—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Energy Utilities ↔ relates to ↔ Transportation Infrastructure

19 Wikipedia bridge articles confirmed in both vertical ledgers. 253 deterministic cross-vertical edges. 6,652 external source links harvested. Every edge provenance-stamped. Every claim auditable.

19 QID Bridge Articles
253 Cross Edges
6,652 External Sources
284 Wikipedia Articles
25 🌲 Evergreen
193 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Energy Utilities
× Transportation Infrastructure
QID Bridge Articles
19
confirmed Wikipedia overlap
Total Cross Edges
253
External Sources Harvested
6,652
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Infrastructure
score: 1.0000  ·  type: exact_title_cross  ·  45 shared tokens
QID Bridge Titles (19)
InfrastructureTreasure ValleyApprenticeshipPublic worksSnake RiverBoise State UniversityClean Water ActCivil engineeringCollege of Western IdahoNampa, IdahoUnited States Environmental Protection AgencyElectric power transmissionBoise, IdahoAda County, IdahoCaldwell, IdahoKuna, IdahoCanyon County, IdahoMeridian, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationpublicmetropolitanadaprivateprogramswesterncanyonmilesenvironmentalphysicalroadseasternlocalvalleylevelcapitalworks
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:42:23 UTC
Content Hash
a3031177f282ea04
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
19 BRIDGES
Infrastructure
Q121359 EXACT TITLE 1.000
QID OVERLAP: Q121359 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (45): "agencies", "community", "components", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "facilities", "firms", "function", "goal", "industrial", "industry", "infrastructure".... | EXACT TITLE in energy_utilities: "Infrastructure". | EXACT TITLE in transportation_infrastructure: "Infrastructure".
agenciescommunitycomponentsdevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentenvironmentalfacilitiesfirmsfunctiongoalindustrialindustryinfrastructureinstitutionsinternationallawmanagementneededofficialparksphysicalpolicyprivate+15
at maintain the economic, health, social, environmental, and cultural standards of a place. This includes educational programs, official statistics, parks and recreational facilities, law enforcement agencies, and emergency services. Classifications A 1987 US National Research Council panel adopted the term "public works infrastructure", referring to: "... both specific functional modes – highways, streets, roads, and bridges; mass transit; airports and airways; water supply and water resources; wastewater management; solid-waste treatment and disposal; electric power generation and transmission; telecommunications; and hazardous waste management – and the combined system these modal elements comprise.
Transport infrastructure – vehicles, road, rail, cable and financing of transport Aviation infrastructure – air traffic control technology in aviation Rail transport – trackage, signals, electrification of rails Road transport – roads, bridges, tunnels Critical infrastructure – assets required to sustain human life Energy infrastructure – transmission and storage of fossil fuels and renewable sources Information and communication infrastructure – systems of information storage and distribution Public capital – government-owned assets Public works – municipal infrastructure, maintenance functions and agencies Municipal solid waste – generation, collection, management of trash/garbage Sustainable urban infrastructure – technology, architecture, policy for sustainable living Water supply network – the distribution and maintenance of water supply Wastewater infrastructure – disposal and treatment of wastewater Infrastructure-based development
Civil defense planners and developmental economists generally refer to both hard and soft infrastructure, including public services such as schools and hospitals, emergency services such as police and fire fighting, and basic services in the economic sector. The notion of infrastructure-based development combining long-term infrastructure investments by government agencies at central and regional levels with public private partnerships has proven popular among economists in Asia (notably Singapore and China), mainland Europe, and Latin America. Military Military infrastructure is the buildings and permanent installations necessary for the support of military forces, whether they are stationed in bases, being deployed or engaged in operations.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "metropolitan", "name", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in energy_utilities: "Treasure Valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalmetropolitannameregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (22): "apprenticeship", "apprenticeships", "boundaries", "certification", "competence", "complete", "concept", "continued", "field", "formal", "labor", "level", "license", "placement", "potential", "professional", "reach", "regulated", "study", "system".... | EXACT TITLE in energy_utilities: "Apprenticeship". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
apprenticeshipapprenticeshipsboundariescertificationcompetencecompleteconceptcontinuedfieldformallaborlevellicenseplacementpotentialprofessionalreachregulatedstudysystemtrainingvary
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Public works
Q627364 EXACT TITLE 1.000
QID OVERLAP: Q627364 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (37): "assets", "broader", "buildings", "canals", "capital", "category", "community", "constructed", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "habitat", "hospitals", "infrastructure", "long-term", "municipal".... | EXACT TITLE in energy_utilities: "Public works". | EXACT TITLE in transportation_infrastructure: "Public works".
assetsbroaderbuildingscanalscapitalcategorycommunityconstructedconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitieshabitathospitalsinfrastructurelong-termmunicipaloperatorparksphysicalpipelinesprivateprojectspublicreductionroadssafety+7
and treatment), public spaces (beaches, parks, and public squares), transport infrastructure (airports, bridges, canals, pipelines, ports, railroads, and roads) and other, usually long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
y long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
eater community. They include environmental protection (drinking water protection, preservation and restoration of forests and wetlands, soil erosion reduction, wildlife habitat preservation), public buildings (hospitals, municipal buildings, and schools), public services (dams, electrical grid, sewage treatment, and water supply and treatment), public spaces (beaches, parks, and public squares), transport infrastructure (airports, bridges, canals, pipelines, ports, railroads, and roads) and other, usually long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (46): "agencies", "american", "canyon", "central", "commercial", "constructed", "construction", "control", "downstream", "drains", "eastern", "eventual", "falls", "farmland", "flood", "governments", "habitat", "history", "idaho", "irrigation".... | EXACT TITLE in energy_utilities: "Snake River".
agenciesamericancanyoncentralcommercialconstructedconstructioncontroldownstreamdrainseasterneventualfallsfarmlandfloodgovernmentshabitathistoryidahoirrigationlakelargelimitedmagicmajormilesnationalnearnorthwestpolicy+16
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Populations of anadromous fish began to decline in the late 1800s due to the impact of commercial fishing, logging, mining and agriculture, but even in the 1930s, returning fall chinook alone numbered 500,000. Populations further collapsed once dams were built on the lower Snake and Columbia Rivers, and Hells Canyon Dam blocked access to the upper Snake. Wild Snake River spring and summer chinook returns declined from 130,000 in the 1950s to less than 5,000 in the 1990s. Wild steelhead returns followed a similar pattern, falling from 110,000 in the 1960s to less than 10,000 in the 1990s. Spring, summer and fall-run chinook were all listed as threatened in 1992. Snake River steelhead were also listed as threatened in 1997. Wild chinook salmon and steelhead continued to decline into the 1990s, but have begun an unsteady recovery since 2000, with both chinook and steelhead returns up to 20,000–30,000 in some years. Coho salmon had disappeared from the Snake River by the 1980s, they were reintroduced to the watershed in 1995. Snake River sockeye once numbered to up 150,000 adults. Between 24,000 and 30,000 sockeye returned to Wallowa Lake in the Grande Ronde River watershed, but the run was eliminated by 1905 due to overharvest and unscreened irrigation diversions. The Payette Lake population once numbering up to 100,000 was blocked by the Black Canyon Dam in 1924. Sockeye in the Yellowbelly, Stanley, and Pettit Lakes of the Sawtooth basin were eradicated by management actions of the Idaho Department of Fish and Game in the 1950s, and irrigation diversions lead to the extirpation of the Pettit Lake population. Snake River sockeye returns declined to 4,500 in the 1950s and only a few dozen by the late 1960s. Snake River sockeye were listed as endangered in 1991. Numerous hatcheries are operated by agencies such as the Army Corps, Idaho Power, the Bonneville Power Administration, the U.S. Bureau of Indian Affairs and the U.S. Fish and Wildlife Service, to supplement wild fish populations. Hatcheries release about 33 million salmon and steelhead smolt into the Snake River watershed each year. However, the survival rate for hatchery fish is poor. Just 0.4 percent of hatchery chinook and 1.5 percent of hatchery steelhead returned as adults, as measured at Lower Granite Dam between 2007 and 2016. Upstream of the four lower dams, the Snake River watershed contains some of the best remaining spawning habitat in the Columbia River system, particularly along the Clearwater and Salmon Rivers; the latter is one of the longest undammed rivers in the continental US. A much depleted sockeye salmon run continues to spawn in Redfish Lake near Stanley, Idaho, more than 900 miles (1,400 km) inland from the Pacific Ocean.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (21): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "idaho", "independent", "million", "program", "programs", "public", "reported", "research", "school", "university".... | EXACT TITLE in energy_utilities: "Boise State University". | EXACT TITLE in transportation_infrastructure: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringidahoindependentmillionprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (34): "act", "addressing", "administered", "changes", "clean", "control", "coordination", "directly", "engineers", "environmental", "epa", "federal", "form", "funding", "governing", "governments", "improvement", "law", "major", "name".... | EXACT TITLE in energy_utilities: "Clean Water Act". | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
actaddressingadministeredchangescleancontrolcoordinationdirectlyengineersenvironmentalepafederalformfundinggoverninggovernmentsimprovementlawmajornameownedphysicalprimaryprovidingprovisionspubliclyqualityrecoveryresourcesafe+4
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Civil engineering
Q77590 EXACT TITLE 1.000
QID OVERLAP: Q77590 in energy_utilities (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (28): "agencies", "buildings", "built", "canals", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "pipelines".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
agenciesbuildingsbuiltcanalscivilcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsinfrastructurelocallymaintenancemunicipalnationalphysicalpipelinesprivateprofessionalpublicroadssectorstructuralsystemsworks
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
nstruction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Site development, also known as site planning, is focused on the planning and development potential of a site as well as addressing possible impacts from permitting issues and environmental challenges. Structural engineering Structural engineering is concerned with the structural design and structural analysis of buildings, bridges, towers, flyovers (overpasses), tunnels, off shore structures like oil and gas fields in the sea, aerostructure and other structures. This involves identifying the loads which act upon a structure and the forces and stresses which arise within that structure due to those loads, and then designing the structure to successfully support and resist those loads. The loads can be self weight of the structures, other dead load, live loads, moving (wheel) load, wind load, earthquake load, load from temperature change etc. The structural engineer must design structures to be safe for their users and to successfully fulfill the function they are designed for (to be serviceable). Due to the nature of some loading conditions, sub-disciplines within structural engineering have emerged, including wind engineering and earthquake engineering. Design considerations will include strength, stiffness, and stability of the structure when subjected to loads which may be static, such as furniture or self-weight, or dynamic, such as wind, seismic, crowd or vehicle loads, or transitory, such as temporary construction loads or impact.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (32): "ada", "board", "boise", "canyon", "classes", "college", "community", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in energy_utilities: "College of Western Idaho". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
adaboardboisecanyonclassescollegecommunitycountiescwidevelopmenteasterneducationgovernedidaholargenampapopulationprimaryprogramspublicreportedresidentsservedsouthweststudentstechnicalthroughouttransfertreasurevalley+2
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (18): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "miles", "name", "nampa", "northwest", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeaningmeridianmetropolitanmilesnamenampanorthwestpopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in energy_utilities (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (34): "approved", "department", "education", "energy", "enforcement", "engineers", "environmental", "epa", "executive", "federal", "financial", "governments", "independent", "information", "january", "legal", "level", "local", "measures", "monitoring"....
approveddepartmenteducationenergyenforcementengineersenvironmentalepaexecutivefederalfinancialgovernmentsindependentinformationjanuarylegallevellocalmeasuresmonitoringnationaloperationpermittingpowersprogramsproposedpublicrankregionalresearch+4
xon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Electric power transmission
Q200928 QID OVERLAP 0.800
QID OVERLAP: Q200928 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (36): "connects", "consumers", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "efficiency", "electric", "electrical", "electricity", "energy", "even", "form", "handling", "increase", "industry"....
connectsconsumerscurrentcustomersdeliverydirectdirectlydistinctdistributioneasternefficiencyelectricelectricalelectricityenergyevenformhandlingincreaseindustrylevellinelineslocallong-distancemajormarketmovementnetworkowned+6
lower currents and lower losses caused by such currents. The AC voltage level is often changed with transformers. A wide area synchronous grid, known as an interconnection in North America, directly connects generators delivering AC power with the same relative frequency to many consumers. North America has four major interconnections: Western, Eastern, Quebec and Texas.
erica, directly connects generators delivering AC power with the same relative frequency to many consumers. North America has four major interconnections: Western, Eastern, Quebec and Texas.
High-voltage direct current (HVDC) is used to transmit large amounts of power over long distances or for interconnections between asynchronous grids. When electrical energy is transmitted over very long distances, the power lost in AC transmission becomes appreciable and it is less expensive to use direct current instead. For a long transmission line, these lower losses (and reduced construction cost of a DC line) can offset the cost of the required converter stations at each end. HVDC is used for long submarine cables where AC cannot be used because of cable capacitance. In these cases special high-voltage cables are used. Submarine HVDC systems are often used to interconnect the electricity grids of islands, for example, between Great Britain and continental Europe, between Great Britain and Ireland, between Tasmania and the Australian mainland, between the North and South Islands of New Zealand, between New Jersey and New York City, and between New Jersey and Long Island. Submarine connections up to 600 kilometres (370 mi) in length have been deployed. HVDC links can be used to control grid problems. The power transmitted by an AC line increases as the phase angle between source end voltage and destination ends increases, but too large a phase angle allows the systems at either end to fall out of step. Since the power flow in a DC link is controlled independently of the phases of the AC networks that it connects, this phase angle limit does not exist, and a DC link is always able to transfer its full rated power. A DC link therefore stabilizes the AC grid at either end, since power flow and phase angle can then be controlled independently. As an example, to adjust the flow of AC power on a hypothetical line between Seattle and Boston would require adjustment of the relative phase of the two regional electrical grids. This is an everyday occurrence in AC systems, but one that can become disrupted when AC system components fail and place unexpected loads on the grid.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "counties", "downtown", "feet", "home", "idaho", "level", "locally", "major", "metropolitan", "miles", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownfeethomeidaholevellocallymajormetropolitanmilespopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in energy_utilities (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private", "roads".
adaboisecapitaldistricthomeidahojurisdictionlocalmetropolitannorthwestpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.680
QID OVERLAP: Q1515177 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (9): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "nearly", "percent", "population".
adaadditionalboiseidahokunametropolitannearlypercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.660
QID OVERLAP: Q1516870 in energy_utilities (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "ada", "boise", "downtown", "eagle", "idaho", "miles", "northwest", "population".
adaboisedowntowneagleidahomilesnorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
234 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP234 edges
🌲 EVERGREEN6 edges
0.650
acresadaapproximatelyboisecanalcanalscanyoncapacityfarmlandfeetidahoirrigationlakemilesmultipleriversystemtreasurevalleywater
SHARED TOKENS (21): "acres", "ada", "approximately", "boise", "canal", "canals", "canyon", "capacity", "farmland", "feet", "idaho", "irrigation", "lake", "miles", "multiple", "river", "system", "treasure", "valley", "water".... | URL->A (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in energy_utilities: "New York Canal".
0.650
commissioncustomerselectricitygasidahointermountainmunicipalitiesoperatedownedpowerprivatelyprovidepublicregulateregulatesutilitiesutilitywater
SHARED TOKENS (18): "commission", "customers", "electricity", "gas", "idaho", "intermountain", "municipalities", "operated", "owned", "power", "privately", "provide", "public", "regulate", "regulates", "utilities", "utility", "water". | URL->A (1): https://puc.idaho.gov/. | EXACT TITLE in energy_utilities: "Idaho Public Utilities Commission".
0.650
acquisitionboardcommissionconstructioneconomicfederalindependentindustryjurisdictionlinesoversightpipelinespowersrateregulationregulatoryrelevantservedservessubject
SHARED TOKENS (24): "acquisition", "board", "commission", "construction", "economic", "federal", "independent", "industry", "jurisdiction", "lines", "oversight", "pipelines", "powers", "rate", "regulation", "regulatory", "relevant", "served", "serves", "subject".... | URL->B (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationamericancommercialcostsefficiencyfederalfundfundingfundsgrantsimprovementlandlightingmanagedpercentplanningprogramprojectspublic
SHARED TOKENS (24): "acquisition", "administration", "american", "commercial", "costs", "efficiency", "federal", "fund", "funding", "funds", "grants", "improvement", "land", "lighting", "managed", "percent", "planning", "program", "projects", "public".... | URL->B (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesairamonganotherauthoritybaseboisecanyoncapacitycapitalcenterconceptconventionalcostcostscrossdemanddistrict
SHARED TOKENS (67): "ada", "additional", "agencies", "air", "among", "another", "authority", "base", "boise", "canyon", "capacity", "capital", "center", "concept", "conventional", "cost", "costs", "cross", "demand", "district".... | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.610
Electrician ↗ Q165029 EXACT TITLE
buildingscomponentsdataelectricalelectriciansequipmentexistinginfrastructureinstallationlinesmaintenanceplatformsrepair
SHARED TOKENS (13): "buildings", "components", "data", "electrical", "electricians", "equipment", "existing", "infrastructure", "installation", "lines", "maintenance", "platforms", "repair". | URL->A (1): http://www.bls.gov/ooh/construction-and-extraction/electricians.htm. | EXACT TITLE in energy_utilities: "Electrician". | EXACT TITLE in transportation_infrastructure: "Electrician".
🌿 BRANCH193 edges
0.510
creatingdepartmentenforcementidaholawmunicipalorganizationpublic
SHARED TOKENS (8): "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "public". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
Well ↗ Q43483 EXACT TITLE
anotherclassesconstructedconstructioncontainscreatedatedevelopingenvironmentalexcavationfallslakemethodneedsplacingpotentialproblemprovidereachrequire
SHARED TOKENS (30): "another", "classes", "constructed", "construction", "contains", "create", "date", "developing", "environmental", "excavation", "falls", "lake", "method", "needs", "placing", "potential", "problem", "provide", "reach", "require".... | EXACT TITLE in energy_utilities: "Well". | EXACT TITLE in transportation_infrastructure: "Well".
0.500
Tariff ↗ EXACT TITLE
accordingagainstamericanamongconsumerconsumersconsumptioncostsdesigneddistributedeconomiceconomyfallsformgrowthindustryintendedlocalmaterialsmeans
SHARED TOKENS (36): "according", "against", "american", "among", "consumer", "consumers", "consumption", "costs", "designed", "distributed", "economic", "economy", "falls", "form", "growth", "industry", "intended", "local", "materials", "means".... | EXACT TITLE in energy_utilities: "Tariff".
0.500
assetassociatedbuildingbuildingsbuiltconstructiondesigndevelopmenteconomiceventualfacilitiesfinancinghazardousindustrialindustryinfrastructuremaintenancepercentplanningprocess
SHARED TOKENS (21): "asset", "associated", "building", "buildings", "built", "construction", "design", "development", "economic", "eventual", "facilities", "financing", "hazardous", "industrial", "industry", "infrastructure", "maintenance", "percent", "planning", "process".... | EXACT TITLE in energy_utilities: "Construction". | EXACT TITLE in transportation_infrastructure: "Construction".
0.500
activitybillionconsumptiondependsdevelopingdirectlyenvironmentalfoodformmajorphysicalsafesuppliedwaterwork
SHARED TOKENS (15): "activity", "billion", "consumption", "depends", "developing", "directly", "environmental", "food", "form", "major", "physical", "safe", "supplied", "water", "work". | EXACT TITLE in energy_utilities: "Drinking water".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingcrossdesigneddrainageitselfnaturalneedperformanceplacingprocessrequirementsroadsshapestructuresurfacetrafficwater
SHARED TOKENS (17): "allowing", "cross", "designed", "drainage", "itself", "natural", "need", "performance", "placing", "process", "requirements", "roads", "shape", "structure", "surface", "traffic", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistinctdividedeasterneconomyidaholandmilesmillionnationalnorthwestofficialpopulationriver
SHARED TOKENS (32): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "divided", "eastern", "economy", "idaho", "land", "miles", "million", "national", "northwest", "official", "population", "river".... | EXACT TITLE in energy_utilities: "Idaho". | EXACT TITLE in transportation_infrastructure: "Idaho".
0.500
aircanyoncivilconstructionemergencyhomeidahoindustrialintegratedmunicipalnampanationalplanprivatepublicriversystemstraining
SHARED TOKENS (18): "air", "canyon", "civil", "construction", "emergency", "home", "idaho", "industrial", "integrated", "municipal", "nampa", "national", "plan", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
centralizedcollectioncommunitycomplexcomponentsconventionalcoordinateddifferentdistributeddistributiondistrictelectricelectricalelectricityenergyenvironmentalgasgenerationintegrationload
SHARED TOKENS (42): "centralized", "collection", "community", "complex", "components", "conventional", "coordinated", "different", "distributed", "distribution", "district", "electric", "electrical", "electricity", "energy", "environmental", "gas", "generation", "integration", "load".... | EXACT TITLE in energy_utilities: "Distributed generation".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagricultureannuallybecomebillioncapacitycentralcleancontainsdischargedistributionenvironmentalfieldformformationindustriallandlevelmajormovement
SHARED TOKENS (42): "agricultural", "agriculture", "annually", "become", "billion", "capacity", "central", "clean", "contains", "discharge", "distribution", "environmental", "field", "form", "formation", "industrial", "land", "level", "major", "movement".... | EXACT TITLE in energy_utilities: "Groundwater".
0.500
airapplicablebuildingcentercenterscommercialconsumerscoordinatededicateddeliverydemanddirectlydistributionequipmentfacilityfirmsfunctionhandlinglaborlarge
SHARED TOKENS (38): "air", "applicable", "building", "center", "centers", "commercial", "consumers", "coordinate", "dedicated", "delivery", "demand", "directly", "distribution", "equipment", "facility", "firms", "function", "handling", "labor", "large".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Natural gas ↗ Q40858 EXACT TITLE
accordingadoptionairalongsideassetschaincommercialconsumptiondemandelectricityenergyfeetgasindustryinfrastructurelong-termmajormeetnaturalpipelines
SHARED TOKENS (30): "according", "adoption", "air", "alongside", "assets", "chain", "commercial", "consumption", "demand", "electricity", "energy", "feet", "gas", "industry", "infrastructure", "long-term", "major", "meet", "natural", "pipelines".... | EXACT TITLE in energy_utilities: "Natural gas". | EXACT TITLE in transportation_infrastructure: "Natural gas".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingbuildingsdeterminedevelopmentdifferentformgoverngovernmentsgrowthindustriallandland-uselocalmethodmunicipalityplanningpolicypropertyregulatory
SHARED TOKENS (29): "allowing", "building", "buildings", "determine", "development", "different", "form", "govern", "governments", "growth", "industrial", "land", "land-use", "local", "method", "municipality", "planning", "policy", "property", "regulatory".... | EXACT TITLE in energy_utilities: "Zoning". | EXACT TITLE in transportation_infrastructure: "Zoning".
0.500
Pipeline ↗ Q25471856 EXACT TITLE
canalsconstructedconstructionconsumptiondesignenvironmentalevengasgenerationindustryirrigationlong-distancemarketmaterialsmilesmillionmovenaturalneedsnetwork
SHARED TOKENS (32): "canals", "constructed", "construction", "consumption", "design", "environmental", "even", "gas", "generation", "industry", "irrigation", "long-distance", "market", "materials", "miles", "million", "move", "natural", "needs", "network".... | EXACT TITLE in energy_utilities: "Pipeline". | EXACT TITLE in transportation_infrastructure: "Pipeline".
0.500
actcommitteescontinuingcooperativeexistingfederalformationfundingfundsfuturegovernedlawlocalmetropolitanorganizationparticipationplanningplanspopulationprocess
SHARED TOKENS (27): "act", "committees", "continuing", "cooperative", "existing", "federal", "formation", "funding", "funds", "future", "governed", "law", "local", "metropolitan", "organization", "participation", "planning", "plans", "population", "process".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
actadministrationappliesapplyenvironmentalepafederalfoodintendedlawprimaryprivateprovidingpublicqualityregulatedsafeservedstandardssystem
SHARED TOKENS (22): "act", "administration", "applies", "apply", "environmental", "epa", "federal", "food", "intended", "law", "primary", "private", "providing", "public", "quality", "regulated", "safe", "served", "standards", "system".... | EXACT TITLE in energy_utilities: "Safe Drinking Water Act".
0.500
Broadband ↗ Q194163 EXACT TITLE
conceptdatadifferentimplementationintegratedlevelnetworkplannedproviderequirementssignalstechnologytelecommunicationstransferuses
SHARED TOKENS (15): "concept", "data", "different", "implementation", "integrated", "level", "network", "planned", "provide", "requirements", "signals", "technology", "telecommunications", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
acresactappliedbecomebuiltdeliverydepartmentdevelopmentfarmlandfederalfundinggenerationirrigationlawmanagementmillionoperationoversightpotentialpower
SHARED TOKENS (33): "acres", "act", "applied", "become", "built", "delivery", "department", "development", "farmland", "federal", "funding", "generation", "irrigation", "law", "management", "million", "operation", "oversight", "potential", "power".... | EXACT TITLE in energy_utilities: "Bureau of Reclamation".
0.500
broaderdevelopmenteconomicenvironmentalfarmlandgrowthindividualindustrialinfrastructurelandland-uselevelmanagementnationalneedsnetworkplacementplanningplanspractices
SHARED TOKENS (31): "broader", "development", "economic", "environmental", "farmland", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "level", "management", "national", "needs", "network", "placement", "planning", "plans", "practices".... | EXACT TITLE in energy_utilities: "Regional planning". | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
airbecomecapacitycleancompetitiveconsumptioncostcurrentelectricityelectrificationenergyenvironmentalevenexpansionfinancialgasgenerationincreaseinternationalland
SHARED TOKENS (46): "air", "become", "capacity", "clean", "competitive", "consumption", "cost", "current", "electricity", "electrification", "energy", "environmental", "even", "expansion", "financial", "gas", "generation", "increase", "international", "land".... | EXACT TITLE in energy_utilities: "Renewable energy".
0.500
Journeyman ↗ Q582096 EXACT TITLE
apprenticeshipbecomebuildingbusinesscontinuededucationfieldindividuallicensemeaningofficialpublicqualificationqualifiedresponsibleworkworkersyet
SHARED TOKENS (18): "apprenticeship", "become", "building", "business", "continued", "education", "field", "individual", "license", "meaning", "official", "public", "qualification", "qualified", "responsible", "work", "workers", "yet". | EXACT TITLE in energy_utilities: "Journeyman".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationavailabilitybuildingbuiltcleanconstructioncriticaldesigndownstreamelectricityengineeringfloodfunctionsgoverninghazardincreaseindustrialirrigationland
SHARED TOKENS (42): "additional", "application", "availability", "building", "built", "clean", "construction", "critical", "design", "downstream", "electricity", "engineering", "flood", "functions", "governing", "hazard", "increase", "industrial", "irrigation", "land".... | EXACT TITLE in energy_utilities: "Dam". | EXACT TITLE in transportation_infrastructure: "Dam".
0.500
agriculturalalongsideannuallybillionconsumptiondevelopmentdirectenvironmentenvironmentalgroupgrowthincreaseindividualinternationallimitedmedicalmillionnaturalpolicypopulation
SHARED TOKENS (30): "agricultural", "alongside", "annually", "billion", "consumption", "development", "direct", "environment", "environmental", "group", "growth", "increase", "individual", "international", "limited", "medical", "million", "natural", "policy", "population".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddirectlyeventsfallslandlargemajornaturalpopulationpotentialreduceresourcesurfacetimingtreatmenturbanwater
SHARED TOKENS (19): "become", "create", "demand", "directly", "events", "falls", "land", "large", "major", "natural", "population", "potential", "reduce", "resource", "surface", "timing", "treatment", "urban", "water". | EXACT TITLE in energy_utilities: "Stormwater".
0.500
annualcapacitychargescommercialconsumersconsumptioncostcustomercustomersdemandelectricelectricalelectricityenergyevenindividualindustriallevelloadloads
SHARED TOKENS (27): "annual", "capacity", "charges", "commercial", "consumers", "consumption", "cost", "customer", "customers", "demand", "electric", "electrical", "electricity", "energy", "even", "individual", "industrial", "level", "load", "loads".... | EXACT TITLE in energy_utilities: "Peak demand".
0.500
Heat pump ↗ Q131313 EXACT TITLE
adoptionairalternativesanotherbuildingcostdependsdesigneddistrictefficiencyelectricelectricalelectricityenergyfallsgasgeneratesincreasinglimitedmeans
SHARED TOKENS (43): "adoption", "air", "alternatives", "another", "building", "cost", "depends", "designed", "district", "efficiency", "electric", "electrical", "electricity", "energy", "falls", "gas", "generates", "increasing", "limited", "means".... | EXACT TITLE in energy_utilities: "Heat pump".
0.500
businessdistributioneasternelectricalelectricitygasgenerationidahonaturaloperatespowerregulatedriversharesutility
SHARED TOKENS (15): "business", "distribution", "eastern", "electrical", "electricity", "gas", "generation", "idaho", "natural", "operates", "power", "regulated", "river", "shares", "utility". | EXACT TITLE in energy_utilities: "Idaho Power".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralcommercialconnectedconsumercontrolcustomerdifferentdistributionelectricelectricalenergyfunctionsgenerationindustrialinfrastructurelargeoperatedownedpower
SHARED TOKENS (25): "approximately", "central", "commercial", "connected", "consumer", "control", "customer", "different", "distribution", "electric", "electrical", "energy", "functions", "generation", "industrial", "infrastructure", "large", "operated", "owned", "power".... | EXACT TITLE in energy_utilities: "Substation".
0.500
accordingcommunityconceptdescribesdevelopmenteconomiceconomicsgrowthindividualinfrastructurelocalmarketpolicyprocessqualityreductionregionwest
SHARED TOKENS (18): "according", "community", "concept", "describes", "development", "economic", "economics", "growth", "individual", "infrastructure", "local", "market", "policy", "process", "quality", "reduction", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
Lineworker ↗ Q691225 EXACT TITLE
buildingscommercialdistributionelectricelectricalelectriciansemergencyenergyfacilitiesindustrialinsidelinesmaintainsresidentialwork
SHARED TOKENS (15): "buildings", "commercial", "distribution", "electric", "electrical", "electricians", "emergency", "energy", "facilities", "industrial", "inside", "lines", "maintains", "residential", "work". | EXACT TITLE in energy_utilities: "Lineworker".
0.500
chaincomplexconsumerconsumersconvertcreatingcustomersdirectdirectlydistributionefficiencyfacilitiesindependentmanagementmaterialsnetworkproductstructuresupplysystem
SHARED TOKENS (23): "chain", "complex", "consumer", "consumers", "convert", "creating", "customers", "direct", "directly", "distribution", "efficiency", "facilities", "independent", "management", "materials", "network", "product", "structure", "supply", "system".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationairassetsauthoritycertificationcivilcommercialcontroldepartmentfederalinternationalorganizationpersonnelpowersregulatesstandardstraffictransportationvehicles
SHARED TOKENS (19): "administration", "air", "assets", "authority", "certification", "civil", "commercial", "control", "department", "federal", "international", "organization", "personnel", "powers", "regulates", "standards", "traffic", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
agricultureamericanboisecivilcountiesdesignatedengineeringengineersfeetidahoirrigationlevelnationaloperatedprimaryprovideriverwaterwestern
SHARED TOKENS (19): "agriculture", "american", "boise", "civil", "counties", "designated", "engineering", "engineers", "feet", "idaho", "irrigation", "level", "national", "operated", "primary", "provide", "river", "water", "western". | EXACT TITLE in energy_utilities: "Arrowrock Dam".
0.500
acquisitionsadditionalairbrandextendsformformationhistoryindependentinternationallinesmajornetworkoperatesoperatingprincipalregionalroutethroughout
SHARED TOKENS (19): "acquisitions", "additional", "air", "brand", "extends", "form", "formation", "history", "independent", "international", "lines", "major", "network", "operates", "operating", "principal", "regional", "route", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
agenciesamericanbusinessescoordinationcurrentdatadepartmenteconomiceconomicsfederalfieldgovernmentslaborlocalmajormanagementneedofficeprincipalpublic
SHARED TOKENS (27): "agencies", "american", "businesses", "coordination", "current", "data", "department", "economic", "economics", "federal", "field", "governments", "labor", "local", "major", "management", "need", "office", "principal", "public".... | EXACT TITLE in energy_utilities: "Bureau of Labor Statistics".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentformationhomeindustriallandlayermajormaterialspressureregionsourcestudyvarywater
SHARED TOKENS (15): "beyond", "environment", "formation", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "source", "study", "vary", "water". | EXACT TITLE in energy_utilities: "Aquifer".
0.500
activityannuallybillioncomplianceenforcementevenformhazardousindustrialissuemakingmunicipaloperationsproblemprocessvarywastewater
SHARED TOKENS (18): "activity", "annually", "billion", "compliance", "enforcement", "even", "form", "hazardous", "industrial", "issue", "making", "municipal", "operations", "problem", "process", "vary", "waste", "water". | EXACT TITLE in energy_utilities: "Industrial waste".
0.500
administrationairapproximatelyauthoritybillionconnectingdatadepartmentenforcementfacilitiesfederalidentificationlawlocaloperatedpartnerspersonnelpipelinesprimaryprocedures
SHARED TOKENS (31): "administration", "air", "approximately", "authority", "billion", "connecting", "data", "department", "enforcement", "facilities", "federal", "identification", "law", "local", "operated", "partners", "personnel", "pipelines", "primary", "procedures".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherchaincivilcollectionconsumptioncostscustomersdedicateddeliveriesequipmentfacilityfieldfoodinformationlinesmanagedmanagementmaterialsmodel
SHARED TOKENS (34): "according", "another", "chain", "civil", "collection", "consumption", "costs", "customers", "dedicated", "deliveries", "equipment", "facility", "field", "food", "information", "lines", "managed", "management", "materials", "model".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesdepartmentdistrictexistingfederalfinancialfunctionsgrantslocalofficeoperateoperatorsprogramsprovidersprovidingpublicregionalrequirementsresponsible
SHARED TOKENS (25): "administration", "agencies", "department", "district", "existing", "federal", "financial", "functions", "grants", "local", "office", "operate", "operators", "programs", "providers", "providing", "public", "regional", "requirements", "responsible".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
advancedbecomescomponentsefficiencyenergyenvironmentenvironmentalindustrialirrigationmaintenancematerialsprocessqualityreceivingrecoveryrecreationresourceriversupplysystems
SHARED TOKENS (23): "advanced", "becomes", "components", "efficiency", "energy", "environment", "environmental", "industrial", "irrigation", "maintenance", "materials", "process", "quality", "receiving", "recovery", "recreation", "resource", "river", "supply", "systems".... | EXACT TITLE in energy_utilities: "Water treatment".
0.500
Microgrid ↗ Q5762595 EXACT TITLE
boundariesbuildingcentralizedconnectedcontrolcrossdistributeddistributioneconomicefficiencyelectricelectricalelectricityelectrificationemergencyenergyentityevenfunctiongeneration
SHARED TOKENS (46): "boundaries", "building", "centralized", "connected", "control", "cross", "distributed", "distribution", "economic", "efficiency", "electric", "electrical", "electricity", "electrification", "emergency", "energy", "entity", "even", "function", "generation".... | EXACT TITLE in energy_utilities: "Microgrid".
0.500
airallowingalternativesarrangementsassociationcompetingcompetitivecontractingcoordinationcorridorscostsdesignateddevelopmenteconomicefficiencyestatefeederfinancialfundingindustry
SHARED TOKENS (53): "air", "allowing", "alternatives", "arrangements", "association", "competing", "competitive", "contracting", "coordination", "corridors", "costs", "designated", "development", "economic", "efficiency", "estate", "feeder", "financial", "funding", "industry".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
associationcertificationcontractorsengineersgroupindustryinternationalmanufacturersmonitoringnationaloperatesorganizationprogramspublicpublishesresearchresponsibleseparatewater
SHARED TOKENS (19): "association", "certification", "contractors", "engineers", "group", "industry", "international", "manufacturers", "monitoring", "national", "operates", "organization", "programs", "public", "publishes", "research", "responsible", "separate", "water". | EXACT TITLE in energy_utilities: "National Ground Water Association".
0.500
appliedconstructioncontroldescribeddesignedengineerequipmentfunctionsindustrialinformationlaborlargeoperationspowerprimarysourcestructuresystemstrainuses
SHARED TOKENS (21): "applied", "construction", "control", "described", "designed", "engineer", "equipment", "functions", "industrial", "information", "labor", "large", "operations", "power", "primary", "source", "structure", "systems", "train", "uses".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
approveddepartmentefficiencyfacilitiesfederalfundsindividuallocalmajormetropolitannationalnetworkorganizationspipelineplanningroadssafetyservingstationsstrategic
SHARED TOKENS (22): "approved", "department", "efficiency", "facilities", "federal", "funds", "individual", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "roads", "safety", "serving", "stations", "strategic".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingamericanauthorityboundariescivilcountiesdifferentdistrictdistrictsdividedentitiesexistingformgovernmentsindependentlawlegallylevellocallocally
SHARED TOKENS (33): "according", "american", "authority", "boundaries", "civil", "counties", "different", "district", "districts", "divided", "entities", "existing", "form", "governments", "independent", "law", "legally", "level", "local", "locally".... | EXACT TITLE in energy_utilities: "County (United States)". | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcommunicationscomponentsconstructiondesignateddevelopmentengineeringenvironmentequipmentestablishhistorylandlawlegalownershipplanningprofessionalproperty
SHARED TOKENS (28): "analysis", "boundaries", "civil", "communications", "components", "construction", "designated", "development", "engineering", "environment", "equipment", "establish", "history", "land", "law", "legal", "ownership", "planning", "professional", "property".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
businessconstructioncontractordesigndifferentdirectlyelectricalelectricianshomeindividualinstallationlicensesmaintenanceoperateownersprofessionalrequirementsspecializedsystemsvary
SHARED TOKENS (21): "business", "construction", "contractor", "design", "different", "directly", "electrical", "electricians", "home", "individual", "installation", "licenses", "maintenance", "operate", "owners", "professional", "requirements", "specialized", "systems", "vary".... | EXACT TITLE in energy_utilities: "Electrical contractor".
0.500
acresactiveamericancentercenterscollectioncorporationenergyenvironmentalepafacilitiesmanagementmaterialsnearoperatedoperatesoperationsownedprojectsprovider
SHARED TOKENS (32): "acres", "active", "american", "center", "centers", "collection", "corporation", "energy", "environmental", "epa", "facilities", "management", "materials", "near", "operated", "operates", "operations", "owned", "projects", "provider".... | EXACT TITLE in energy_utilities: "Republic Services".
0.500
adaairbaseboisecentercommercialcommissiondepartmentdowntownfacilityfallsfieldfunctionsidahoincreaseinternationalmilesmillionnationaloperated
SHARED TOKENS (28): "ada", "air", "base", "boise", "center", "commercial", "commission", "department", "downtown", "facility", "falls", "field", "functions", "idaho", "increase", "international", "miles", "million", "national", "operated".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
Compost ↗ Q212254 EXACT TITLE
agricultureaircommercialconstructioneconomicenvironmentalfoodincreasinglandlevelmanagementmaterialsphysicalprocessprovidingreducerequiresresultingurbanwaste
SHARED TOKENS (21): "agriculture", "air", "commercial", "construction", "economic", "environmental", "food", "increasing", "land", "level", "management", "materials", "physical", "process", "providing", "reduce", "requires", "resulting", "urban", "waste".... | EXACT TITLE in energy_utilities: "Compost".
0.500
Landfill ↗ Q152810 EXACT TITLE
activeconsolidationdischargeenvironmentalfinalformfulllandmanagementmaterialsmunicipalsimplysitesitesstoragetemporarytransfertreatmentuseswaste
SHARED TOKENS (20): "active", "consolidation", "discharge", "environmental", "final", "form", "full", "land", "management", "materials", "municipal", "simply", "site", "sites", "storage", "temporary", "transfer", "treatment", "uses", "waste". | EXACT TITLE in energy_utilities: "Landfill".
0.500
actadministrationagenciescivilcorridordepartmentdevelopmentfederalfinancialmanagementnationaloperatespolicyprogramsprovidepublicrehabilitationresearchrightssafety
SHARED TOKENS (22): "act", "administration", "agencies", "civil", "corridor", "department", "development", "federal", "financial", "management", "national", "operates", "policy", "programs", "provide", "public", "rehabilitation", "research", "rights", "safety".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
cannotcleanclearcommissioncommunicationscompetecompetingcontrolcostsdifferentelectricityenergyentityfederalgasinfrastructureissuelargelineslocal
SHARED TOKENS (43): "cannot", "clean", "clear", "commission", "communications", "compete", "competing", "control", "costs", "different", "electricity", "energy", "entity", "federal", "gas", "infrastructure", "issue", "large", "lines", "local".... | EXACT TITLE in energy_utilities: "Public utility".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbuiltcommunitycomplexconnectingconnectionconstructedconstructioncreatecrossdesigndesignedengineeringengineersenvironmentindustrialintendedloadslocalmajor
SHARED TOKENS (39): "allowing", "built", "community", "complex", "connecting", "connection", "constructed", "construction", "create", "cross", "design", "designed", "engineering", "engineers", "environment", "industrial", "intended", "loads", "local", "major".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
activityairannualapplicationapplicationsapproximatelyboundariescapacityconsumptioncontainsdirectefficiencyenergyevenformationneededprimarysourcesurfacewinter
SHARED TOKENS (20): "activity", "air", "annual", "application", "applications", "approximately", "boundaries", "capacity", "consumption", "contains", "direct", "efficiency", "energy", "even", "formation", "needed", "primary", "source", "surface", "winter". | EXACT TITLE in energy_utilities: "Geothermal heating".
0.500
affectsalternativesbusinesscertificationconsumerconsumerscreatescustomercustomerseconomicentryformgrowthindividuallawlicenselicensedlicensingmarketoccupational
SHARED TOKENS (39): "affects", "alternatives", "business", "certification", "consumer", "consumers", "creates", "customer", "customers", "economic", "entry", "form", "growth", "individual", "law", "license", "licensed", "licensing", "market", "occupational".... | EXACT TITLE in energy_utilities: "Occupational licensing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangescollectionconsolidationcontributioncontrolcontrolleddirectlydischargedistributeddistributiondownstreamdrainageenvironmentalfieldform
SHARED TOKENS (48): "agricultural", "agriculture", "application", "applies", "central", "changes", "collection", "consolidation", "contribution", "control", "controlled", "directly", "discharge", "distributed", "distribution", "downstream", "drainage", "environmental", "field", "form".... | EXACT TITLE in energy_utilities: "Irrigation". | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
Veolia ↗ Q1632461 EXACT TITLE
adoptedbillionboardbusinessclearenergyenvironmentenvironmentalgroupidentificationmajormanagedmanagementnameoperationspublicrevenuesectorsingleutility
SHARED TOKENS (22): "adopted", "billion", "board", "business", "clear", "energy", "environment", "environmental", "group", "identification", "major", "managed", "management", "name", "operations", "public", "revenue", "sector", "single", "utility".... | EXACT TITLE in energy_utilities: "Veolia".
0.500
Pipefitter ↗ Q5407416 EXACT TITLE
apprenticeshipapprenticeshipscentercommercialcompletionconstructioncontrolleddifferenteducationindustrialinstitutionallicensedmaintainsnationalpressureprocessregulatedrequirerequirementsrequires
SHARED TOKENS (30): "apprenticeship", "apprenticeships", "center", "commercial", "completion", "construction", "controlled", "different", "education", "industrial", "institutional", "licensed", "maintains", "national", "pressure", "process", "regulated", "require", "requirements", "requires".... | EXACT TITLE in energy_utilities: "Pipefitter".
0.500
allowingcommunicationsdatadevelopersdevelopmentdividedelectricelectricalformindependentindividualinformationlong-distancemeansmediaphysicalpowersignalssingletechnology
SHARED TOKENS (21): "allowing", "communications", "data", "developers", "development", "divided", "electric", "electrical", "form", "independent", "individual", "information", "long-distance", "means", "media", "physical", "power", "signals", "single", "technology".... | EXACT TITLE in energy_utilities: "Telecommunications". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcanalcanalscontrolcreatecurrentdrainagefloodincreaseirrigationlevelmanagementnaturalneededpressurerequiringresourcesrivershares
SHARED TOKENS (27): "building", "built", "canal", "canals", "control", "create", "current", "drainage", "flood", "increase", "irrigation", "level", "management", "natural", "needed", "pressure", "requiring", "resources", "river", "shares".... | EXACT TITLE in energy_utilities: "Canal". | EXACT TITLE in transportation_infrastructure: "Canal".
0.500
Recycling ↗ Q132580 EXACT TITLE
abilityairanothercentercomplexconceptconsumptioncontrolconventionaldependsdifferenteconomicenergyenvironmentalfoodformgashazardousmanagementmaterials
SHARED TOKENS (35): "ability", "air", "another", "center", "complex", "concept", "consumption", "control", "conventional", "depends", "different", "economic", "energy", "environmental", "food", "form", "gas", "hazardous", "management", "materials".... | EXACT TITLE in energy_utilities: "Recycling".
0.500
activebusinesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancialfinancingfirmsfundfundslimitedlong-termmanagementoperationalownership
SHARED TOKENS (28): "active", "business", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financial", "financing", "firms", "fund", "funds", "limited", "long-term", "management", "operational", "ownership".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessescomponentsdesigneddirectlyfacilityfunctionindustriallargeloadmanufacturersmaterialsparksplacedproductionstandardwarehouses
SHARED TOKENS (20): "agriculture", "associated", "building", "buildings", "businesses", "components", "designed", "directly", "facility", "function", "industrial", "large", "load", "manufacturers", "materials", "parks", "placed", "production", "standard", "warehouses". | EXACT TITLE in energy_utilities: "Warehouse". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
builtcapacityclassificationcommunitydatadefinitionsdistributedelectricityenergyenvironmentalfundinggenerationintegrationlevellocalnationaloperatingpermittingpowerprimary
SHARED TOKENS (36): "built", "capacity", "classification", "community", "data", "definitions", "distributed", "electricity", "energy", "environmental", "funding", "generation", "integration", "level", "local", "national", "operating", "permitting", "power", "primary".... | EXACT TITLE in energy_utilities: "Small hydro".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelybillionboardbusinesscorporationcorridordirectlyexecutivefederallimitedlinesmanagedmetropolitanmilesmillionnationalnearlynetwork
SHARED TOKENS (34): "additional", "american", "approximately", "billion", "board", "business", "corporation", "corridor", "directly", "executive", "federal", "limited", "lines", "managed", "metropolitan", "miles", "million", "national", "nearly", "network".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
buildingscannotconnectdesigndesigneddrainagedrainsevenfallshazardousinfrastructureinsidelargemunicipalparkspropertypublicreceiverequireresidential
SHARED TOKENS (28): "buildings", "cannot", "connect", "design", "designed", "drainage", "drains", "even", "falls", "hazardous", "infrastructure", "inside", "large", "municipal", "parks", "property", "public", "receive", "require", "residential".... | EXACT TITLE in energy_utilities: "Storm drain".
0.500
commissioncommissionersdepartmentelectricityenergyfederalgasindependentlicensingnaturalpipelinepipelinesprojectsregulatesregulatoryreviewsservingstorage
SHARED TOKENS (18): "commission", "commissioners", "department", "electricity", "energy", "federal", "gas", "independent", "licensing", "natural", "pipeline", "pipelines", "projects", "regulates", "regulatory", "reviews", "serving", "storage". | EXACT TITLE in energy_utilities: "Federal Energy Regulatory Commission".
0.500
agenciesalternativesapplybusinessesdesignfacilitiesfuturelinesmovemovementneedsplanningprivateprocesspublicsystemtransportation
SHARED TOKENS (17): "agencies", "alternatives", "apply", "businesses", "design", "facilities", "future", "lines", "move", "movement", "needs", "planning", "private", "process", "public", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
agenciesbeyondcommunityconceptcustomersdesigneddevelopingdischargeeconomicextendsformformallocalmetropolitanoperateoperatedoperatesoperatorsorganizationsprivate
SHARED TOKENS (34): "agencies", "beyond", "community", "concept", "customers", "designed", "developing", "discharge", "economic", "extends", "form", "formal", "local", "metropolitan", "operate", "operated", "operates", "operators", "organizations", "private".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
Road ↗ Q34442 EXACT TITLE
anotherdesigndistinctionlandlocalmovementprimaryprivatepublicroadsroutestreettrafficurban
SHARED TOKENS (14): "another", "design", "distinction", "land", "local", "movement", "primary", "private", "public", "roads", "route", "street", "traffic", "urban". | EXACT TITLE in energy_utilities: "Road". | EXACT TITLE in transportation_infrastructure: "Road".
0.480
associationcanalcorridorsenvironmentalindustriallandmultipleparksrightsruralservessurfaceurbanutility
SHARED TOKENS (14): "association", "canal", "corridors", "environmental", "industrial", "land", "multiple", "parks", "rights", "rural", "serves", "surface", "urban", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.480
centralizedcommercialcomponentsconsumersdistributionindustrialinfrastructurenetworkrequirementsresidentialsupplysystemtreatmentwater
SHARED TOKENS (14): "centralized", "commercial", "components", "consumers", "distribution", "industrial", "infrastructure", "network", "requirements", "residential", "supply", "system", "treatment", "water". | EXACT TITLE in energy_utilities: "Water distribution system".
0.480
agriculturalanotherenvironmentfacilityindustrialindustrymunicipalprocessresultingtreatedtreatmentuseswastewater
SHARED TOKENS (14): "agricultural", "another", "environment", "facility", "industrial", "industry", "municipal", "process", "resulting", "treated", "treatment", "uses", "waste", "water". | EXACT TITLE in energy_utilities: "Wastewater treatment".
0.480
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcreatingdesignatednetworkprofessionalrecordroadsruralsafetytrafficurbanvehicleswider
SHARED TOKENS (14): "american", "associated", "creating", "designated", "network", "professional", "record", "roads", "rural", "safety", "traffic", "urban", "vehicles", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.460
constructioncontrolcontrolsdesignedlakemanagementmeasuresneedreduceriversitetemporarywater
SHARED TOKENS (13): "construction", "control", "controls", "designed", "lake", "management", "measures", "need", "reduce", "river", "site", "temporary", "water". | EXACT TITLE in energy_utilities: "Sediment control".
0.440
americancrossfieldmovementpermitroadsstandardsurfacesystemthoughtrafficuses
SHARED TOKENS (12): "american", "cross", "field", "movement", "permit", "roads", "standard", "surface", "system", "though", "traffic", "uses". | EXACT TITLE in energy_utilities: "Interchange (road)". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.440
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbasecontroldischargefloodincreasinglandnearriverurbanvalleywater
SHARED TOKENS (12): "agricultural", "base", "control", "discharge", "flood", "increasing", "land", "near", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.440
administrationdepartmentdivisionfederalmajorofficeprogramprogramspublicroadsroletransportation
SHARED TOKENS (12): "administration", "department", "division", "federal", "major", "office", "program", "programs", "public", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.420
Reservoir ↗ Q131681 EXACT TITLE
buildingbuiltcontrollingdrainsexistingformgenerationlakepowerstoragewater
SHARED TOKENS (11): "building", "built", "controlling", "drains", "existing", "form", "generation", "lake", "power", "storage", "water". | EXACT TITLE in energy_utilities: "Reservoir".
0.420
Wastewater ↗ Q336191 EXACT TITLE
agriculturalanotherapplicationscommercialcommunityindustrialmunicipalsewersurfacewastewater
SHARED TOKENS (11): "agricultural", "another", "applications", "commercial", "community", "industrial", "municipal", "sewer", "surface", "waste", "water". | EXACT TITLE in energy_utilities: "Wastewater".
0.420
againstcomplianceconditioncontactphysicalqualitysafetystandardssupplytreatmentwater
SHARED TOKENS (11): "against", "compliance", "condition", "contact", "physical", "quality", "safety", "standards", "supply", "treatment", "water". | EXACT TITLE in energy_utilities: "Water quality".
0.420
controlscrossdesigndifferentmajormeetroadsseparatetrafficusesvehicles
SHARED TOKENS (11): "controls", "cross", "design", "different", "major", "meet", "roads", "separate", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.420
acrescanyoneasternfeetidahonationalrecreationriversmallwestwestern
SHARED TOKENS (11): "acres", "canyon", "eastern", "feet", "idaho", "national", "recreation", "river", "small", "west", "western". | EXACT TITLE in energy_utilities: "Hells Canyon".
0.400
Utility ↗ Q466707 EXACT TITLE
amongconceptdistincteconomicsfunctionfunctionsgoalrelationshipsourceutility
SHARED TOKENS (10): "among", "concept", "distinct", "economics", "function", "functions", "goal", "relationship", "source", "utility". | EXACT TITLE in energy_utilities: "Utility". | EXACT TITLE in transportation_infrastructure: "Utility".
0.400
boiseeasternexpansionidaholakelong-distanceoperatingroutethoughtrain
SHARED TOKENS (10): "boise", "eastern", "expansion", "idaho", "lake", "long-distance", "operating", "route", "though", "train". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.400
differentirrigationlawlegalphysicalriversourcesurfacesystemswater
SHARED TOKENS (10): "different", "irrigation", "law", "legal", "physical", "river", "source", "surface", "systems", "water". | EXACT TITLE in energy_utilities: "Water right".
0.380
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboisedrainsidahomilesriverurbanwestern
SHARED TOKENS (9): "agricultural", "approximately", "boise", "drains", "idaho", "miles", "river", "urban", "western". | EXACT TITLE in energy_utilities: "Boise River". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.360
boisedepartmentenvironmentalfederalidahoqualityregionalresponsible
SHARED TOKENS (8): "boise", "department", "environmental", "federal", "idaho", "quality", "regional", "responsible". | EXACT TITLE in energy_utilities: "Idaho Department of Environmental Quality".
0.360
organizationorganizationsprovidingpublicregulatorysystemutilitieswater
SHARED TOKENS (8): "organization", "organizations", "providing", "public", "regulatory", "system", "utilities", "water". | EXACT TITLE in energy_utilities: "Public water system".
0.360
Snowplow ↗ Q14976 EXACT TITLE
clearintendedlargereceiveservingtransportationvehicleswinter
SHARED TOKENS (8): "clear", "intended", "large", "receive", "serving", "transportation", "vehicles", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.340
civilengineeringfieldnetworktelecommunicationstraffictransportation
SHARED TOKENS (7): "civil", "engineering", "field", "network", "telecommunications", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.340
Sidewalk ↗ Q177749 EXACT TITLE
americanbuildingsdesignedlandprivatesouthstreet
SHARED TOKENS (7): "american", "buildings", "designed", "land", "private", "south", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.320
aircreateengineergasnaturaluses
SHARED TOKENS (6): "air", "create", "engineer", "gas", "natural", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.300
advisoryanotherapplicationconstructioncreatedependdevelopersdevelopmentenvironmentalfieldhazardousindustrylandmaterialsmediamunicipalphysicalpressureprogramprograms
SHARED TOKENS (28): "advisory", "another", "application", "construction", "create", "depend", "developers", "development", "environmental", "field", "hazardous", "industry", "land", "materials", "media", "municipal", "physical", "pressure", "program", "programs"....
0.300
Project finance ↗ KW CROSS HIGH
agreementsallocationamongassetsassociatedcapitalcomplexconstructioncontractscontributioncontrolcorporatedeliverydevelopingdevelopmentdistributedeconomicentityenvironmentalfinance
SHARED TOKENS (52): "agreements", "allocation", "among", "assets", "associated", "capital", "complex", "construction", "contracts", "contribution", "control", "corporate", "delivery", "developing", "development", "distributed", "economic", "entity", "environmental", "finance"....
0.300
chaincostsdirecteconomicsgroupintendedinternationalitselfoperatingpracticesregionspecializedtraintransportationunionvary
SHARED TOKENS (16): "chain", "costs", "direct", "economics", "group", "intended", "international", "itself", "operating", "practices", "region", "specialized", "train", "transportation", "union", "vary".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomebuildingcommercialcostsdescribeddevelopmentenvironmentenvironmentalexistingexpansionformgrowthindustrialinfrastructurelandlargeplanningpopulationprivate
SHARED TOKENS (32): "associated", "become", "building", "commercial", "costs", "described", "development", "environment", "environmental", "existing", "expansion", "form", "growth", "industrial", "infrastructure", "land", "large", "planning", "population", "private"....
0.300
additionalagriculturalapplicationsboundariesbuiltcapacitycontinuedcostcostsdepartmentdistrictelectricelectricityenergyformationgenerationindustrialindustrymeaningnear
SHARED TOKENS (29): "additional", "agricultural", "applications", "boundaries", "built", "capacity", "continued", "cost", "costs", "department", "district", "electric", "electricity", "energy", "formation", "generation", "industrial", "industry", "meaning", "near"....
0.300
Black start ↗ Q655257 KW CROSS HIGH
abilityagreementanothercomplexelectricelectricalelectricityemergencyenergyfacilityindustriallargeloadsnetworkoperationpowerprocessprovidingrequirestechnology
SHARED TOKENS (20): "ability", "agreement", "another", "complex", "electric", "electrical", "electricity", "emergency", "energy", "facility", "industrial", "large", "loads", "network", "operation", "power", "process", "providing", "requires", "technology".
0.300
baseconsumercontrolcontrollingcostscriticaldemanddevelopmentdirectelectricalelectricityentitiesevenindustryloadmakesmanagementneednetworkpower
SHARED TOKENS (29): "base", "consumer", "control", "controlling", "costs", "critical", "demand", "development", "direct", "electrical", "electricity", "entities", "even", "industry", "load", "makes", "management", "need", "network", "power"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
agreementcapacityconnectedelectricalelectricityenergyenvironmentfarmsgasgenerationmeetnearlyneedspotentialpowersourcestationsstoragesuppliedsupply
SHARED TOKENS (22): "agreement", "capacity", "connected", "electrical", "electricity", "energy", "environment", "farms", "gas", "generation", "meet", "nearly", "needs", "potential", "power", "source", "stations", "storage", "supplied", "supply"....
0.300
alternativesapplicationscapacitychainconsumptioncostdefinesdemanddistrictefficiencyelectricenergyformfullgenerationgoalgrowthincreasingintegratedirp
SHARED TOKENS (34): "alternatives", "applications", "capacity", "chain", "consumption", "cost", "defines", "demand", "district", "efficiency", "electric", "energy", "form", "full", "generation", "goal", "growth", "increasing", "integrated", "irp"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
allowingannualarrangementconnectionconsumerscurrentdesignedelectricelectricityenergyevenfeemechanismnetpolicypowerprivaterequirerequiresretail
SHARED TOKENS (26): "allowing", "annual", "arrangement", "connection", "consumers", "current", "designed", "electric", "electricity", "energy", "even", "fee", "mechanism", "net", "policy", "power", "private", "require", "requires", "retail"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalapprovedbrandcustomersdetermineindependentinspectionmaintenanceneedsproblemproposedrepairroleshowingtechnicianwork
SHARED TOKENS (16): "approval", "approved", "brand", "customers", "determine", "independent", "inspection", "maintenance", "needs", "problem", "proposed", "repair", "role", "showing", "technician", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentralconceptdesignengineersenvironmentfullimprovementincreaseintegrationlinesmakesneedreducerequireresearchresultingrulessafety
SHARED TOKENS (27): "associated", "become", "central", "concept", "design", "engineers", "environment", "full", "improvement", "increase", "integration", "lines", "makes", "need", "reduce", "require", "research", "resulting", "rules", "safety"....
0.300
actamericanamongassociationauthorityconstructioncontractsdepartmenteventualfederalfundirrigationlandlawmaintenancemajormeridiannationalnearlyorganization
SHARED TOKENS (34): "act", "american", "among", "association", "authority", "construction", "contracts", "department", "eventual", "federal", "fund", "irrigation", "land", "law", "maintenance", "major", "meridian", "national", "nearly", "organization"....
0.300
accordingcreatingdemandformfunctionsmedicalmovementneedsnetworkprivateprogramsprovidepublicratherrelevantrouteruralsharedtechnologyvehicles
SHARED TOKENS (20): "according", "creating", "demand", "form", "functions", "medical", "movement", "needs", "network", "private", "programs", "provide", "public", "rather", "relevant", "route", "rural", "shared", "technology", "vehicles".
0.300
adaboisecanyoncountiesdesignatedhomeidahomeridianmetropolitannampanearlynorthwestpercentpopulationtreasurevalleywider
SHARED TOKENS (17): "ada", "boise", "canyon", "counties", "designated", "home", "idaho", "meridian", "metropolitan", "nampa", "nearly", "northwest", "percent", "population", "treasure", "valley", "wider".
0.300
advancedagriculturalagriculturebusinessescostcostsdirectdistributionenvironmentalincreasingindustrialindustryirrigationmanagementmeaningmeetmunicipalnaturalneedsplanned
SHARED TOKENS (38): "advanced", "agricultural", "agriculture", "businesses", "cost", "costs", "direct", "distribution", "environmental", "increasing", "industrial", "industry", "irrigation", "management", "meaning", "meet", "municipal", "natural", "needs", "planned"....
0.300
americanbuiltbusinessescenterscentralchangesconsequencedevelopmenteconomicenvironmentalexpansionformationgrowthmodelmovementperipheralplannedpopulationprocessresidents
SHARED TOKENS (23): "american", "built", "businesses", "centers", "central", "changes", "consequence", "development", "economic", "environmental", "expansion", "formation", "growth", "model", "movement", "peripheral", "planned", "population", "process", "residents"....
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
advancedcapacitycodecommunicationsconnectconsumptioncontrolcreatecurrentdeliverydemanddescribeddistributeddistributionefficiencyelectricelectricalelectricityenergyeven
SHARED TOKENS (59): "advanced", "capacity", "code", "communications", "connect", "consumption", "control", "create", "current", "delivery", "demand", "described", "distributed", "distribution", "efficiency", "electric", "electrical", "electricity", "energy", "even"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedclassescontrolcriticalenforcementlevelmeasuresoccupationalpracticesproduceprovidingpublicrapidlyreductionremainrequiringroadsruralsafesafety
SHARED TOKENS (26): "applied", "classes", "control", "critical", "enforcement", "level", "measures", "occupational", "practices", "produce", "providing", "public", "rapidly", "reduction", "remain", "requiring", "roads", "rural", "safe", "safety"....
0.300
buildingbusinesscentercentraldedicateddesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivateproblempublicrelationshipresidentialscale
SHARED TOKENS (23): "building", "business", "center", "central", "dedicated", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "problem", "public", "relationship", "residential", "scale"....
0.300
authorityboundariescooperativecorporationdesignateddistrictdistrictsentityirrigationlandownerslargelocalpowerprojectspublicsubdivisionwater
SHARED TOKENS (17): "authority", "boundaries", "cooperative", "corporation", "designated", "district", "districts", "entity", "irrigation", "landowners", "large", "local", "power", "projects", "public", "subdivision", "water".
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
applicationcustomersdifferentdistributionelectricalequipmentlargelinelinespowerpublicreduceresidentialsafetysouthstreetsupportsystemsystemsthem
SHARED TOKENS (24): "application", "customers", "different", "distribution", "electrical", "equipment", "large", "line", "lines", "power", "public", "reduce", "residential", "safety", "south", "street", "support", "system", "systems", "them"....
0.300
analysisbatterybuildingbuildingscapacitycommercialcomponentsdistributedelectricalenergyenvironmentequipmentformgenerationindustriallargemanagementmillionmonitoringnet
SHARED TOKENS (31): "analysis", "battery", "building", "buildings", "capacity", "commercial", "components", "distributed", "electrical", "energy", "environment", "equipment", "form", "generation", "industrial", "large", "management", "million", "monitoring", "net"....
0.300
capitalconceptcostcostscreatingeconomicselectricityentryfirmsformindustryinfrastructurelargemarketmultiplenaturaloperatepotentialprovidingpublic
SHARED TOKENS (29): "capital", "concept", "cost", "costs", "creating", "economics", "electricity", "entry", "firms", "form", "industry", "infrastructure", "large", "market", "multiple", "natural", "operate", "potential", "providing", "public"....
0.300
approximatelycapacitycomponentscostcreatecreatescreatingdevelopmentdownstreamenergyformgashandlinglevellocallong-termmarketmeansnaturalpressure
SHARED TOKENS (33): "approximately", "capacity", "components", "cost", "create", "creates", "creating", "development", "downstream", "energy", "form", "gas", "handling", "level", "local", "long-term", "market", "means", "natural", "pressure"....
0.300
becomechangesdesignengineeringengineersmeasuresphysicalresponsibleroadsrulesafetysurfacetrafficurbanuses
SHARED TOKENS (15): "become", "changes", "design", "engineering", "engineers", "measures", "physical", "responsible", "roads", "rule", "safety", "surface", "traffic", "urban", "uses".
0.300
Combined sewer ↗ Q361472 KW CROSS HIGH
buildingbuildingscapacitycollectionconstructedconstructionconsumptioncostsdesigndesigneddrainageenvironmentaleventsfacilitiesindividualindustrialinfrastructureirrigationlargeload
SHARED TOKENS (45): "building", "buildings", "capacity", "collection", "constructed", "construction", "consumption", "costs", "design", "designed", "drainage", "environmental", "events", "facilities", "individual", "industrial", "infrastructure", "irrigation", "large", "load"....
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalapplicationsavailabilitycapacitycostcostscurrentdemanddevelopingdirectdistributionefficiencyelectricalelectricityenergyfinancialfinancinggasgenerationgrowth
SHARED TOKENS (55): "additional", "applications", "availability", "capacity", "cost", "costs", "current", "demand", "developing", "direct", "distribution", "efficiency", "electrical", "electricity", "energy", "financial", "financing", "gas", "generation", "growth"....
0.300
administrationairamericananotherbuildingcenterscommercialconstructiondepartmentdistributiondivisioneconomyeducationenvironmentalfederalgoverninggovernshandlinghomeindustry
SHARED TOKENS (47): "administration", "air", "american", "another", "building", "centers", "commercial", "construction", "department", "distribution", "division", "economy", "education", "environmental", "federal", "governing", "governs", "handling", "home", "industry"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsdevelopmentenvironmentenvironmentalgrowthindustriallakeprocessprogramreduceresultingriversourcesubstantialsurfacewater
SHARED TOKENS (17): "agriculture", "controls", "development", "environment", "environmental", "growth", "industrial", "lake", "process", "program", "reduce", "resulting", "river", "source", "substantial", "surface", "water".
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
connectedefficiencyenvironmentfacilityfieldmethodprimaryproblemratereduceruralsystemsystemsthereforetreatedtreatmentwaste
SHARED TOKENS (17): "connected", "efficiency", "environment", "facility", "field", "method", "primary", "problem", "rate", "reduce", "rural", "system", "systems", "therefore", "treated", "treatment", "waste".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycanalscrossdifferentestatefacilityfulllandlegallineslocaloperateownershipphysicalprivaterealright-of-wayrightsrights-of-wayroads
SHARED TOKENS (27): "authority", "canals", "cross", "different", "estate", "facility", "full", "land", "legal", "lines", "local", "operate", "ownership", "physical", "private", "real", "right-of-way", "rights", "rights-of-way", "roads"....
0.300
actalternativesamericanapplicableappliedassociationauthoritycentralchangescommunitycostscreatingdependdependsdesigndevelopmentdistrictseconomicefficiencyenvironmental
SHARED TOKENS (45): "act", "alternatives", "american", "applicable", "applied", "association", "authority", "central", "changes", "community", "costs", "creating", "depend", "depends", "design", "development", "districts", "economic", "efficiency", "environmental"....
0.300
apprenticeshipapproximatelyassociationconstructioncontractorscostdataelectricalelectriciansindustryinsideinternationallabornationalprogramspublictelecommunicationstrainingunionutilities
SHARED TOKENS (22): "apprenticeship", "approximately", "association", "construction", "contractors", "cost", "data", "electrical", "electricians", "industry", "inside", "international", "labor", "national", "programs", "public", "telecommunications", "training", "union", "utilities"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomebillioncompetitiveconditioncreatecreatescurrentdescribesdevelopingdevelopmenteconomiceconomicseducationenvironmentalforecastgeographygoalgrowth
SHARED TOKENS (55): "approximately", "architecture", "become", "billion", "competitive", "condition", "create", "creates", "current", "describes", "developing", "development", "economic", "economics", "education", "environmental", "forecast", "geography", "goal", "growth"....
0.300
anotherbecomecapacityconditiondemanddepartmentsincreasinginteractionmodeledplanningpublicresultingroadsroutetraffictransportationurbanvehicles
SHARED TOKENS (18): "another", "become", "capacity", "condition", "demand", "departments", "increasing", "interaction", "modeled", "planning", "public", "resulting", "roads", "route", "traffic", "transportation", "urban", "vehicles".
0.300
additionalbuildingcurrentdepartmentdevelopmentdirectlydirectsenergyexecutivefederalhandlingnationaloriginatingphysicalpolicypositionpowerproductionprogramproject
SHARED TOKENS (23): "additional", "building", "current", "department", "development", "directly", "directs", "energy", "executive", "federal", "handling", "national", "originating", "physical", "policy", "position", "power", "production", "program", "project"....
0.300
againstallowingchangescommercialcontrolledcurrentdifferentdirecteconomyelectricformlinelinesloadlong-distancenetworkpowerrequiresourcesouth
SHARED TOKENS (26): "against", "allowing", "changes", "commercial", "controlled", "current", "different", "direct", "economy", "electric", "form", "line", "lines", "load", "long-distance", "network", "power", "require", "source", "south"....
0.300
alongsideamericancapacitycapitalconnectingconventionalcorridorscostdedicateddesigndesignedelectricintegratemillionnetworkpublicqualityreducereliabilitysingle
SHARED TOKENS (24): "alongside", "american", "capacity", "capital", "connecting", "conventional", "corridors", "cost", "dedicated", "design", "designed", "electric", "integrate", "million", "network", "public", "quality", "reduce", "reliability", "single"....
0.300
becomebillionbuiltcomplexconnectedconnectingconsumerscurrentcustomersdeliverydistributionelectricelectricalelectricityelectrificationenergylargemarketsmeaningmillion
SHARED TOKENS (33): "become", "billion", "built", "complex", "connected", "connecting", "consumers", "current", "customers", "delivery", "distribution", "electric", "electrical", "electricity", "electrification", "energy", "large", "markets", "meaning", "million"....
0.300
adoptedadvancedapplicationappliedcapacitychangescollectioncoordinateddifferentefficiencyemergencyfieldincreaseinformationinfrastructuremanagementprovidereduceroadssafety
SHARED TOKENS (27): "adopted", "advanced", "application", "applied", "capacity", "changes", "collection", "coordinated", "different", "efficiency", "emergency", "field", "increase", "information", "infrastructure", "management", "provide", "reduce", "roads", "safety"....
0.300
alternativesanotherapplicationsbatterycapacityconsumercostdemanddevelopmentdifferentdischargeefficiencyelectricelectrificationenergyenvironmentalformgashazardlarge
SHARED TOKENS (33): "alternatives", "another", "applications", "battery", "capacity", "consumer", "cost", "demand", "development", "different", "discharge", "efficiency", "electric", "electrification", "energy", "environmental", "form", "gas", "hazard", "large"....
0.300
creatingdepartmentdesignateddesigneddifferentdividedevenmovementpathwaypermitprimaryprovideroutesharedsurfaceurban
SHARED TOKENS (16): "creating", "department", "designated", "designed", "different", "divided", "even", "movement", "pathway", "permit", "primary", "provide", "route", "shared", "surface", "urban".
0.300
americanappearscrossdesignatedevenfacilitiesgovernlargeroadsrulessafetyschoolseparatesignagesignalsstreettrafficvehicles
SHARED TOKENS (18): "american", "appears", "cross", "designated", "even", "facilities", "govern", "large", "roads", "rules", "safety", "school", "separate", "signage", "signals", "street", "traffic", "vehicles".
0.300
activityamongapproximatelyassociationboisecanyoncapacitycentercontainscountiescreatesdirectlyedgeexecutivefederalfeetformationidaholakelevel
SHARED TOKENS (38): "activity", "among", "approximately", "association", "boise", "canyon", "capacity", "center", "contains", "counties", "creates", "directly", "edge", "executive", "federal", "feet", "formation", "idaho", "lake", "level"....
0.300
againstanalysisbroaderbuildingchangesconceptcontrolengineeringeventsexposurefloodhandlingincreaseindividualinfrastructurelevelmanagementmeasuresmitigationnatural
SHARED TOKENS (30): "against", "analysis", "broader", "building", "changes", "concept", "control", "engineering", "events", "exposure", "flood", "handling", "increase", "individual", "infrastructure", "level", "management", "measures", "mitigation", "natural"....
0.300
amongassociationavailabilitybecomeconsumptiondevelopmentdistributionefficiencyenergyincreaseinternationallimitednationalnaturalpowerresourcessupplies
SHARED TOKENS (17): "among", "association", "availability", "become", "consumption", "development", "distribution", "efficiency", "energy", "increase", "international", "limited", "national", "natural", "power", "resources", "supplies".
0.300
appliedappliesapprovalassociationdecisionsdefinesdevelopmentenvironmentalgovernedinternationalmajormakingmanagementmoveparticipationplanplanspolicypotentialprocess
SHARED TOKENS (33): "applied", "applies", "approval", "association", "decisions", "defines", "development", "environmental", "governed", "international", "major", "making", "management", "move", "participation", "plan", "plans", "policy", "potential", "process"....
0.300
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcommissioncompetitiveconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesentity
SHARED TOKENS (43): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "commission", "competitive", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "entity"....
0.300
advancedamericanbuiltcapacitycentralchangesclassconnectconnectedconnectingconstructeddesignedevenincreasingnetworkplannedplanspropertyproposedprovide
SHARED TOKENS (35): "advanced", "american", "built", "capacity", "central", "changes", "class", "connect", "connected", "connecting", "constructed", "designed", "even", "increasing", "network", "planned", "plans", "property", "proposed", "provide"....
0.300
businessescapacitychangesconsumersconsumptioncostcustomercustomersdemanddirectdirectlyeconomicelectricelectricityenergyfullimplicationlargelineload
SHARED TOKENS (39): "businesses", "capacity", "changes", "consumers", "consumption", "cost", "customer", "customers", "demand", "direct", "directly", "economic", "electric", "electricity", "energy", "full", "implication", "large", "line", "load"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasternidahomajormilesnationalnearnorthwestofficialparallelplannedriverroadsrouterulesthroughoutwestwestern
SHARED TOKENS (18): "caldwell", "eastern", "idaho", "major", "miles", "national", "near", "northwest", "official", "parallel", "planned", "river", "roads", "route", "rules", "throughout", "west", "western".
0.300
Energy conservation ↗ KW CROSS HIGH
affectanothercomplexcomponentsconsumptionconvertcosteconomicefficiencyenergyengineeringenvironmentalformgasgrowthidentifylargeloadmaintenancemonitoring
SHARED TOKENS (32): "affect", "another", "complex", "components", "consumption", "convert", "cost", "economic", "efficiency", "energy", "engineering", "environmental", "form", "gas", "growth", "identify", "large", "load", "maintenance", "monitoring"....
0.300
Power station ↗ Q159719 KW CROSS HIGH
connectedcreatescurrentelectricelectricalelectricityenergyfacilityfieldgasgenerationindustrialnaturalpowersourcestations
SHARED TOKENS (16): "connected", "creates", "current", "electric", "electrical", "electricity", "energy", "facility", "field", "gas", "generation", "industrial", "natural", "power", "source", "stations".
0.300
becomebusinesscentralcommercialcreatingdevelopmentfinancialfundfundshistoryindependentindividualinstitutionsissuemultiplenameorganizationsownersprojectprojects
SHARED TOKENS (23): "become", "business", "central", "commercial", "creating", "development", "financial", "fund", "funds", "history", "independent", "individual", "institutions", "issue", "multiple", "name", "organizations", "owners", "project", "projects"....
0.300
acresboisecontainscontinueddistrictsfacilitiesfeethomeidaholandmanagedmilesmultiplenationalpercentrecreationresourcesriverwaterwest
SHARED TOKENS (20): "acres", "boise", "contains", "continued", "districts", "facilities", "feet", "home", "idaho", "land", "managed", "miles", "multiple", "national", "percent", "recreation", "resources", "river", "water", "west".
0.300
amongcapacitycommunitydistributedelectricelectricityemploymentenergyfarmsgasgenerationindividualindustrylocalmilesnearpercentplanspowerproject
SHARED TOKENS (31): "among", "capacity", "community", "distributed", "electric", "electricity", "employment", "energy", "farms", "gas", "generation", "individual", "industry", "local", "miles", "near", "percent", "plans", "power", "project"....
0.300
deliverydemanddirectlydistributionelectricelectricalelectricityelectrificationenergyforecastgasgenerationgrowthincreasingindustrymeansmethodpowerprimaryprocess
SHARED TOKENS (28): "delivery", "demand", "directly", "distribution", "electric", "electrical", "electricity", "electrification", "energy", "forecast", "gas", "generation", "growth", "increasing", "industry", "means", "method", "power", "primary", "process"....
0.300
amongcapacitycleancomplexconstructedconstructioncreatingdemanddirectelectricalelectricityenergyenvironmentalgasgenerationlandlargemakingnaturalnearly
SHARED TOKENS (35): "among", "capacity", "clean", "complex", "constructed", "construction", "creating", "demand", "direct", "electrical", "electricity", "energy", "environmental", "gas", "generation", "land", "large", "making", "natural", "nearly"....
0.300
adaboisebuiltconstructioncontroldirectlydownstreamelectricityengineersfederalfeetfloodfullgenerationidahoirrigationlakelevelmilesmultiple
SHARED TOKENS (28): "ada", "boise", "built", "construction", "control", "directly", "downstream", "electricity", "engineers", "federal", "feet", "flood", "full", "generation", "idaho", "irrigation", "lake", "level", "miles", "multiple"....
0.300
actadaagainstbusinesschangescivilcostsfinaljanuarylawnationalprotectionsprovidepublicrequirementsrequiresrights
SHARED TOKENS (17): "act", "ada", "against", "business", "changes", "civil", "costs", "final", "january", "law", "national", "protections", "provide", "public", "requirements", "requires", "rights".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycompetingcontrolelectricityinformationlevellocalnationalneedpositionedreducesignalssouthsystemsystemstechnologytraffic
SHARED TOKENS (18): "advanced", "capacity", "competing", "control", "electricity", "information", "level", "local", "national", "need", "positioned", "reduce", "signals", "south", "system", "systems", "technology", "traffic".
0.300
accordingadministrationboisebuiltcanyoncapacitycomplexcontainscontractordrainageenergyfallsfeetfinalgenerationidahoinformationlevellineoperated
SHARED TOKENS (26): "according", "administration", "boise", "built", "canyon", "capacity", "complex", "contains", "contractor", "drainage", "energy", "falls", "feet", "final", "generation", "idaho", "information", "level", "line", "operated"....
0.300
airbuildingcreatesenvironmentevengashazardhazardousidentificationmaterialspersonnelphysicalpropertypublicsafetysignagesubjectsystemthemwaste
SHARED TOKENS (20): "air", "building", "creates", "environment", "even", "gas", "hazard", "hazardous", "identification", "materials", "personnel", "physical", "property", "public", "safety", "signage", "subject", "system", "them", "waste".
0.300
announcedapprovedbillioncenterclasscorporationcreateitselfmilesnetworkoperatesoperatingplansprincipalprojectreachreportingroutesystemtransportation
SHARED TOKENS (23): "announced", "approved", "billion", "center", "class", "corporation", "create", "itself", "miles", "network", "operates", "operating", "plans", "principal", "project", "reach", "reporting", "route", "system", "transportation"....
0.300
Off-the-grid ↗ Q267162 KW CROSS HIGH
buildingbuildingscannotconnectedcostdesignedelectricalenergyenvironmentalfoodgasindependentitselfpublicreachreduceresidentialscalesewersmall
SHARED TOKENS (25): "building", "buildings", "cannot", "connected", "cost", "designed", "electrical", "energy", "environmental", "food", "gas", "independent", "itself", "public", "reach", "reduce", "residential", "scale", "sewer", "small"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
americanassociationbuildingcommercialdeterminefeetmethodprocesspublicrapidlyratesrequirementsresidentialstandardssuppliedsupplysystemtechnologywaterworks
SHARED TOKENS (20): "american", "association", "building", "commercial", "determine", "feet", "method", "process", "public", "rapidly", "rates", "requirements", "residential", "standards", "supplied", "supply", "system", "technology", "water", "works".
0.300
actadditionaladministrationadoptedannuallyapproximatelybillionbuiltcollectioncompleteconstructioncontinuedcontrolledcostcreatingdesigndesignedextendsfederalfund
SHARED TOKENS (48): "act", "additional", "administration", "adopted", "annually", "approximately", "billion", "built", "collection", "complete", "construction", "continued", "controlled", "cost", "creating", "design", "designed", "extends", "federal", "fund"....
0.300
accordingassociatedbuildingcapabilitycodecodescommissioncontrolcurrentdesigndesigneddistributionelectricelectricalenvironmentalexposureinstallationinternationallargelocal
SHARED TOKENS (35): "according", "associated", "building", "capability", "code", "codes", "commission", "control", "current", "design", "designed", "distribution", "electric", "electrical", "environmental", "exposure", "installation", "international", "large", "local"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationadoptedairanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycivilcodescommunicationscommunitycreatingdesigndevelopingdevelopment
SHARED TOKENS (72): "administration", "adopted", "air", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "civil", "codes", "communications", "community", "creating", "design", "developing", "development"....
0.300
accordingactivityanalysisbecomesboundariescalculationsdesignengineerengineeringengineersenvironmentlegallicenselicensedlocalmaintenanceplansprocessproductprofessional
SHARED TOKENS (37): "according", "activity", "analysis", "becomes", "boundaries", "calculations", "design", "engineer", "engineering", "engineers", "environment", "legal", "license", "licensed", "local", "maintenance", "plans", "process", "product", "professional"....
0.300
Sewage treatment ↗ KW CROSS HIGH
advancedapplicationapproximatelyavailabilitybusinessescentralizedconnectedconstructioncontainscostsdemanddesigndevelopingdifferentdischargedrainageenergyengineersenvironmenteven
SHARED TOKENS (50): "advanced", "application", "approximately", "availability", "businesses", "centralized", "connected", "construction", "contains", "costs", "demand", "design", "developing", "different", "discharge", "drainage", "energy", "engineers", "environment", "even"....
0.300
competedistributiondrainselectricitygaslinesmajornationalnaturalpipelinesprocesspublicstreettrafficutilitywater
SHARED TOKENS (16): "compete", "distribution", "drains", "electricity", "gas", "lines", "major", "national", "natural", "pipelines", "process", "public", "street", "traffic", "utility", "water".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
adoptedappliedapplyapprovedauthoritybecomesbuildingbuildingschargescodecodescomplianceconstructioncontroldepartmentsdesigndevelopersdistrictelectricalengineers
SHARED TOKENS (47): "adopted", "applied", "apply", "approved", "authority", "becomes", "building", "buildings", "charges", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "district", "electrical", "engineers"....
0.300
airbuildingbuildingscontrolcostsdesigndesignedefficiencyelectricalenergyengineersenvironmentalevaluateintegratemaintenancemodelingoperatingperformanceprojectsprovide
SHARED TOKENS (26): "air", "building", "buildings", "control", "costs", "design", "designed", "efficiency", "electrical", "energy", "engineers", "environmental", "evaluate", "integrate", "maintenance", "modeling", "operating", "performance", "projects", "provide"....
0.300
changescontrolcontrolledcontrolsdownstreamequipmentgasintendedlevelmaintainsmechanismparallelplacingpressureprovidereductionregulatedresponseseparatevalue
SHARED TOKENS (20): "changes", "control", "controlled", "controls", "downstream", "equipment", "gas", "intended", "level", "maintains", "mechanism", "parallel", "placing", "pressure", "provide", "reduction", "regulated", "response", "separate", "value".
0.300
buildingscommercialdirectlydrainsindustrialinfrastructuremunicipalitiesseparateservedservingsewersurfacesystemsystemstreatmenturban
SHARED TOKENS (16): "buildings", "commercial", "directly", "drains", "industrial", "infrastructure", "municipalities", "separate", "served", "serving", "sewer", "surface", "system", "systems", "treatment", "urban".
0.300
actactiveadministeredagenciesairapproximatelyauthoritybillionbuildingbusinesscanalscapacitycivilcleancomponentsconstituteconstructioncontroldepartmentdesign
SHARED TOKENS (66): "act", "active", "administered", "agencies", "air", "approximately", "authority", "billion", "building", "business", "canals", "capacity", "civil", "clean", "components", "constitute", "construction", "control", "department", "design"....
0.300
consumptiondesignedeconomyefficiencyelectricalenergynetperformancepotentialpowerprocessproducessourcetransportationvisiblework
SHARED TOKENS (16): "consumption", "designed", "economy", "efficiency", "electrical", "energy", "net", "performance", "potential", "power", "process", "produces", "source", "transportation", "visible", "work".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationbuildingsconnectdevelopmenteasementsevenfeefinalfullfunctionslandlegalmunicipalitiesownersownershippowerprivateproperty
SHARED TOKENS (29): "acquisition", "another", "application", "buildings", "connect", "development", "easements", "even", "fee", "final", "full", "functions", "land", "legal", "municipalities", "owners", "ownership", "power", "private", "property"....
0.300
boisecrossdesignateddowntownfallshomeidaholinemajormetropolitanmilesnearnorthwestriverrouteserves
SHARED TOKENS (16): "boise", "cross", "designated", "downtown", "falls", "home", "idaho", "line", "major", "metropolitan", "miles", "near", "northwest", "river", "route", "serves".
0.300
airanotherbecomesbeyondcapacityconnectedcostdemandeconomiceconomicselectricalelectricityenergyformlargeloadmakingmanagementneedneeded
SHARED TOKENS (29): "air", "another", "becomes", "beyond", "capacity", "connected", "cost", "demand", "economic", "economics", "electrical", "electricity", "energy", "form", "large", "load", "making", "management", "need", "needed"....
0.300
civilconstructiondesignengineeringengineersfuturemaintenancematerialsoperationplanningprofessionalroadsstandardsstructuraltraffictransportation
SHARED TOKENS (16): "civil", "construction", "design", "engineering", "engineers", "future", "maintenance", "materials", "operation", "planning", "professional", "roads", "standards", "structural", "traffic", "transportation".
0.300
Solar power ↗ Q1483757 KW CROSS HIGH
applicationsbuiltcapacitycommercialcontinuingconvertcostcurrentdirectlyelectricelectricityelectrificationenergyfinancinggenerationintegrationinternationallargemethodmitigation
SHARED TOKENS (34): "applications", "built", "capacity", "commercial", "continuing", "convert", "cost", "current", "directly", "electric", "electricity", "electrification", "energy", "financing", "generation", "integration", "international", "large", "method", "mitigation"....
0.300
additionaladvancedagenciesbusinessescontactdepartmentdevelopingdispatchemergencyfacilitieshospitalmedicalmodeloperatepersonnelprimaryprovideprovidingpublicqualification
SHARED TOKENS (35): "additional", "advanced", "agencies", "businesses", "contact", "department", "developing", "dispatch", "emergency", "facilities", "hospital", "medical", "model", "operate", "personnel", "primary", "provide", "providing", "public", "qualification"....
0.300
acresboisecanalcapacitycomponentsdesigneddistrictfarmlandgenerationidahoirrigationnamenampanationalnearprogramprojectproviderivertreasure
SHARED TOKENS (23): "acres", "boise", "canal", "capacity", "components", "designed", "district", "farmland", "generation", "idaho", "irrigation", "name", "nampa", "national", "near", "program", "project", "provide", "river", "treasure"....
0.300
actagricultureamericanapproximatelyboardboisecapacitycentercompletionconstructiondesignfallsfeethomeidahoirrigationlaborlawlevelmaterials
SHARED TOKENS (37): "act", "agriculture", "american", "approximately", "board", "boise", "capacity", "center", "completion", "construction", "design", "falls", "feet", "home", "idaho", "irrigation", "labor", "law", "level", "materials"....
0.300
administrationagenciesamongchangescompliancecontrolcurrentdefinesdepartmentdesigndesignedfederallawlocalnationalownedplacementprivatelypublicrequires
SHARED TOKENS (27): "administration", "agencies", "among", "changes", "compliance", "control", "current", "defines", "department", "design", "designed", "federal", "law", "local", "national", "owned", "placement", "privately", "public", "requires"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacitydefinitionsdifferentformindividuallinemeaningmultipleoperateoperatesoperatingoperationsright-of-wayrights-of-waysystemsystemstechnologytraffic
SHARED TOKENS (23): "broader", "capability", "capacity", "definitions", "different", "form", "individual", "line", "meaning", "multiple", "operate", "operates", "operating", "operations", "right-of-way", "rights-of-way", "system", "systems", "technology", "traffic"....
0.300
announcedauthorizationcenterdepartmentdevelopmentefficiencyenergyhomeintegrationnamenationaloperatedresearchsystemstechnologytransportation
SHARED TOKENS (16): "announced", "authorization", "center", "department", "development", "efficiency", "energy", "home", "integration", "name", "national", "operated", "research", "systems", "technology", "transportation".
0.300
capacitycustomersdistributionelectricelectricalelectricitylinelinesneededpowerstationsstructuresupportutilitywater
SHARED TOKENS (15): "capacity", "customers", "distribution", "electric", "electrical", "electricity", "line", "lines", "needed", "power", "stations", "structure", "support", "utility", "water".
0.300
accordingauthoritybasebecomesbusinesscapitalcommunityconsumercooperativecostcustomerdeliverydistributedelectricelectricityenergyformfundgenerationgoverned
SHARED TOKENS (47): "according", "authority", "base", "becomes", "business", "capital", "community", "consumer", "cooperative", "cost", "customer", "delivery", "distributed", "electric", "electricity", "energy", "form", "fund", "generation", "governed"....
0.300
communitycompletedesigndesignedeconomicengineersenvironmentalhomeoperatedplannedpolicypublicrequiressafesafetytraffictransportationurban
SHARED TOKENS (18): "community", "complete", "design", "designed", "economic", "engineers", "environmental", "home", "operated", "planned", "policy", "public", "requires", "safe", "safety", "traffic", "transportation", "urban".
0.300
commercialconnectconnectedconsumerscustomercustomersdeliverydirectlydistributionelectricelectricityequipmentfinalfunctionsindividualindustriallevellightinglinesmultiple
SHARED TOKENS (29): "commercial", "connect", "connected", "consumers", "customer", "customers", "delivery", "directly", "distribution", "electric", "electricity", "equipment", "final", "functions", "individual", "industrial", "level", "lighting", "lines", "multiple"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
agriculturecapitalcommercialcommunitycostcostsdependdifferentenergyinstitutionalirrigationlargepersonnelpolicypressureproviderspublicqualityregulationresponsibility
SHARED TOKENS (31): "agriculture", "capital", "commercial", "community", "cost", "costs", "depend", "different", "energy", "institutional", "irrigation", "large", "personnel", "policy", "pressure", "providers", "public", "quality", "regulation", "responsibility"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralchargesconnectingdifferentdistrictselectricinsidelinelinesmetropolitanmultipleoperateoperatespricingregionalsystemsurban
SHARED TOKENS (18): "business", "central", "charges", "connecting", "different", "districts", "electric", "inside", "line", "lines", "metropolitan", "multiple", "operate", "operates", "pricing", "regional", "systems", "urban".
0.300
activebatterycapacityconnectioncontrolcostcostscustomerdeliveriesdemanddesigneddispatchelectricelectricalelectricityenergyevenextendingfacilityform
SHARED TOKENS (43): "active", "battery", "capacity", "connection", "control", "cost", "costs", "customer", "deliveries", "demand", "designed", "dispatch", "electric", "electrical", "electricity", "energy", "even", "extending", "facility", "form"....
🫐 BERRY35 edges
0.280
capitalcostcostsdistributionelectricelectricalincreaselinelinesoperatingpowerqualityreducesupply
SHARED TOKENS (14): "capital", "cost", "costs", "distribution", "electric", "electrical", "increase", "line", "lines", "operating", "power", "quality", "reduce", "supply".
0.280
Solar inverter ↗ Q129316 KW CROSS HIGH
allowingcommercialcriticalcurrentdirectelectricalequipmentfunctionslocalnetworkordinarypowersystemutility
SHARED TOKENS (14): "allowing", "commercial", "critical", "current", "direct", "electrical", "equipment", "functions", "local", "network", "ordinary", "power", "system", "utility".
0.280
americandepartmentdepartmentsdirectlyeconomyexecutivefederalmovementplansafeservingstrategicsystemtransportation
SHARED TOKENS (14): "american", "department", "departments", "directly", "economy", "executive", "federal", "movement", "plan", "safe", "serving", "strategic", "system", "transportation".
0.280
applicationdesignengineeringfacilitiesfieldmanagementmovementoccupationaloperationplanningprovidesafetechnologytransportation
SHARED TOKENS (14): "application", "design", "engineering", "facilities", "field", "management", "movement", "occupational", "operation", "planning", "provide", "safe", "technology", "transportation".
0.260
agriculturalamericanconstitutefullindustriallegalmerelyownershiprightssourcesubsequentsystemwater
SHARED TOKENS (13): "agricultural", "american", "constitute", "full", "industrial", "legal", "merely", "ownership", "rights", "source", "subsequent", "system", "water".
0.260
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahometropolitannamepopulationrapidlyschoolschoolssharedwest
SHARED TOKENS (13): "ada", "boise", "canyon", "district", "idaho", "metropolitan", "name", "population", "rapidly", "school", "schools", "shared", "west".
0.260
approximatelydesignedfacilitiesfacilityinfrastructuremunicipalproducespropertypublicservedsystemstreatmentwestern
SHARED TOKENS (13): "approximately", "designed", "facilities", "facility", "infrastructure", "municipal", "produces", "property", "public", "served", "systems", "treatment", "western".
0.260
collegecommunitydifferenteducationforminstitutionspolicyprogramsschoolstudentstransferuniversityworkforce
SHARED TOKENS (13): "college", "community", "different", "education", "form", "institutions", "policy", "programs", "school", "students", "transfer", "university", "workforce".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
airconstructionequipmentindustrialinfrastructurelargelegalloadloadsordinarystandardtransportationwater
SHARED TOKENS (13): "air", "construction", "equipment", "industrial", "infrastructure", "large", "legal", "load", "loads", "ordinary", "standard", "transportation", "water".
0.240
agricultureconstructioncontrolcontrollingcontrolsdevelopmenthabitatlandpropertyriversurfacewater
SHARED TOKENS (12): "agriculture", "construction", "control", "controlling", "controls", "development", "habitat", "land", "property", "river", "surface", "water".
0.220
annuallyenvironmenthazardousinternationallocalmaterialsmillionnationalproducesregulatedwaste
SHARED TOKENS (11): "annually", "environment", "hazardous", "international", "local", "materials", "million", "national", "produces", "regulated", "waste".
0.220
connectingdesignedlocalmajormoveprovideresidentialroadsservestrafficwider
SHARED TOKENS (11): "connecting", "designed", "local", "major", "move", "provide", "residential", "roads", "serves", "traffic", "wider".
0.200
suez
EXACT TITLE in energy_utilities: "Suez (disambiguation)".
0.200
Garden City, Idaho ↗ KW CROSS HIGH
adaboiseidahometropolitanmunicipalnamenearlypopulationseparatestreet
SHARED TOKENS (10): "ada", "boise", "idaho", "metropolitan", "municipal", "name", "nearly", "population", "separate", "street".
0.200
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedeasternidaholimitedmilesroutesouthsystemwestwestern
SHARED TOKENS (10): "continued", "eastern", "idaho", "limited", "miles", "route", "south", "system", "west", "western".
0.200
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahometropolitannampapopulationruralwestern
SHARED TOKENS (10): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "nampa", "population", "rural", "western".
0.200
codefoodmunicipalmunicipalitiesmunicipalitypublicroleseparatelyunionwaste
SHARED TOKENS (10): "code", "food", "municipal", "municipalities", "municipality", "public", "role", "separately", "union", "waste".
0.200
collectionfacilitymanagementmaterialsmunicipalprocessprogramtransfertreatmentwaste
SHARED TOKENS (10): "collection", "facility", "management", "materials", "municipal", "process", "program", "transfer", "treatment", "waste".
0.200
Bike lane ↗ Q1378400 KW CROSS HIGH
advisorybusinesseseconomicentrylineresearchsafetyshowstrafficvehicles
SHARED TOKENS (10): "advisory", "businesses", "economic", "entry", "line", "research", "safety", "shows", "traffic", "vehicles".
0.180
Effluent ↗ Q1057706 KW CROSS HIGH
differentdirectlyfacilityindustrialriversourcesurfacetreatedwaste
SHARED TOKENS (9): "different", "directly", "facility", "industrial", "river", "source", "surface", "treated", "waste".
0.160
canyonconnectingeagleidahomeridiannamparivervalley
SHARED TOKENS (8): "canyon", "connecting", "eagle", "idaho", "meridian", "nampa", "river", "valley".
0.160
airamericancommercialenvironmentinternationallandphysicalprocess
SHARED TOKENS (8): "air", "american", "commercial", "environment", "international", "land", "physical", "process".
0.160
corporationcountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (8): "corporation", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.160
Park and ride ↗ Q738031 KW CROSS HIGH
connectionslargemetropolitanpoolpublicsystemtransfervehicles
SHARED TOKENS (8): "connections", "large", "metropolitan", "pool", "public", "system", "transfer", "vehicles".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
agriculturalidaholandmajormilesnorthwestriver
SHARED TOKENS (7): "agricultural", "idaho", "land", "major", "miles", "northwest", "river".
0.140
formalprocesspublicratesregulatoryutilitiesutility
SHARED TOKENS (7): "formal", "process", "public", "rates", "regulatory", "utilities", "utility".
0.140
commercialhazardouslargelicensematerialsoperatevehicles
SHARED TOKENS (7): "commercial", "hazardous", "large", "license", "materials", "operate", "vehicles".
0.140
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulationwilder
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "nampa", "population", "wilder".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
costshandlingitselfmethodmultipletransportation
SHARED TOKENS (6): "costs", "handling", "itself", "method", "multiple", "transportation".
0.100
adaconnectingcountiesidahoroute
SHARED TOKENS (5): "ada", "connecting", "counties", "idaho", "route".
0.100
airamericanboiseidaholines
SHARED TOKENS (5): "air", "american", "boise", "idaho", "lines".
0.100
Axle load ↗ Q340755 KW CROSS HIGH
connecteddesigndesignedengineeringload
SHARED TOKENS (5): "connected", "design", "designed", "engineering", "load".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Energy Utilities × Transportation Infrastructure — Treasure Valley
HAIKU · HIGH GATE
How do electric power transmission lines in Ada County affect road planning for the Treasure Valley?
Electric power transmission corridors crossing Ada County require coordination with transportation departments to ensure roads do not interfere with utility infrastructure. Civil engineering projects in Boise and Nampa must account for existing transmission easements when designing new road networks or expanding public works.
What role do energy utilities play in supporting public transportation infrastructure development in the Treasure Valley?
Energy utilities in the Treasure Valley provide electrical power to public transportation systems and infrastructure operated across Boise, Nampa, and Caldwell. The expanding metropolitan population requires utilities and transportation agencies to coordinate infrastructure expansion to serve growing demand in Ada County.
How do apprenticeship programs connect energy utilities and transportation infrastructure workers in Idaho?
College of Western Idaho and Boise State University offer apprenticeship programs that train workers in both electrical utility maintenance and civil engineering for transportation projects across the Treasure Valley. These programs prepare professionals to work on projects where utility lines cross roads and highways throughout Ada County and surrounding areas.
Why do energy utilities and transportation agencies coordinate under the Clean Water Act in the Treasure Valley?
The United States Environmental Protection Agency enforces Clean Water Act standards that affect how both energy utilities and transportation infrastructure operate near the Snake River and other waterways in the Treasure Valley. Utility substations and roads in Boise, Nampa, and Caldwell must meet environmental requirements that prevent contamination of water resources in Ada County.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Energy Utilities × Transportation Infrastructure 19 QID bridges 253 edges 6,652 ext links 2026-07-17 20:42:23 UTC a2d07a48229e8e93
Energy Utilities corridor ↗ Transportation Infrastructure corridor ↗ Transportation Infrastructure × Energy Utilities ↗ boisestandard.org/standard ↗
Parent Corridors
Energy Utilities × All Other Verticals