesternyork
western United States in southwestern Idaho, near Boise and Nampa. The dams are components of the U.S. Bureau of Reclamation's Boise Project, and were designed to provide irrigation water to 500,000 acres (780 mi2; 2,000 km2) of Treasure Valley farmland in conjunction with the New York Irrigation District (New York Canal). The Boise River Diversion Dam also provides hydroelectric generation capacity.
ise Project, and were designed to provide irrigation water to 500,000 acres (780 mi2; 2,000 km2) of Treasure Valley farmland in conjunction with the New York Irrigation District (New York Canal). The Boise River Diversion Dam also provides hydroelectric generation capacity.
ver Diversion Dam also provides hydroelectric generation capacity. The dams were listed on the National Register in 1976. The three dams that make up the Diversion Dam and Deer Flat Embankments are: Boise River Diversion Dam Deer Flat Upper Embankment Deer Flat Lower Embankment See also National Register of Historic Places listings in Ada County, Idaho National Register of Historic Places listings in Canyon County, Idaho Deer Flat National Wildlife Refuge
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (13): "ada", "behind", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
adabehindboisecapitaldistricthomeidahojurisdictionlocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
P
QID OVERLAP 0.740
QID OVERLAP: Q7245403 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (12): "agricultural", "beneficial", "full", "industrial", "legal", "merely", "ownership", "purpose", "right", "rights", "source", "system".
agriculturalbeneficialfullindustriallegalmerelyownershippurposerightrightssourcesystem
In the American legal system, prior appropriation water rights is the doctrine that the first person to take a quantity of water from a water source for "beneficial use" (agricultural, industrial or household) has the right to continue to use that quantity of water for that purpose. Subsequent users can take the remaining water for their own use if they do not impinge on the rights of previous users.
Nature of the right The legal details of prior appropriation vary from state to state. Under the prior appropriation system, the right is initially allotted to those who are "first in time of use"; these rights of withdrawal can then trade on the open market, like other property. For water sources with many users, a government or quasi-government agency is usually charged with overseeing allocations. Allocations involving water sources that cross state borders or international borders can be quite contentious, and are generally governed by federal court rulings, interstate agreements and international treaties. A claim of prior appropriation must prove four sub-claims: diversion (that the water had been withdrawn), priority (that the withdrawer had diverted water prior to the other claimant), intent (that the water had been withdrawn by design), and beneficial use (that the water was put to a publicly-acceptable end). If proved, the initial person to use a quantity of water from a water source for a beneficial use has the right to continue to use the same quantity of water for the same purpose. Subsequent users can use the remaining water for their own beneficial purposes provided that they do not impinge on the rights of previous users; this is the priority element of the doctrine. But neither can a senior user change the manner (i.e., location) in which they appropriate water to the detriment of a junior user. These Preservation of Conditions were granted to the second user after Farmers Highline Canal & Reservoir Co. v. City of Golden, 272 P.2d 629 (Colo. 1954). A senior water user could, for example, only have been using the water during a particular season. Then the purchaser of the water right could only use the water in the same season as when the right was established. In addition, the state may put additional conditions on the use of the water right to prevent polluting or inefficient uses of water. Beneficial use is commonly defined as agricultural, industrial or household use. The doctrine has historically excluded ecological purposes, such as maintaining a natural body of water and the wildlife that depends on it, but some jurisdictions now accept such claims. The extent to which private parties may own such rights varies among the states. Each water right has a yearly quantity and an appropriation date. Each year, the user with the earliest appropriation date (known as the "senior appropriator") may use up to their full allocation (provided the water source can supply it). Then the user with the next earliest appropriation date may use their full allocation and so on. In cases of water shortages, prior-appropriation does not require a senior user to utilize less water than usual. Therefore, during times of drought, users with junior appropriation dates might not receive their full allocation or even any water at all. When a water right is sold, it retains its original appropriation date. Only the amount of water historically consumed can be transferred if a water right is sold. For example, if alfalfa is grown using flood irrigation, the amount of the return flow may not be transferred, only the amount that would be necessary to irrigate the amount of alfalfa historically grown. Prior appropriation rights are subject to certain adverse possession-type rules to reduce speculation. Withdrawal rights can be lost or shrunk over time if unused for a certain number of years, or if a litigant can demonstrate that the water's use is not beneficial.
Criticism Each drop of rain falling through the sky has already been allocated to a user. Leave the hose running between rinses while you wash your car and you won't run afoul of the law; but if you gather a pailful of rainwater and pour on your tomato plant, look over your shoulder for a water cop. You will be preventing those raindrops from entering the watershed, depriving people downstream from the surrounding creeks and rivers of their rights to use their apportioned amounts of streamflow. The doctrine of prior appropriation comes crashing up against the imperative to conserve scarce water. Colorado made it legal for some homeowners to harvest rain and snow from their roofs. Tucson is encouraging its citizens to gather rainwater. Santa Fe made catchment devices mandatory for new dwellings. But, in Utah and Washington (with the exception of Seattle), harvesting raindrops is still a crime. Even though water markets increasingly gain ground, many criticize the prior appropriation system for failing to adequately adjust to society's evolving values and needs. Environmentalists and recreational river-users demand more water be left in rivers and streams, but courts have been slow to accept these requests as beneficial uses. Conversely, the tool of beneficial use is too tied to custom to encourage users to conserve. An appropriator who uses water inefficiently retains the right to the full allotment, but an appropriator who uses only a portion risks losing the right to the rest, and water right markets remain too illiquid to purchase any excess. As a result, the vast majority of water in the West still is allocated to agricultural uses despite cries for additional water from growing cities. High demand can cause an over-appropriation of the waters, in which there are more water rights for a particular stream than water actually available. This leads to an apparent inefficiency: if a water source is over-appropriated, the latest users will almost never see water from their claims.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in energy_utilities (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (6): "ada", "boise", "idaho", "miles", "northwest", "population".
adaboiseidahomilesnorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
192 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP192 edges
🌿 BRANCH153 edges
0.590
Electrician ↗ Q165029 EXACT TITLE
componentsdataelectricalequipmentexistinginfrastructureinstallationlinesmaintenanceplatformsrelatedrepair
SHARED TOKENS (12): "components", "data", "electrical", "equipment", "existing", "infrastructure", "installation", "lines", "maintenance", "platforms", "related", "repair". | URL->A (1): http://www.bls.gov/ooh/construction-and-extraction/electricians.htm. | EXACT TITLE in energy_utilities: "Electrician".
0.590
idahomunicipalitiesoperatedownedpowerprivatelyprovidepublicregulateregulatesutilitiesutility
SHARED TOKENS (12): "idaho", "municipalities", "operated", "owned", "power", "privately", "provide", "public", "regulate", "regulates", "utilities", "utility". | URL->A (1): https://puc.idaho.gov/. | EXACT TITLE in energy_utilities: "Idaho Public Utilities Commission".
0.500
amongapproximatelybigboisedivisionextensionidahomainoperatesproductionprofessionalpublicresearchruralschoolsuniversity
SHARED TOKENS (16): "among", "approximately", "big", "boise", "division", "extension", "idaho", "main", "operates", "production", "professional", "public", "research", "rural", "schools", "university". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Tariff ↗ EXACT TITLE
accordingamongconsumerconsumerscostsdesigneddomesticdutieseconomiceconomyformgrowthinstrumentsintendedlocalmaterialsmeansnationalpolicypressure
SHARED TOKENS (32): "according", "among", "consumer", "consumers", "costs", "designed", "domestic", "duties", "economic", "economy", "form", "growth", "instruments", "intended", "local", "materials", "means", "national", "policy", "pressure".... | EXACT TITLE in energy_utilities: "Tariff".
0.500
alongsidecanalscontainscontinueddrinkingenergyformgroundhydropowerindustrialirrigationlandlargemajorprecipitationrecreationresultsurfacetreatmentuses
SHARED TOKENS (22): "alongside", "canals", "contains", "continued", "drinking", "energy", "form", "ground", "hydropower", "industrial", "irrigation", "land", "large", "major", "precipitation", "recreation", "result", "surface", "treatment", "uses".... | EXACT TITLE in water_rights: "Surface water".
0.500
anotherchaincurrentdifferentenergyevenlevelmakingnaturalprocessratesinglestablethoughtreated
SHARED TOKENS (15): "another", "chain", "current", "different", "energy", "even", "level", "making", "natural", "process", "rate", "single", "stable", "though", "treated". | EXACT TITLE in water_rights: "Radionuclide".
0.500
agriculturalapproximatelychangedrinkingflowgroundgroundwaterindustrialirrigationnaturalresourceresourcesriversourcesouthsupplysurfacewastewater
SHARED TOKENS (18): "agricultural", "approximately", "change", "drinking", "flow", "ground", "groundwater", "industrial", "irrigation", "natural", "resource", "resources", "river", "source", "south", "supply", "surface", "wastewater". | EXACT TITLE in energy_utilities: "Water resources". | EXACT TITLE in water_rights: "Water resources".
0.500
Land use ↗ Q1165944 EXACT TITLE
agriculturalanotherassessmentsbuiltcategoriescategorychangechangesclassificationdatadirectlydominantenvironmentenvironmentallandland-uselandsmajormanagementmodeling
SHARED TOKENS (30): "agricultural", "another", "assessments", "built", "categories", "category", "change", "changes", "classification", "data", "directly", "dominant", "environment", "environmental", "land", "land-use", "lands", "major", "management", "modeling".... | EXACT TITLE in water_rights: "Land use".
0.500
anotherboundariesdrainageengineeringenvironmentalhydrologiclakelandpointratherriversinglesurfacesystemthoughunderground
SHARED TOKENS (16): "another", "boundaries", "drainage", "engineering", "environmental", "hydrologic", "lake", "land", "point", "rather", "river", "single", "surface", "system", "though", "underground". | EXACT TITLE in water_rights: "Drainage basin".
0.500
anotheraquiferaquifersconnectedconservationconstructeddesigndesigneddevelopingdistributiondrainsenergyengineeringflowgoverninggroundwaterinteractionlocalmainmatter
SHARED TOKENS (30): "another", "aquifer", "aquifers", "connected", "conservation", "constructed", "design", "designed", "developing", "distribution", "drains", "energy", "engineering", "flow", "governing", "groundwater", "interaction", "local", "main", "matter".... | EXACT TITLE in water_rights: "Hydrogeology".
0.500
Wheat ↗ Q15645384 EXACT TITLE
acresaroundcenturydemandfoodgroupincreasinglandmajormakingmillionpopulationproductionqualityrecordrelativelysourcesupplying
SHARED TOKENS (18): "acres", "around", "century", "demand", "food", "group", "increasing", "land", "major", "making", "million", "population", "production", "quality", "record", "relatively", "source", "supplying". | EXACT TITLE in water_rights: "Wheat".
0.500
communitycomponentsconventionaldifferentdistributiondistrictelectricalenergyenvironmentalflowgeothermalhybridincreasinglymajormakesmeansnetworkoperatepowerpressure
SHARED TOKENS (31): "community", "components", "conventional", "different", "distribution", "district", "electrical", "energy", "environmental", "flow", "geothermal", "hybrid", "increasingly", "major", "makes", "means", "network", "operate", "power", "pressure".... | EXACT TITLE in energy_utilities: "Distributed generation".
0.500
Natural gas ↗ Q40858 EXACT TITLE
accordingalongsideassessmentassetschainchangecommercialdemandenergyfootprintformedgenerallyinfrastructurelayerslong-termmajormatternaturalpressureprocesses
SHARED TOKENS (29): "according", "alongside", "assessment", "assets", "chain", "change", "commercial", "demand", "energy", "footprint", "formed", "generally", "infrastructure", "layers", "long-term", "major", "matter", "natural", "pressure", "processes".... | EXACT TITLE in energy_utilities: "Natural gas".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdeterminedevelopmentdifferentformgoverngrowthindustriallandland-uselocalmunicipalityplanningpolicypropertyregulatoryresidentialrulesshape
SHARED TOKENS (25): "allowing", "building", "determine", "development", "different", "form", "govern", "growth", "industrial", "land", "land-use", "local", "municipality", "planning", "policy", "property", "regulatory", "residential", "rules", "shape".... | EXACT TITLE in energy_utilities: "Zoning". | EXACT TITLE in water_rights: "Zoning".
0.500
Pipeline ↗ Q25471856 EXACT TITLE
buriedcanalsconstructedconstructiondesigndrinkingenvironmentalevenirrigationmainmarketmaterialsmilesmillionmovenaturalnetworkpipepipelineplanning
SHARED TOKENS (30): "buried", "canals", "constructed", "construction", "design", "drinking", "environmental", "even", "irrigation", "main", "market", "materials", "miles", "million", "move", "natural", "network", "pipe", "pipeline", "planning".... | EXACT TITLE in energy_utilities: "Pipeline". | EXACT TITLE in water_rights: "Pipeline".
0.500
actadministrationappliesapplydrinkingenvironmentalfederalfoodintendedlawprimaryprivateprotectionprovidingpublicqualityregulatedservedstandardssystem
SHARED TOKENS (22): "act", "administration", "applies", "apply", "drinking", "environmental", "federal", "food", "intended", "law", "primary", "private", "protection", "providing", "public", "quality", "regulated", "served", "standards", "system".... | EXACT TITLE in energy_utilities: "Safe Drinking Water Act".
0.500
Wastewater ↗ Q336191 EXACT TITLE
agriculturalanotherapplicationscombinationcommercialcommunitydomesticdrinkingindustrialmunicipalprocessessewerstormsurfacewastewastewater
SHARED TOKENS (16): "agricultural", "another", "applications", "combination", "commercial", "community", "domestic", "drinking", "industrial", "municipal", "processes", "sewer", "storm", "surface", "waste", "wastewater". | EXACT TITLE in energy_utilities: "Wastewater". | EXACT TITLE in water_rights: "Wastewater".
0.500
commercialcomponentsconsumersdistributionfireindustrialinfrastructurenetworkpotablerequirementsresidentialsupplysystemtreatmentwells
SHARED TOKENS (15): "commercial", "components", "consumers", "distribution", "fire", "industrial", "infrastructure", "network", "potable", "requirements", "residential", "supply", "system", "treatment", "wells". | EXACT TITLE in energy_utilities: "Water distribution system".
0.500
agencieschangecommunitycomponentsdevelopmentdifferentdistincteconomiceconomyeducationalelectricalemergencyenforcementenvironmentenvironmentalfacilitiesfirmsfunctionimportanceindustrial
SHARED TOKENS (41): "agencies", "change", "community", "components", "development", "different", "distinct", "economic", "economy", "educational", "electrical", "emergency", "enforcement", "environment", "environmental", "facilities", "firms", "function", "importance", "industrial".... | EXACT TITLE in energy_utilities: "Infrastructure". | EXACT TITLE in water_rights: "Infrastructure".
0.500
becomecapacitychangecleancostcurrentenergyenvironmentalevenexpansiongeothermalhydropowerincreaseinstallationslandlargelocalmainmajormaking
SHARED TOKENS (40): "become", "capacity", "change", "clean", "cost", "current", "energy", "environmental", "even", "expansion", "geothermal", "hydropower", "increase", "installations", "land", "large", "local", "main", "major", "making".... | EXACT TITLE in energy_utilities: "Renewable energy".
0.500
Journeyman ↗ Q582096 EXACT TITLE
apprenticeshipbecomebuildingbusinesscontinuededucationevaluationexaminationexperiencegenerallyindividuallicenseofficialprotectpublicresponsiblesupervisedworkworkersworking
SHARED TOKENS (21): "apprenticeship", "become", "building", "business", "continued", "education", "evaluation", "examination", "experience", "generally", "individual", "license", "official", "protect", "public", "responsible", "supervised", "work", "workers", "working".... | EXACT TITLE in energy_utilities: "Journeyman".
0.500
Drought ↗ Q43059 EXACT TITLE
agricultureannualavailabilitybecomechangecostsdatedevelopingdirectlyeconomiceconomyenvironmentalexperiencefoodfuturehistoryhydropowerincreaseincreasinglarge
SHARED TOKENS (35): "agriculture", "annual", "availability", "become", "change", "costs", "date", "developing", "directly", "economic", "economy", "environmental", "experience", "food", "future", "history", "hydropower", "increase", "increasing", "large".... | EXACT TITLE in water_rights: "Drought".
0.500
actualannualcapacitychargescombinationcommercialconsumerscostcustomerdemanddomesticelectricalenergyevenheatingindividualindustriallevelmanagementoperating
SHARED TOKENS (29): "actual", "annual", "capacity", "charges", "combination", "commercial", "consumers", "cost", "customer", "demand", "domestic", "electrical", "energy", "even", "heating", "individual", "industrial", "level", "management", "operating".... | EXACT TITLE in energy_utilities: "Peak demand".
0.500
Heat pump ↗ Q131313 EXACT TITLE
anotherbuildingchangecostdependsdesigneddistrictelectricalenergyfootprintgroundheatingincreasinglimitedmeansmillionmitigationmovenaturalneed
SHARED TOKENS (36): "another", "building", "change", "cost", "depends", "designed", "district", "electrical", "energy", "footprint", "ground", "heating", "increasing", "limited", "means", "million", "mitigation", "move", "natural", "need".... | EXACT TITLE in energy_utilities: "Heat pump".
0.500
aroundbusinessdistributioneasternelectricalfollowsgenerallygeothermalidahonaturaloperatespowerregulatedriversharessnakesouthernutility
SHARED TOKENS (18): "around", "business", "distribution", "eastern", "electrical", "follows", "generally", "geothermal", "idaho", "natural", "operates", "power", "regulated", "river", "shares", "snake", "southern", "utility". | EXACT TITLE in energy_utilities: "Idaho Power".
0.500
adaboisebuiltbureaucanalcanyonchannelcountiesdamdiversionengineersidahoirrigationluckymilesoperatedpeakprimaryreclamationriver
SHARED TOKENS (25): "ada", "boise", "built", "bureau", "canal", "canyon", "channel", "counties", "dam", "diversion", "engineers", "idaho", "irrigation", "lucky", "miles", "operated", "peak", "primary", "reclamation", "river".... | EXACT TITLE in energy_utilities: "Boise River Diversion Dam". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralchangecommercialconnectedconsumercontrolcustomerdifferentdistributionelectricalenergyflowfunctionsgenerallyindustrialinfrastructurelargeoperatedowned
SHARED TOKENS (27): "approximately", "central", "change", "commercial", "connected", "consumer", "control", "customer", "different", "distribution", "electrical", "energy", "flow", "functions", "generally", "industrial", "infrastructure", "large", "operated", "owned".... | EXACT TITLE in energy_utilities: "Substation".
0.500
administrativeapproximatelybecomebillioncenturychangecreatecreatescurrentdescribesdevelopingdevelopmentdrinkingeconomiceducationenvironmentalforecastformedgrowthincrease
SHARED TOKENS (49): "administrative", "approximately", "become", "billion", "century", "change", "create", "creates", "current", "describes", "developing", "development", "drinking", "economic", "education", "environmental", "forecast", "formed", "growth", "increase".... | EXACT TITLE in water_rights: "Urbanization".
0.500
apprenticeshipboundariescertificationcompletecontinuedlaborlevellicenseoutsideplacementpotentialprofessionalregulatedstudysystemtradestrainingworking
SHARED TOKENS (18): "apprenticeship", "boundaries", "certification", "complete", "continued", "labor", "level", "license", "outside", "placement", "potential", "professional", "regulated", "study", "system", "trades", "training", "working". | EXACT TITLE in energy_utilities: "Apprenticeship". | EXACT TITLE in water_rights: "Apprenticeship".
0.500
Lineworker ↗ Q691225 EXACT TITLE
commercialdeliverdistributionelectricalemergencyenergyfacilitiesgenerallygroundindustrialinsideinstallinstallationslinesmaintainmaintainsresidentialstormwork
SHARED TOKENS (19): "commercial", "deliver", "distribution", "electrical", "emergency", "energy", "facilities", "generally", "ground", "industrial", "inside", "install", "installations", "lines", "maintain", "maintains", "residential", "storm", "work". | EXACT TITLE in energy_utilities: "Lineworker".
0.500
Hydrology ↗ Q42250 EXACT TITLE
civildatadistributiondrainageengineeringenvironmentalfieldsgroundwatermanagementnaturalphysicalplanningpolicyqualityrelatedresearchresourcesstudysurface
SHARED TOKENS (19): "civil", "data", "distribution", "drainage", "engineering", "environmental", "fields", "groundwater", "management", "natural", "physical", "planning", "policy", "quality", "related", "research", "resources", "study", "surface". | EXACT TITLE in water_rights: "Hydrology".
0.500
Easement ↗ Q448405 EXACT TITLE
amonganothereasementsholderitselflandlawlimitedownedprivatelypropertyprovidingpublicpurposerealrightrightsstated
SHARED TOKENS (18): "among", "another", "easements", "holder", "itself", "land", "law", "limited", "owned", "privately", "property", "providing", "public", "purpose", "real", "right", "rights", "stated". | EXACT TITLE in energy_utilities: "Easement". | EXACT TITLE in water_rights: "Easement".
0.500
agenciesbureaubusinessescoordinationcurrentdatadepartmenteconomicfederallaborlocalmaintainmajormanagementmatterneedofficeprincipalprocessespublic
SHARED TOKENS (26): "agencies", "bureau", "businesses", "coordination", "current", "data", "department", "economic", "federal", "labor", "local", "maintain", "major", "management", "matter", "need", "office", "principal", "processes", "public".... | EXACT TITLE in energy_utilities: "Bureau of Labor Statistics".
0.500
assessmentsbillioncomplianceenforcementevenformgroundwaterindustrialissuemakingmattermunicipaloperationsprocessprocessessolidwastewaters
SHARED TOKENS (18): "assessments", "billion", "compliance", "enforcement", "even", "form", "groundwater", "industrial", "issue", "making", "matter", "municipal", "operations", "process", "processes", "solid", "waste", "waters". | EXACT TITLE in energy_utilities: "Industrial waste".
0.500
assetsbroadercanalscapitalcategorycommunityconstructedconstructiondirectlydrinkingeconomicelectricalemploymentenvironmentalfacilitieshabitatinfrastructurelong-termmunicipaloperator
SHARED TOKENS (33): "assets", "broader", "canals", "capital", "category", "community", "constructed", "construction", "directly", "drinking", "economic", "electrical", "employment", "environmental", "facilities", "habitat", "infrastructure", "long-term", "municipal", "operator".... | EXACT TITLE in energy_utilities: "Public works". | EXACT TITLE in water_rights: "Public works".
0.500
accordingagriculturalagriculturechangesclassificationdifferentenvironmentalfoodformhomeindustrialmakingphysicalprimaryreducingresultswaste
SHARED TOKENS (17): "according", "agricultural", "agriculture", "changes", "classification", "different", "environmental", "food", "form", "home", "industrial", "making", "physical", "primary", "reducing", "results", "waste". | EXACT TITLE in water_rights: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestateintendedlandlawlegalmeansnaturalownedownershipprivatepropertypublicpurposerealresidential
SHARED TOKENS (23): "acquisition", "business", "commercial", "different", "entity", "estate", "intended", "land", "law", "legal", "means", "natural", "owned", "ownership", "private", "property", "public", "purpose", "real", "residential".... | EXACT TITLE in energy_utilities: "Real estate". | EXACT TITLE in water_rights: "Real estate".
0.500
Microgrid ↗ Q5762595 EXACT TITLE
boundariesbuildingconnectedcontrolcrossdistributiondomesticeconomicelectricalemergencyenergyentityevenfunctiongenerallyheatingisolatedlevellocalmajor
SHARED TOKENS (37): "boundaries", "building", "connected", "control", "cross", "distribution", "domestic", "economic", "electrical", "emergency", "energy", "entity", "even", "function", "generally", "heating", "isolated", "level", "local", "major".... | EXACT TITLE in energy_utilities: "Microgrid".
0.500
Telemetry ↗ Q209867 EXACT TITLE
communicationscontrolcostdataequipmentinstructionsmechanismsmediamonitoringneednetworkoperatephysicalpowerreceivereceivingrequiresystemstransfertransferred
SHARED TOKENS (20): "communications", "control", "cost", "data", "equipment", "instructions", "mechanisms", "media", "monitoring", "need", "network", "operate", "physical", "power", "receive", "receiving", "require", "systems", "transfer", "transferred". | EXACT TITLE in water_rights: "Telemetry".
0.500
associationcertificationcontractorseducationalengineersgroundgroundwatergroupmonitoringnationaloperatesprogramspublicpublishesrelatedresearchresponsibleseparate
SHARED TOKENS (18): "association", "certification", "contractors", "educational", "engineers", "ground", "groundwater", "group", "monitoring", "national", "operates", "programs", "public", "publishes", "related", "research", "responsible", "separate". | EXACT TITLE in energy_utilities: "National Ground Water Association".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcommunicationscomponentsconstructiondevelopmentengineeringenvironmentequipmentestablishgishistorylandlawlegalmappingownershipplanningprofessional
SHARED TOKENS (30): "analysis", "boundaries", "civil", "communications", "components", "construction", "development", "engineering", "environment", "equipment", "establish", "gis", "history", "land", "law", "legal", "mapping", "ownership", "planning", "professional".... | EXACT TITLE in water_rights: "Surveying".
0.500
businessconstructioncontractordesigndifferentdirectlyelectricalfirmhomeindividualinstallationlicensesmaintenanceoperateownersprofessionalrelatedrequirementsspecializedsystems
SHARED TOKENS (21): "business", "construction", "contractor", "design", "different", "directly", "electrical", "firm", "home", "individual", "installation", "licenses", "maintenance", "operate", "owners", "professional", "related", "requirements", "specialized", "systems".... | EXACT TITLE in energy_utilities: "Electrical contractor".
0.500
acresactivecentersdisposalenergyenvironmentalfacilitiesinjectioninvolvedmanagementmaterialsoperatedoperatesoperationsownedprojectsprotectionproviderprovidingresidents
SHARED TOKENS (30): "acres", "active", "centers", "disposal", "energy", "environmental", "facilities", "injection", "involved", "management", "materials", "operated", "operates", "operations", "owned", "projects", "protection", "provider", "providing", "residents".... | EXACT TITLE in energy_utilities: "Republic Services".
0.500
Compost ↗ Q212254 EXACT TITLE
agriculturebeneficialbiologicalcommercialconstructioneconomicenvironmentalfoodincreasinglandlevelmanagementmaterialsmatterphysicalprocesspropertiesprovidingreclamationreduce
SHARED TOKENS (25): "agriculture", "beneficial", "biological", "commercial", "construction", "economic", "environmental", "food", "increasing", "land", "level", "management", "materials", "matter", "physical", "process", "properties", "providing", "reclamation", "reduce".... | EXACT TITLE in energy_utilities: "Compost".
0.500
Landfill ↗ Q152810 EXACT TITLE
activechangeconsolidationdischargedisposalenvironmentalfinalformfulllandmanagementmaterialsmunicipalreleasesimplysitesitessolidstoragetemporary
SHARED TOKENS (25): "active", "change", "consolidation", "discharge", "disposal", "environmental", "final", "form", "full", "land", "management", "materials", "municipal", "release", "simply", "site", "sites", "solid", "storage", "temporary".... | EXACT TITLE in energy_utilities: "Landfill".
0.500
affectsbusinesscertificationconsumerconsumerscreatescustomereconomicentryformgrowthindividuallawleastlicenselicensedlicensingmarketmechanismsoccupational
SHARED TOKENS (42): "affects", "business", "certification", "consumer", "consumers", "creates", "customer", "economic", "entry", "form", "growth", "individual", "law", "least", "license", "licensed", "licensing", "market", "mechanisms", "occupational".... | EXACT TITLE in energy_utilities: "Occupational licensing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagriculturealteredapplicationappliesaquiferscentralchangesconsolidationcontrolcontrolleddirectlydischargedistributesdistributiondownstreamdrainageenvironmentalfieldsflow
SHARED TOKENS (58): "agricultural", "agriculture", "altered", "application", "applies", "aquifers", "central", "changes", "consolidation", "control", "controlled", "directly", "discharge", "distributes", "distribution", "downstream", "drainage", "environmental", "fields", "flow".... | EXACT TITLE in energy_utilities: "Irrigation". | EXACT TITLE in water_rights: "Irrigation".
0.500
Veolia ↗ Q1632461 EXACT TITLE
billionboardbusinessenergyenvironmentenvironmentalgroupmainmajormanagementoperationspublicrecordedsectorsingleutilityveoliawaste
SHARED TOKENS (18): "billion", "board", "business", "energy", "environment", "environmental", "group", "main", "major", "management", "operations", "public", "recorded", "sector", "single", "utility", "veolia", "waste". | EXACT TITLE in energy_utilities: "Veolia". | EXACT TITLE in water_rights: "Veolia".
0.500
Pipefitter ↗ Q5407416 EXACT TITLE
apprenticeshipcommercialcompletionconstructioncontrolleddifferenteducationheatingindustrialinstitutionallicensedmaintainsnationalpipepipingpotablepressureprocessregulatedrequire
SHARED TOKENS (30): "apprenticeship", "commercial", "completion", "construction", "controlled", "different", "education", "heating", "industrial", "institutional", "licensed", "maintains", "national", "pipe", "piping", "potable", "pressure", "process", "regulated", "require".... | EXACT TITLE in energy_utilities: "Pipefitter".
0.500
associationcontractorscontroldescribeddrillingenvironmentequipmentevaluationgroundgroundwaterinjectionmonitoringnaturalpressureprocessproducingprofileprotectregulatedreservoir
SHARED TOKENS (28): "association", "contractors", "control", "described", "drilling", "environment", "equipment", "evaluation", "ground", "groundwater", "injection", "monitoring", "natural", "pressure", "process", "producing", "profile", "protect", "regulated", "reservoir".... | EXACT TITLE in energy_utilities: "Well drilling". | EXACT TITLE in water_rights: "Well drilling".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcanalcanalschannelcontrolcreatecurrentdeliverdrainagefloodflowgenerallyincreaseirrigationlevelmanagementnaturalneededpressure
SHARED TOKENS (30): "building", "built", "canal", "canals", "channel", "control", "create", "current", "deliver", "drainage", "flood", "flow", "generally", "increase", "irrigation", "level", "management", "natural", "needed", "pressure".... | EXACT TITLE in energy_utilities: "Canal". | EXACT TITLE in water_rights: "Canal".
0.500
Recycling ↗ Q132580 EXACT TITLE
anotherconservationconstituentcontrolconventionaldelivereddependsdifferentdisposaleconomicenergyenvironmentalfoodformmanagementmaterialsofficeprocessproducesproducing
SHARED TOKENS (32): "another", "conservation", "constituent", "control", "conventional", "delivered", "depends", "different", "disposal", "economic", "energy", "environmental", "food", "form", "management", "materials", "office", "process", "produces", "producing".... | EXACT TITLE in energy_utilities: "Recycling".
0.500
actapplicationbecomescleandischargeflowgenerallygroundgroundwaterirrigationneedpermitpointprecipitationqualityrechargerequirementsrisksuppliedsurface
SHARED TOKENS (21): "act", "application", "becomes", "clean", "discharge", "flow", "generally", "ground", "groundwater", "irrigation", "need", "permit", "point", "precipitation", "quality", "recharge", "requirements", "risk", "supplied", "surface".... | EXACT TITLE in water_rights: "Return flow".
0.500
assessmentsbuiltcapacityclassificationcommunitydamdatadefinitionsenergyenvironmentalexactinstallationsisolatedlevellocalnationaloperatingpermittingpowerprimary
SHARED TOKENS (33): "assessments", "built", "capacity", "classification", "community", "dam", "data", "definitions", "energy", "environmental", "exact", "installations", "isolated", "level", "local", "national", "operating", "permitting", "power", "primary".... | EXACT TITLE in energy_utilities: "Small hydro".
0.500
adaboardboisecanyoncollegecommunitycountiescwidevelopmenteasterneducationgovernedidaholargenampapopulationprimaryprogramspublicreported
SHARED TOKENS (31): "ada", "board", "boise", "canyon", "college", "community", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "reported".... | EXACT TITLE in energy_utilities: "College of Western Idaho". | EXACT TITLE in water_rights: "College of Western Idaho".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectsapplicationscombinationdetermineenvironmentalformgroundwatergroupincreasingneededprimaryproductionpropertiesproposedprotectionresearchriskrolesemiconductorshares
SHARED TOKENS (23): "affects", "applications", "combination", "determine", "environmental", "form", "groundwater", "group", "increasing", "needed", "primary", "production", "properties", "proposed", "protection", "research", "risk", "role", "semiconductor", "shares".... | EXACT TITLE in water_rights: "Arsenic".
0.480
constructioncontrolcontrolsdesignedgenerallylakemanagementmeasuresneedreduceriversitestormtemporary
SHARED TOKENS (14): "construction", "control", "controls", "designed", "generally", "lake", "management", "measures", "need", "reduce", "river", "site", "storm", "temporary". | EXACT TITLE in energy_utilities: "Sediment control".
0.480
anotherbeneficialestateevenlegalnamesownerpropertyrightrightssharesthoughtitleunderlying
SHARED TOKENS (14): "another", "beneficial", "estate", "even", "legal", "names", "owner", "property", "right", "rights", "shares", "though", "title", "underlying". | EXACT TITLE in energy_utilities: "Beneficial use". | EXACT TITLE in water_rights: "Beneficial use".
0.480
Nitrate ↗ Q49916468 EXACT TITLE
agriculturalapplicationsassociatedcomponentsdirectenergyenvironmentmeansmillionnaturalprecipitationprocessesproductionsource
SHARED TOKENS (14): "agricultural", "applications", "associated", "components", "direct", "energy", "environment", "means", "million", "natural", "precipitation", "processes", "production", "source". | EXACT TITLE in water_rights: "Nitrate".
0.480
departmentenergyfederalhydropowerindependentlicensingnaturalpipelineprojectsregulatesregulatoryreviewsservingstorage
SHARED TOKENS (14): "department", "energy", "federal", "hydropower", "independent", "licensing", "natural", "pipeline", "projects", "regulates", "regulatory", "reviews", "serving", "storage". | EXACT TITLE in energy_utilities: "Federal Energy Regulatory Commission".
0.460
MODFLOW ↗ Q6716996 EXACT TITLE
aquifersbeyondboundarycodecommercialflowgroundwatermodeloperatingprogrampublicsourcesystems
SHARED TOKENS (13): "aquifers", "beyond", "boundary", "code", "commercial", "flow", "groundwater", "model", "operating", "program", "public", "source", "systems". | EXACT TITLE in water_rights: "MODFLOW".
0.460
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclassificationdifferentdrinkingformationgroundphysicalpropertiesprovideresourcestudy
SHARED TOKENS (13): "agriculture", "annual", "change", "classification", "different", "drinking", "formation", "ground", "physical", "properties", "provide", "resource", "study". | EXACT TITLE in water_rights: "Snowpack".
0.440
Ditch ↗ Q2048319 EXACT TITLE
alongsidearoundchanneldrainageeasternfieldsirrigationmajorprovideruralsourcethem
SHARED TOKENS (12): "alongside", "around", "channel", "drainage", "eastern", "fields", "irrigation", "major", "provide", "rural", "source", "them". | EXACT TITLE in water_rights: "Ditch".
0.440
approximatelyboisedatadistrictdistrictsdividedevenidahopopulationresidentssinglesouth
SHARED TOKENS (12): "approximately", "boise", "data", "district", "districts", "divided", "even", "idaho", "population", "residents", "single", "south". | EXACT TITLE in water_rights: "Idaho Legislature".
0.420
capacitychanneldischargeflowgroundgroundwaterlandmajorrecordsurfacevolume
SHARED TOKENS (11): "capacity", "channel", "discharge", "flow", "ground", "groundwater", "land", "major", "record", "surface", "volume". | EXACT TITLE in water_rights: "Streamflow".
0.420
Effluent ↗ Q1057706 EXACT TITLE
differentdirectlyfacilityindustrialriversourcesurfacetreatedwastewastewaterwaters
SHARED TOKENS (11): "different", "directly", "facility", "industrial", "river", "source", "surface", "treated", "waste", "wastewater", "waters". | EXACT TITLE in water_rights: "Effluent".
0.420
aquiferdrainageenvironmentalgroundwaterhydrologicprimaryprocessprocessesrechargesubsurfacesurface
SHARED TOKENS (11): "aquifer", "drainage", "environmental", "groundwater", "hydrologic", "primary", "process", "processes", "recharge", "subsurface", "surface". | EXACT TITLE in water_rights: "Groundwater recharge".
0.420
administrationassociateddepartmenteconomicfederalmanagesnationalofficepotentialresourcesresponsible
SHARED TOKENS (11): "administration", "associated", "department", "economic", "federal", "manages", "national", "office", "potential", "resources", "responsible". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.420
acrescanyoneasternidahonationalrecreationriversnakewaterswestwestern
SHARED TOKENS (11): "acres", "canyon", "eastern", "idaho", "national", "recreation", "river", "snake", "waters", "west", "western". | EXACT TITLE in energy_utilities: "Hells Canyon".
0.400
adjudicationevaluatedinvolvedlegalobligationsprocessprocessesreviewsrightsshows
SHARED TOKENS (10): "adjudication", "evaluated", "involved", "legal", "obligations", "process", "processes", "reviews", "rights", "shows". | EXACT TITLE in energy_utilities: "Adjudication". | EXACT TITLE in water_rights: "Adjudication".
0.400
capacityconservationdeliveriesdeliveryfeefuturerightrightsstoragetransfers
SHARED TOKENS (10): "capacity", "conservation", "deliveries", "delivery", "fee", "future", "right", "rights", "storage", "transfers". | EXACT TITLE in water_rights: "Water banking".
0.380
agriculturalirrigationlocalmanagementnaturalprocessesresourcerolesurface
SHARED TOKENS (9): "agricultural", "irrigation", "local", "management", "natural", "processes", "resource", "role", "surface". | EXACT TITLE in water_rights: "Evapotranspiration".
0.360
agriculturebuildingdevelopmentestatelandnaturalpurposereal
SHARED TOKENS (8): "agriculture", "building", "development", "estate", "land", "natural", "purpose", "real". | EXACT TITLE in energy_utilities: "Land development". | EXACT TITLE in water_rights: "Land development".
0.340
drinkingorganizationsprovidingpublicregulatorysystemutilities
SHARED TOKENS (7): "drinking", "organizations", "providing", "public", "regulatory", "system", "utilities". | EXACT TITLE in energy_utilities: "Public water system". | EXACT TITLE in water_rights: "Public water system".
0.320
Plumber ↗ Q252924 EXACT TITLE
drainagedrinkingplumbingpotableproductionsystems
SHARED TOKENS (6): "drainage", "drinking", "plumbing", "potable", "production", "systems". | EXACT TITLE in water_rights: "Plumber".
0.300
anotherapplicationassessmentsconstructioncreatedependdevelopersdevelopmentdisposalenvironmentalgenerallygroundwaterlandmaterialsmediamunicipalphysicalpressureprogramprograms
SHARED TOKENS (30): "another", "application", "assessments", "construction", "create", "depend", "developers", "development", "disposal", "environmental", "generally", "groundwater", "land", "materials", "media", "municipal", "physical", "pressure", "program", "programs"....
0.300
Project finance ↗ KW CROSS HIGH
addressagreementsallocationamongassetsassociatedcapitalconstructioncontractscontrolcorporatedeliverydevelopingdevelopmenteconomicentityenvironmentalfailurefinancefinancing
SHARED TOKENS (52): "address", "agreements", "allocation", "among", "assets", "associated", "capital", "construction", "contracts", "control", "corporate", "delivery", "developing", "development", "economic", "entity", "environmental", "failure", "finance", "financing"....
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalagriculturecanalsdatedesignedfieldsformimportanceirrigatedirrigationmanagementoperatedregionresourcesouthernsystemsthroughout
SHARED TOKENS (17): "agricultural", "agriculture", "canals", "date", "designed", "fields", "form", "importance", "irrigated", "irrigation", "management", "operated", "region", "resource", "southern", "systems", "throughout".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomebuildingcommercialcorecostsdescribeddevelopmentenvironmentenvironmentalexistingexpansionformgrowthindustrialinfrastructurelandlargeplanningpopulation
SHARED TOKENS (31): "associated", "become", "building", "commercial", "core", "costs", "described", "development", "environment", "environmental", "existing", "expansion", "form", "growth", "industrial", "infrastructure", "land", "large", "planning", "population"....
0.300
capitalcostcostsdistributionelectricalincreaselinesoperatingpowerqualityreducerisksupplyundergroundwildfire
SHARED TOKENS (15): "capital", "cost", "costs", "distribution", "electrical", "increase", "lines", "operating", "power", "quality", "reduce", "risk", "supply", "underground", "wildfire".
0.300
Black start ↗ Q655257 KW CROSS HIGH
agreementanotherelectricalemergencyenergyfacilityindustriallargemainnetworkoperationpowerprocessprovidingrequiresstationsuitable
SHARED TOKENS (17): "agreement", "another", "electrical", "emergency", "energy", "facility", "industrial", "large", "main", "network", "operation", "power", "process", "providing", "requires", "station", "suitable".
0.300
consumercontrolcontrollingcostscriticaldemanddevelopmentdirectelectricalentitiesevenmakesmanagementneednetworkpeakpowerprivateprocesspublic
SHARED TOKENS (27): "consumer", "control", "controlling", "costs", "critical", "demand", "development", "direct", "electrical", "entities", "even", "makes", "management", "need", "network", "peak", "power", "private", "process", "public"....
0.300
analysisanotherapplicationsbroaderbusinessdatadatabasedateengineeringgisindexinformationinstitutionalintegratedmanagementnaturaloperationsorganizationsphysicalplanning
SHARED TOKENS (30): "analysis", "another", "applications", "broader", "business", "data", "database", "date", "engineering", "gis", "index", "information", "institutional", "integrated", "management", "natural", "operations", "organizations", "physical", "planning"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
agreementcapacitychangeconnectedelectricalenergyenvironmentfarmsgenerallyinstallationspotentialpowersharesourcesouthernstationsstoragesuitablesuppliedsupply
SHARED TOKENS (21): "agreement", "capacity", "change", "connected", "electrical", "energy", "environment", "farms", "generally", "installations", "potential", "power", "share", "source", "southern", "stations", "storage", "suitable", "supplied", "supply"....
0.300
applicationscapacitychainconservationcostdefinesdemanddistrictenergyformfullgrowthheatingincreasingintegratedlawlong-termmeansplanningpower
SHARED TOKENS (29): "applications", "capacity", "chain", "conservation", "cost", "defines", "demand", "district", "energy", "form", "full", "growth", "heating", "increasing", "integrated", "law", "long-term", "means", "planning", "power"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
allowingannualbillingconnectionconsumerscurrentdesignedenergyevenfeemechanismnetpolicypowerprivaterequirerequiressinglesolelystorage
SHARED TOKENS (21): "allowing", "annual", "billing", "connection", "consumers", "current", "designed", "energy", "even", "fee", "mechanism", "net", "policy", "power", "private", "require", "requires", "single", "solely", "storage"....
0.300
advancedapplicationscentralcleancomponentscontrolcreateenvironmentequipmentfacilitiesindividualindustrialinsideintegratedlargemaintainmaterialsneedprocessproduction
SHARED TOKENS (28): "advanced", "applications", "central", "clean", "components", "control", "create", "environment", "equipment", "facilities", "individual", "industrial", "inside", "integrated", "large", "maintain", "materials", "need", "process", "production"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothercivildividedeconomicenforcementenvironmentalgenerallygoverninggovernsjurisdictionlandlawlegalmajorownershipprivatepropertypublicreal
SHARED TOKENS (25): "acquisition", "another", "civil", "divided", "economic", "enforcement", "environmental", "generally", "governing", "governs", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "property", "public", "real"....
0.300
adaboisecanyoncountieshomeidahomainmeridianmetropolitannampanorthwestpercentpopulationtreasurevalley
SHARED TOKENS (15): "ada", "boise", "canyon", "counties", "home", "idaho", "main", "meridian", "metropolitan", "nampa", "northwest", "percent", "population", "treasure", "valley".
0.300
actadministeredagenciesauthoritycodeconsequenceconservationdependdescribeddesigneddevelopmentdifferentdirectseconomicfederalgrowthlawmeansmechanismsnational
SHARED TOKENS (29): "act", "administered", "agencies", "authority", "code", "consequence", "conservation", "depend", "described", "designed", "development", "different", "directs", "economic", "federal", "growth", "law", "means", "mechanisms", "national"....
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
advancedbehindcapacitycenturycodecommunicationsconnectcontrolcreatecurrentdeliverydemanddescribeddistributionelectricalenergyevenfinancingfullfunction
SHARED TOKENS (54): "advanced", "behind", "capacity", "century", "code", "communications", "connect", "control", "create", "current", "delivery", "demand", "described", "distribution", "electrical", "energy", "even", "financing", "full", "function"....
0.300
adjudicationadministrationadministrativeagenciesanotherbuiltcenturychangescivilcontroldecisionsdivisioneconomiceducationenforcementenvironmentenvironmentalgenerallygoverningimportance
SHARED TOKENS (34): "adjudication", "administration", "administrative", "agencies", "another", "built", "century", "changes", "civil", "control", "decisions", "division", "economic", "education", "enforcement", "environment", "environmental", "generally", "governing", "importance"....
0.300
accountadditionalagricultureannualbigboisecenturychangechangesdatadegreesdescribeddifferentexperiencegenerallyhistoryidahoincreaseincreasinginteraction
SHARED TOKENS (37): "account", "additional", "agriculture", "annual", "big", "boise", "century", "change", "changes", "data", "degrees", "described", "different", "experience", "generally", "history", "idaho", "increase", "increasing", "interaction"....
0.300
authorityboundariesdistrictdistrictsentityirrigationlandslargelocalobtainorganizedpowerprojectspublicsubdivision
SHARED TOKENS (15): "authority", "boundaries", "district", "districts", "entity", "irrigation", "lands", "large", "local", "obtain", "organized", "power", "projects", "public", "subdivision".
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
applicationcenturydifferentdistributionelectricalequipmentgenerallygroundincreasinglylargelinespowerpublicreducerelatedresidentialsafetysouthstreetsupport
SHARED TOKENS (27): "application", "century", "different", "distribution", "electrical", "equipment", "generally", "ground", "increasingly", "large", "lines", "power", "public", "reduce", "related", "residential", "safety", "south", "street", "support"....
0.300
analysisaroundbuildingcapacitycommercialcomponentselectricalenergyenvironmentequipmentformindustriallargemanagementmillionmonitoringnetpowerresidentialstations
SHARED TOKENS (25): "analysis", "around", "building", "capacity", "commercial", "components", "electrical", "energy", "environment", "equipment", "form", "industrial", "large", "management", "million", "monitoring", "net", "power", "residential", "stations"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscenturycompleteconnectedcurrenteasternformidahoincreasinglymakingorganizedownerspointriverseparateterritoryvalleywestwestern
SHARED TOKENS (19): "business", "century", "complete", "connected", "current", "eastern", "form", "idaho", "increasingly", "making", "organized", "owners", "point", "river", "separate", "territory", "valley", "west", "western".
0.300
capitalcenturycostcostscreatingentryfailurefirmfirmsforminfrastructurelargemarketnaturaloperatepotentialprovidingpublicregulationsingle
SHARED TOKENS (23): "capital", "century", "cost", "costs", "creating", "entry", "failure", "firm", "firms", "form", "infrastructure", "large", "market", "natural", "operate", "potential", "providing", "public", "regulation", "single"....
0.300
approximatelyaroundcapacitycenturycomponentscostcreatecreatescreatingdevelopmentdownstreamenergyformlevellocallong-termmainmarketmeansnatural
SHARED TOKENS (35): "approximately", "around", "capacity", "century", "components", "cost", "create", "creates", "creating", "development", "downstream", "energy", "form", "level", "local", "long-term", "main", "market", "means", "natural"....
0.300
Combined sewer ↗ Q361472 KW CROSS HIGH
buildingcapacityconstructedconstructioncontactscostsdesigndesigneddewateringdisposaldrainagedrinkingenvironmentalexpandingexperiencefacilitiesflowgroundindividualindustrial
SHARED TOKENS (50): "building", "capacity", "constructed", "construction", "contacts", "costs", "design", "designed", "dewatering", "disposal", "drainage", "drinking", "environmental", "expanding", "experience", "facilities", "flow", "ground", "individual", "industrial"....
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalapplicationsavailabilitybidcapacitychangecostcostscurrentdemanddevelopingdirectdistributionelectricalenergyfinancinggrowthhistoryinstallationinstallations
SHARED TOKENS (45): "additional", "applications", "availability", "bid", "capacity", "change", "cost", "costs", "current", "demand", "developing", "direct", "distribution", "electrical", "energy", "financing", "growth", "history", "installation", "installations"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycanalsconservationcrossdifferentestatefacilityfullgroundlandlegallineslocalmainmeanoperateownerownershipphysicalprivate
SHARED TOKENS (31): "authority", "canals", "conservation", "cross", "different", "estate", "facility", "full", "ground", "land", "legal", "lines", "local", "main", "mean", "operate", "owner", "ownership", "physical", "private"....
0.300
apprenticeshipapproximatelyassociationcommitteeconstructioncontractorscostdatadeliverelectricalfieldsinsideinstallinstallerslabornationalprogramspublicrelatedrepresents
SHARED TOKENS (25): "apprenticeship", "approximately", "association", "committee", "construction", "contractors", "cost", "data", "deliver", "electrical", "fields", "inside", "install", "installers", "labor", "national", "programs", "public", "related", "represents"....
0.300
additionalbuildingconservationcurrentdepartmentdevelopmentdirectlydirectsenergyfederalnationalphysicalpolicypowerproductionprogramprojectregulatingresearchserved
SHARED TOKENS (21): "additional", "building", "conservation", "current", "department", "development", "directly", "directs", "energy", "federal", "national", "physical", "policy", "power", "production", "program", "project", "regulating", "research", "served"....
0.300
allowingchangescommercialcontrolledcurrentdifferentdirecteconomyflowformindependentlyinstallationslinesnetworkpowerrapidrequiresourcesouthsystem
SHARED TOKENS (24): "allowing", "changes", "commercial", "controlled", "current", "different", "direct", "economy", "flow", "form", "independently", "installations", "lines", "network", "power", "rapid", "require", "source", "south", "system"....
0.300
becomebillionbuiltconnectedconnectingconsumerscurrentdeliverydistributionelectricalenergylargemarketsmillionneedneedednetworkoperatepopulationpower
SHARED TOKENS (24): "become", "billion", "built", "connected", "connecting", "consumers", "current", "delivery", "distribution", "electrical", "energy", "large", "markets", "million", "need", "needed", "network", "operate", "population", "power"....
0.300
anotherapplicationscapacityconsumercostdemanddevelopmentdifferentdischargeenergyenvironmentalfireformgenerallylargemainmaterialspowerproductionrate
SHARED TOKENS (26): "another", "applications", "capacity", "consumer", "cost", "demand", "development", "different", "discharge", "energy", "environmental", "fire", "form", "generally", "large", "main", "materials", "power", "production", "rate"....
0.300
affectsagriculturalagriculturebecomebuildingcategorychangesconstructioncontrolcontrollingdifferentdrainageflowgenerallylandlandslargelocalmakingmanagement
SHARED TOKENS (37): "affects", "agricultural", "agriculture", "become", "building", "category", "changes", "construction", "control", "controlling", "different", "drainage", "flow", "generally", "land", "lands", "large", "local", "making", "management"....
0.300
actadministersassociatedauthorizationdevelopmentdivisionengineersenvironmentalfloodindexinfrastructurenationalnetpdfprotectionpublicrequirementsresourcesstructural
SHARED TOKENS (19): "act", "administers", "associated", "authorization", "development", "division", "engineers", "environmental", "flood", "index", "infrastructure", "national", "net", "pdf", "protection", "public", "requirements", "resources", "structural".
0.300
additionalaquifercommercialcomponentsconnectionsconsumersdevelopingdistributiondownstreamdrainagedrinkingfacilitiesfireflowgenerallygroundgroundwaterhydrologicindustrialinstitution
SHARED TOKENS (45): "additional", "aquifer", "commercial", "components", "connections", "consumers", "developing", "distribution", "downstream", "drainage", "drinking", "facilities", "fire", "flow", "generally", "ground", "groundwater", "hydrologic", "industrial", "institution"....
0.300
Aquifer test ↗ Q446124 KW CROSS HIGH
applyaquiferaquifersaroundboundarieschangecharacteristicsdataengineeringflowincreasemodelmonitoringpointpropertiesrealresponseresultssimplysystem
SHARED TOKENS (21): "apply", "aquifer", "aquifers", "around", "boundaries", "change", "characteristics", "data", "engineering", "flow", "increase", "model", "monitoring", "point", "properties", "real", "response", "results", "simply", "system"....
0.300
amongassociationavailabilitybecomedevelopmentdistributionenergyincreaselimitednationalnaturalpowerrapidresourcesresultsupplies
SHARED TOKENS (16): "among", "association", "availability", "become", "development", "distribution", "energy", "increase", "limited", "national", "natural", "power", "rapid", "resources", "result", "supplies".
0.300
acquisitionacquisitionsactanotherassetsbusinesscapitalcentralconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesentityfederalgovernedlaw
SHARED TOKENS (41): "acquisition", "acquisitions", "act", "another", "assets", "business", "capital", "central", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "entity", "federal", "governed", "law"....
0.300
addressingappliesbeneficialcivilconstructioncontrolcreatedesigndisposalengineeringengineersenvironmentenvironmentalindustriallawlicensinglocalmaintainmanagementmunicipal
SHARED TOKENS (37): "addressing", "applies", "beneficial", "civil", "construction", "control", "create", "design", "disposal", "engineering", "engineers", "environment", "environmental", "industrial", "law", "licensing", "local", "maintain", "management", "municipal"....
0.300
businessescapacitycenturychangechangesconsumerscostcustomerdemanddirectdirectlyeconomicenergyfullimplicationlargemanagementnetoperatepeak
SHARED TOKENS (33): "businesses", "capacity", "century", "change", "changes", "consumers", "cost", "customer", "demand", "direct", "directly", "economic", "energy", "full", "implication", "large", "management", "net", "operate", "peak"....
0.300
Agriculture in Idaho ↗ KW CROSS HIGH
acresagriculturalagriculturedifferenteconomyfarmsfoodidaholandmillionproducesproductionrepresentsrolesector
SHARED TOKENS (15): "acres", "agricultural", "agriculture", "different", "economy", "farms", "food", "idaho", "land", "million", "produces", "production", "represents", "role", "sector".
0.300
Energy conservation ↗ KW CROSS HIGH
affectanothercomponentsconservationconvertcosteconomicenergyengineeringenvironmentalfootprintformgrowthheatingidentifylargemaintenancemonitoringoperationspractices
SHARED TOKENS (27): "affect", "another", "components", "conservation", "convert", "cost", "economic", "energy", "engineering", "environmental", "footprint", "form", "growth", "heating", "identify", "large", "maintenance", "monitoring", "operations", "practices"....
0.300
agricultureaquifersaroundassessmentsbillioncapacitycentralchangechangesconservationcurrentdemanddevelopmentdifferenteconomicenvironmentalexpandingexpansionexperienceflow
SHARED TOKENS (47): "agriculture", "aquifers", "around", "assessments", "billion", "capacity", "central", "change", "changes", "conservation", "current", "demand", "development", "different", "economic", "environmental", "expanding", "expansion", "experience", "flow"....
0.300
becomebusinesscentralcharacteristicscommercialcreatingdevelopmentfundhistoryindependentindividualinstitutionsissueorganizationsownersprojectprojectsprovidingriskshare
SHARED TOKENS (21): "become", "business", "central", "characteristics", "commercial", "creating", "development", "fund", "history", "independent", "individual", "institutions", "issue", "organizations", "owners", "project", "projects", "providing", "risk", "share"....
0.300
acresboisecenturycontainscontinueddistrictsfacilitieshomeidaholandmaintainmilesnationalpercentreachesrecreationreservoirsresourcesriverwest
SHARED TOKENS (20): "acres", "boise", "century", "contains", "continued", "districts", "facilities", "home", "idaho", "land", "maintain", "miles", "national", "percent", "reaches", "recreation", "reservoirs", "resources", "river", "west".
0.300
accountapproximatelycombinationdesigneddomesticfacilitiesfacilityinfrastructuremunicipalproducespropertypublicsepticservedsystemstreatmentwastewaterwestern
SHARED TOKENS (18): "account", "approximately", "combination", "designed", "domestic", "facilities", "facility", "infrastructure", "municipal", "produces", "property", "public", "septic", "served", "systems", "treatment", "wastewater", "western".
0.300
Solar inverter ↗ Q129316 KW CROSS HIGH
allowingcommercialcriticalcurrentdirectelectricalequipmentfunctionslocalnetworkordinarypointpowerprotectionsystemutility
SHARED TOKENS (16): "allowing", "commercial", "critical", "current", "direct", "electrical", "equipment", "functions", "local", "network", "ordinary", "point", "power", "protection", "system", "utility".
0.300
amongbendcapacitycommunityemploymentenergyfarmsincreasinglyindividualinstallationslocalmilesobtainoverviewpercentplanspowerprojectrequiringresearch
SHARED TOKENS (28): "among", "bend", "capacity", "community", "employment", "energy", "farms", "increasingly", "individual", "installations", "local", "miles", "obtain", "overview", "percent", "plans", "power", "project", "requiring", "research"....
0.300
changedeliverydemanddirectlydistributionelectricalenergyfieldsforecastgeothermalgrowthincreasingmeanspeakpowerprimaryprocessproductionproposedreported
SHARED TOKENS (24): "change", "delivery", "demand", "directly", "distribution", "electrical", "energy", "fields", "forecast", "geothermal", "growth", "increasing", "means", "peak", "power", "primary", "process", "production", "proposed", "reported"....
0.300
affectagricultureanalysisapplicationaquiferaquifersboundarycharacteristicsconstituentcontaminantdifferentedgegroundgroundwaterinteractionlandmakingmanagementmeansmechanisms
SHARED TOKENS (39): "affect", "agriculture", "analysis", "application", "aquifer", "aquifers", "boundary", "characteristics", "constituent", "contaminant", "different", "edge", "ground", "groundwater", "interaction", "land", "making", "management", "means", "mechanisms"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeagriculturalappropriatebusinesscenturycharacteristicscommercialconservationdatefacilitiesgenerallygrowthhomeincreasingindependentlargemaintainsmaterialsnationalplanning
SHARED TOKENS (32): "active", "agricultural", "appropriate", "business", "century", "characteristics", "commercial", "conservation", "date", "facilities", "generally", "growth", "home", "increasing", "independent", "large", "maintains", "materials", "national", "planning"....
0.300
connectsconsumerscurrentdeliverydirectdirectlydistinctdistributioneasternelectricalenergyevenformincreaselevellineslocalmajormarketnetwork
SHARED TOKENS (27): "connects", "consumers", "current", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "electrical", "energy", "even", "form", "increase", "level", "lines", "local", "major", "market", "network"....
0.300
accordingadministrationboisebuiltcanyoncapacitycontainscontractordamdrainageenergyfinalidahoinformationleveloperatedownedpowerprivatelyproject
SHARED TOKENS (25): "according", "administration", "boise", "built", "canyon", "capacity", "contains", "contractor", "dam", "drainage", "energy", "final", "idaho", "information", "level", "operated", "owned", "power", "privately", "project"....
0.300
Water table ↗ Q3342272 KW CROSS HIGH
actualaquiferaquifersdepositsflowgroundgroundwaterincreasinglayerslevelmaterialsprecipitationpressuresimplysubsurfacesurface
SHARED TOKENS (16): "actual", "aquifer", "aquifers", "deposits", "flow", "ground", "groundwater", "increasing", "layers", "level", "materials", "precipitation", "pressure", "simply", "subsurface", "surface".
0.300
actaddressesaddressingagenciesagreementagreementsassessmentsbiologicalcenturychangecleancomplianceconcerningconservationcontroldesigneddevelopmenteconomicenergyenforcement
SHARED TOKENS (44): "act", "addresses", "addressing", "agencies", "agreement", "agreements", "assessments", "biological", "century", "change", "clean", "compliance", "concerning", "conservation", "control", "designed", "development", "economic", "energy", "enforcement"....
0.300
Off-the-grid ↗ Q267162 KW CROSS HIGH
buildingcannotconnectedcostdesignedelectricalenergyenvironmentalfoodgenerallyindependentisolateditselfpotablepublicreduceresidentialsewersupplysystems
SHARED TOKENS (23): "building", "cannot", "connected", "cost", "designed", "electrical", "energy", "environmental", "food", "generally", "independent", "isolated", "itself", "potable", "public", "reduce", "residential", "sewer", "supply", "systems"....
0.300
accordingassociatedbuildingcapabilitycodecodescontrolcurrentdesigndesigneddistributionelectricalenvironmentalfireinstallationlargelocalmodelnationaloperating
SHARED TOKENS (31): "according", "associated", "building", "capability", "code", "codes", "control", "current", "design", "designed", "distribution", "electrical", "environmental", "fire", "installation", "large", "local", "model", "national", "operating"....
0.300
Sewage treatment ↗ KW CROSS HIGH
accountadvancedapplicationapproximatelyaroundavailabilitybiologicalbusinessesconnectedconstructioncontainscostsdemanddesigndevelopingdifferentdischargedrainageenergyengineers
SHARED TOKENS (59): "account", "advanced", "application", "approximately", "around", "availability", "biological", "businesses", "connected", "construction", "contains", "costs", "demand", "design", "developing", "different", "discharge", "drainage", "energy", "engineers"....
0.300
actagenciesapplyaroundassessmentsauthoritydecisionsdesignedenvironmentenvironmentalfederalfinaljanuarylawnationalpolicypotentialpreserveproposedquality
SHARED TOKENS (25): "act", "agencies", "apply", "around", "assessments", "authority", "decisions", "designed", "environment", "environmental", "federal", "final", "january", "law", "national", "policy", "potential", "preserve", "proposed", "quality"....
0.300
actaffectagriculturalanotherapplicationsbeneficialchangecommercialconservationcurrentdemanddevelopmentfuturegrowthinvolvedirrigationlevellocalmakesmanagement
SHARED TOKENS (35): "act", "affect", "agricultural", "another", "applications", "beneficial", "change", "commercial", "conservation", "current", "demand", "development", "future", "growth", "involved", "irrigation", "level", "local", "makes", "management"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
applyappropriateapprovedauthoritybecomesbuildingchargescodecodescomplianceconstructioncontroldepartmentsdesigndevelopersdistrictelectricalengineersenvironmentalestate
SHARED TOKENS (49): "apply", "appropriate", "approved", "authority", "becomes", "building", "charges", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "district", "electrical", "engineers", "environmental", "estate"....
0.300
buildingcontrolcostsdesigndesignedelectricalenergyengineersenvironmentalheatingmaintenancemodelingoperatingperformanceplumbingprojectsprovidepumpqualityregulate
SHARED TOKENS (21): "building", "control", "costs", "design", "designed", "electrical", "energy", "engineers", "environmental", "heating", "maintenance", "modeling", "operating", "performance", "plumbing", "projects", "provide", "pump", "quality", "regulate"....
0.300
actualchangechangescontrolcontrolledcontrolsdownstreamequipmentflowintendedlevelmaintainmaintainsmechanismmechanismspressureprovidereducingregulatedresponse
SHARED TOKENS (23): "actual", "change", "changes", "control", "controlled", "controls", "downstream", "equipment", "flow", "intended", "level", "maintain", "maintains", "mechanism", "mechanisms", "pressure", "provide", "reducing", "regulated", "response"....
0.300
actactiveadministeredagenciesapproximatelyauthoritybillionbuildingbusinesscanalscapacitycivilcleancomponentsconstructioncontroldeliverdepartmentdesigndirect
SHARED TOKENS (70): "act", "active", "administered", "agencies", "approximately", "authority", "billion", "building", "business", "canals", "capacity", "civil", "clean", "components", "construction", "control", "deliver", "department", "design", "direct"....
0.300
conservationdesignedeconomyelectricalenergynetperformancepotentialpowerprocessproducespurposereducingsourcetransportationvisiblework
SHARED TOKENS (17): "conservation", "designed", "economy", "electrical", "energy", "net", "performance", "potential", "power", "process", "produces", "purpose", "reducing", "source", "transportation", "visible", "work".
0.300
adabendboisecentralconnectedcontainseasternidahoitselfmetropolitannationalpopulationranchrecreationruralvalleywestern
SHARED TOKENS (17): "ada", "bend", "boise", "central", "connected", "contains", "eastern", "idaho", "itself", "metropolitan", "national", "population", "ranch", "recreation", "rural", "valley", "western".
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalallowinganotherapplicationscanalcanalscriticalcustomerdemanddesigndesigneddevelopmentdifferentdrainageenergyenvironmentalequipmentfacilitiesfootprintimportance
SHARED TOKENS (47): "agricultural", "allowing", "another", "applications", "canal", "canals", "critical", "customer", "demand", "design", "designed", "development", "different", "drainage", "energy", "environmental", "equipment", "facilities", "footprint", "importance"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationcenturyconnectdevelopmenteasementsevenfeefinalfullfunctionslandlegalmunicipalitiesobtainownerownersownershippower
SHARED TOKENS (33): "acquisition", "another", "application", "century", "connect", "development", "easements", "even", "fee", "final", "full", "functions", "land", "legal", "municipalities", "obtain", "owner", "owners", "ownership", "power"....
0.300
addressingaffectagriculturalagriculturecentralchangechangesdevelopmentdirectdischargedownstreamdrinkingeconomicenvironmentenvironmentalfieldsfoodgroundwaterlandlarge
SHARED TOKENS (35): "addressing", "affect", "agricultural", "agriculture", "central", "change", "changes", "development", "direct", "discharge", "downstream", "drinking", "economic", "environment", "environmental", "fields", "food", "groundwater", "land", "large"....
0.300
anotherbecomesbeyondcapacitychangeconnectedcostdemandeconomicelectricalenergyexperienceflowformlargemakingmanagementneedneededpower
SHARED TOKENS (26): "another", "becomes", "beyond", "capacity", "change", "connected", "cost", "demand", "economic", "electrical", "energy", "experience", "flow", "form", "large", "making", "management", "need", "needed", "power"....
0.300
Solar power ↗ Q1483757 KW CROSS HIGH
applicationsbuiltcapacitychangecommercialcontinuingconvertcostcurrentdirectlyenergyfinancinginstallationslargemitigationneededpolicypowerprimaryproduces
SHARED TOKENS (28): "applications", "built", "capacity", "change", "commercial", "continuing", "convert", "cost", "current", "directly", "energy", "financing", "installations", "large", "mitigation", "needed", "policy", "power", "primary", "produces"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancingfirmfirmsfundlimitedlong-termmanagementoperationalownershipprivate
SHARED TOKENS (27): "active", "business", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financing", "firm", "firms", "fund", "limited", "long-term", "management", "operational", "ownership", "private"....
0.300
Maize ↗ Q11575 KW CROSS HIGH
alongsideannualbecomebecomesbillioncommercialcontainsfoodmainmajorproducesproductionsouthernthroughouttreatmentuses
SHARED TOKENS (16): "alongside", "annual", "become", "becomes", "billion", "commercial", "contains", "food", "main", "major", "produces", "production", "southern", "throughout", "treatment", "uses".
0.300
addressagreementsalonealteramongaquifersassociatedavailabilitybecomebecomeschangescontrolcorporatecrosseconomicgroundwaterhistoryindividualinstitutionsirrigation
SHARED TOKENS (46): "address", "agreements", "alone", "alter", "among", "aquifers", "associated", "availability", "become", "becomes", "changes", "control", "corporate", "cross", "economic", "groundwater", "history", "individual", "institutions", "irrigation"....
0.300
accordingauthoritybecomesbusinesscapitalcommunityconsumercostcustomerdeliveryenergyformformedfundgovernedgrowthindividualinfrastructurelargelocal
SHARED TOKENS (39): "according", "authority", "becomes", "business", "capital", "community", "consumer", "cost", "customer", "delivery", "energy", "form", "formed", "fund", "governed", "growth", "individual", "infrastructure", "large", "local"....
0.300
commercialconnectconnectedconsumerscustomerdeliverydirectlydistributesdistributionequipmentfinalfunctionsgroundindividualindustriallevellinespowerprimaryresidential
SHARED TOKENS (26): "commercial", "connect", "connected", "consumers", "customer", "delivery", "directly", "distributes", "distribution", "equipment", "final", "functions", "ground", "individual", "industrial", "level", "lines", "power", "primary", "residential"....
0.300
actapprovalapprovedbuildingcommercialconstructioncontractorscostscreatesdesigndeterminedeveloperdevelopersdevelopmentdifferenteconomicengineersenvironmentalestateexisting
SHARED TOKENS (44): "act", "approval", "approved", "building", "commercial", "construction", "contractors", "costs", "creates", "design", "determine", "developer", "developers", "development", "different", "economic", "engineers", "environmental", "estate", "existing"....
0.300
activearoundcapacityconnectioncontrolcostcostscustomerdeliverdeliveriesdemanddesignedelectricalenergyevenfacilityformfullgenerallygroup
SHARED TOKENS (39): "active", "around", "capacity", "connection", "control", "cost", "costs", "customer", "deliver", "deliveries", "demand", "designed", "electrical", "energy", "even", "facility", "form", "full", "generally", "group"....
🫐 BERRY39 edges
0.280
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturaldivisiondrainageidahomajormilesnationalrecreationriversnakesouthsquarevalleywest
SHARED TOKENS (14): "agricultural", "division", "drainage", "idaho", "major", "miles", "national", "recreation", "river", "snake", "south", "square", "valley", "west".
0.280
Sugar beet ↗ Q151964 EXACT TITLE
containsgroupmillionproduction
SHARED TOKENS (4): "contains", "group", "million", "production". | EXACT TITLE in water_rights: "Sugar beet".
0.280
Power station ↗ Q159719 KW CROSS HIGH
connectedcreatescurrentelectricalenergyfacilitygenerallygeothermalindustrialnaturalpowersourcestationstations
SHARED TOKENS (14): "connected", "creates", "current", "electrical", "energy", "facility", "generally", "geothermal", "industrial", "natural", "power", "source", "station", "stations".
0.280
distributiondrainslinesmainsmajornationalnaturalprocesspublicstormstreetundergroundutilitywastewater
SHARED TOKENS (14): "distribution", "drains", "lines", "mains", "major", "national", "natural", "process", "public", "storm", "street", "underground", "utility", "wastewater".
0.280
currentdatadepartmentfederalmajormakesnaturalpublicregulatoryresearchresourcesresponsibilitystudywork
SHARED TOKENS (14): "current", "data", "department", "federal", "major", "makes", "natural", "public", "regulatory", "research", "resources", "responsibility", "study", "work".
0.260
associationidahointegrated
SHARED TOKENS (3): "association", "idaho", "integrated". | EXACT TITLE in water_rights: "Idaho State Bar".
0.260
demanddistributionfireflowmainpipepotablepressureprotectstoragesuppliessystemsystems
SHARED TOKENS (13): "demand", "distribution", "fire", "flow", "main", "pipe", "potable", "pressure", "protect", "storage", "supplies", "system", "systems".
0.260
disposaldiversionfacilitymanagementmaterialsmunicipalpointprocessprogramsolidtransfertreatmentwaste
SHARED TOKENS (13): "disposal", "diversion", "facility", "management", "materials", "municipal", "point", "process", "program", "solid", "transfer", "treatment", "waste".
0.240
aroundbureaucontainslandsmajornorthwestriversouthsouthernsouthwestwestwestern
SHARED TOKENS (12): "around", "bureau", "contains", "lands", "major", "northwest", "river", "south", "southern", "southwest", "west", "western".
0.240
codedisposalfoodmunicipalmunicipalitiesmunicipalitypublicroleseparatelysolidunionwaste
SHARED TOKENS (12): "code", "disposal", "food", "municipal", "municipalities", "municipality", "public", "role", "separately", "solid", "union", "waste".
0.220
allowingburieddesigneddirectlyirrigationnetworkoperatedpotentialsurfacesystemsystems
SHARED TOKENS (11): "allowing", "buried", "designed", "directly", "irrigation", "network", "operated", "potential", "surface", "system", "systems".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
aroundsouth
SHARED TOKENS (2): "around", "south". | EXACT TITLE in water_rights: "Alfalfa".
0.220
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
behindboisecaldwellcanyoneasternidahometropolitannampapopulationruralwestern
SHARED TOKENS (11): "behind", "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "nampa", "population", "rural", "western".
0.220
actchaptercodedevelopmentfederallawpowerprojectspurposeregulationtitle
SHARED TOKENS (11): "act", "chapter", "code", "development", "federal", "law", "power", "projects", "purpose", "regulation", "title".
0.220
agricultureconstructioncontrolcontrollingcontrolsdevelopmenthabitatlandpropertyriversurface
SHARED TOKENS (11): "agriculture", "construction", "control", "controlling", "controls", "development", "habitat", "land", "property", "river", "surface".
0.220
announcedauthorizationdepartmentdevelopmentenergyhomenationaloperatedresearchsystemstransportation
SHARED TOKENS (11): "announced", "authorization", "department", "development", "energy", "home", "national", "operated", "research", "systems", "transportation".
0.220
capacitycategoriesdistributionelectricallinesneededpowerstationsstructuresupportutility
SHARED TOKENS (11): "capacity", "categories", "distribution", "electrical", "lines", "needed", "power", "stations", "structure", "support", "utility".
0.220
aroundbeneficialcreatingequipmentfieldsformedirrigatedirrigationlandlargesystems
SHARED TOKENS (11): "around", "beneficial", "creating", "equipment", "fields", "formed", "irrigated", "irrigation", "land", "large", "systems".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in energy_utilities: "Subdivision". | EXACT TITLE in water_rights: "Subdivision".
0.200
suez
EXACT TITLE in energy_utilities: "Suez (disambiguation)".
0.200
distributionfloodformirrigationmanagementpracticessurfacethereforethousandsthroughout
SHARED TOKENS (10): "distribution", "flood", "form", "irrigation", "management", "practices", "surface", "therefore", "thousands", "throughout".
0.200
amongeasternlandlaworganizedownershippropertyrightssimplysystem
SHARED TOKENS (10): "among", "eastern", "land", "law", "organized", "ownership", "property", "rights", "simply", "system".
0.200
Abandon ↗ Q397584 EXACT TITLE
EXACT TITLE in water_rights: "Abandon".
0.200
agriculturalbigidaholandmajormilesnorthwestriversnakesouthern
SHARED TOKENS (10): "agricultural", "big", "idaho", "land", "major", "miles", "northwest", "river", "snake", "southern".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
EXACT TITLE in water_rights: "Forfeit".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyoncenturydistrictidahometropolitanpopulationschoolswest
SHARED TOKENS (10): "ada", "boise", "canyon", "century", "district", "idaho", "metropolitan", "population", "schools", "west".
0.200
controldistinctgoverninglawownershippropertyqualityrelatedresourceresources
SHARED TOKENS (10): "control", "distinct", "governing", "law", "ownership", "property", "quality", "related", "resource", "resources".
0.200
Lateral canal ↗ Q6495566 KW CROSS HIGH
anotherbuiltcanalcanalsexistingfloodnaturalprovideright-of-wayriver
SHARED TOKENS (10): "another", "built", "canal", "canals", "existing", "flood", "natural", "provide", "right-of-way", "river".
0.200
Watershed ↗ Q4018542 EXACT TITLE
watershed
EXACT TITLE in energy_utilities: "Watershed".
0.160
environmentlocalmaterialsmillionnationalproducesregulatedwaste
SHARED TOKENS (8): "environment", "local", "materials", "million", "national", "produces", "regulated", "waste".
0.160
associatedexaminationhistoryidahonorthwestsouthernwestwestern
SHARED TOKENS (8): "associated", "examination", "history", "idaho", "northwest", "southern", "west", "western".
0.140
foodidahomakingpopulationregionsourcesouthern
SHARED TOKENS (7): "food", "idaho", "making", "population", "region", "source", "southern".
0.140
conservationdemandenvironmentalgroundwaterphysicalsuppliessurface
SHARED TOKENS (7): "conservation", "demand", "environmental", "groundwater", "physical", "supplies", "surface".
0.140
continuingdepartmentfederalmanagementnaturalprotectworking
SHARED TOKENS (7): "continuing", "department", "federal", "management", "natural", "protect", "working".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
linesownershipprivatepropertypublicresources
SHARED TOKENS (6): "lines", "ownership", "private", "property", "public", "resources".
0.100
managementstationtransfertransportationwaste
SHARED TOKENS (5): "management", "station", "transfer", "transportation", "waste".
0.100
processpublicregulatoryutilitiesutility
SHARED TOKENS (5): "process", "public", "regulatory", "utilities", "utility".
0.100
finalidahoorganizedterritoryunion
SHARED TOKENS (5): "final", "idaho", "organized", "territory", "union".
◈ Frequently Asked Questions
Energy Utilities × Water Rights — Treasure Valley
HAIKU · HIGH GATE
How do hydroelectric dams like Arrowrock Dam and Lucky Peak Dam generate power while managing water rights in the Treasure Valley?
Arrowrock Dam and Lucky Peak Dam store Snake River water for irrigation under the Newlands Reclamation Act while simultaneously generating hydroelectric power through water discharge. The Bureau of Reclamation operates these facilities to balance electricity generation with surface water allocation to senior water rights holders across the Treasure Valley's irrigation districts.
Why do energy utilities in the Treasure Valley need to consider groundwater aquifers when planning power generation?
Groundwater from Snake River aquifers supplies industrial water demands for power plants and cooling systems throughout Boise and the surrounding region. Energy utilities must account for existing water rights claims on these aquifers, which compete with municipal water treatment systems and agricultural irrigation in the Treasure Valley.
What role does the Bureau of Reclamation play in coordinating dam operations with water rights distribution in Idaho's Treasure Valley?
The Bureau of Reclamation manages Lucky Peak Dam and Arrowrock Dam to store and release Snake River water according to the Newlands Reclamation Act while ensuring water rights holders receive allocated supplies. Their dam operations determine both the volume available for hydroelectric generation and the timing of surface water delivery to irrigation systems across the Treasure Valley.
How do geothermal energy operations in the Treasure Valley interact with local groundwater rights?
Geothermal energy facilities extract heat from Snake River basin aquifers, requiring water rights permits that compete with municipal well systems and agricultural groundwater claims. The Treasure Valley's growing population increases demand on both geothermal resources and traditional groundwater supplies, intensifying conflicts over aquifer allocation between energy utilities and irrigation districts.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Energy Utilities × Water Rights 47 QID bridges 239 edges 6,028 ext links 2026-07-17 20:42:41 UTC a742ba18d8077c7d
Energy Utilities corridor ↗ Water Rights corridor ↗ Water Rights × Energy Utilities ↗ boisestandard.org/standard ↗
Parent Corridors
Energy Utilities × All Other Verticals