—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Energy Utilities ↔ relates to ↔ Outdoor Recreation

10 Wikipedia bridge articles confirmed in both vertical ledgers. 211 deterministic cross-vertical edges. 5,511 external source links harvested. Every edge provenance-stamped. Every claim auditable.

10 QID Bridge Articles
211 Cross Edges
5,511 External Sources
240 Wikipedia Articles
12 🌲 Evergreen
131 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Energy Utilities
× Outdoor Recreation
QID Bridge Articles
10
confirmed Wikipedia overlap
Total Cross Edges
211
External Sources Harvested
5,511
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Bureau of Reclamation
score: 1.0000  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (10)
Bureau of ReclamationBoise National ForestTreasure ValleyBoise RiverBoise, IdahoAda County, IdahoMeridian, IdahoEagle, IdahoKuna, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahoadamilesriverwesternhomecapitalacreslandswatercascadefeetlandresourceslocalsnaketreasurevalleydowntown
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:41:05 UTC
Content Hash
30dec4df026402ff
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
10 BRIDGES
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in energy_utilities (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (19): "acres", "become", "built", "bureau", "department", "development", "federal", "lands", "law", "management", "million", "reclamation", "resource", "revenue", "source", "specifically", "throughout", "water", "western". | EXACT TITLE in energy_utilities: "Bureau of Reclamation". | EXACT TITLE in outdoor_recreation: "Bureau of Reclamation".
acresbecomebuiltbureaudepartmentdevelopmentfederallandslawmanagementmillionreclamationresourcerevenuesourcespecificallythroughoutwaterwestern
power generation. It is currently the U.S.'s largest wholesaler of water, bringing water to more than 31 million people, and providing one in five Western farmers with irrigation water for 10 million acres of farmland, which produce 60% of the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding. Because Texas had no federal lands, it did not become a Reclamation state until 1906, when Congress passed a law including it in the provisions of the Reclamation Act. History From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
Boise National Forest
Q891075 EXACT TITLE 1.000
QID OVERLAP: Q891075 in energy_utilities (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (20): "acres", "boise", "cascade", "districts", "facilities", "feet", "home", "idaho", "land", "managed", "miles", "multiple", "national", "plant", "recreation", "reservoirs", "resources", "river", "water", "west". | EXACT TITLE in outdoor_recreation: "Boise National Forest".
acresboisecascadedistrictsfacilitiesfeethomeidaholandmanagedmilesmultiplenationalplantrecreationreservoirsresourcesriverwaterwest
Boise National Forest is a National Forest covering 2,203,703 acres (8,918.07 km2) of the U.S. state of Idaho. Created on July 1, 1908, from part of Sawtooth National Forest, it is managed by the U.S. Forest Service as five units: the Cascade, Emmett, Idaho City, Lowman, and Mountain Home ranger districts. The Idaho Batholith underlies most of Boise National Forest, forming the forest's Boise, Salmon River, and West mountain ranges; the forest reaches a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
s a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
Archaeological evidence indicates that human habitation in Idaho began towards the end of the last ice age: bone fragments about 10,000 years old have been found in Wilson Butte Cave, an inflationary cave on the Snake River Plain believed to have been occupied by indigenous people until as recently as the 17th century. A change of climate around 7000 years ago dried up much of the Great Basin, forcing the Shoshone people northward into the mountainous areas of central Idaho. Most of what is now Boise National Forest was sparsely inhabited by Native Americans, and several archaeological sites, including campsites, rock shelters, burial grounds, and pictographs have been found along rivers in the area. Trappers and fur traders of European descent first arrived in the area in the early 1800s, starting with John Jacob Astor's Pacific Fur Company in October 1811. Donald Mackenzie and Francois Payette trapped in the area of Boise National Forest in 1819. By 1840, the fur trade was coming to an end, but the westward migration on the Oregon Trail, which passed south of the forest, was beginning. The first settlers moved into the mountains in the 1860s after gold was discovered in Idaho, which forced many of the Shoshone out and led to conflicts throughout the state, including the Bannock War in southern Idaho. Prospectors George Grimes and Moses Splawn were the first to discover gold in the forest at the eponymous Grimes Creek on August 2, 1862. Subsequent gold discoveries at Rocky Bar in 1863 and Atlanta in 1864 increased the rush of people to Idaho, and in 1863 Idaho City, with a population of 6,267, surpassed Portland, Oregon as the largest city in the Pacific Northwest. The Idaho gold rush was largely over by 1870, and the population of the Boise Basin fell from 16,000 to 3,500. In 1898 the forest's first gold dredge was built in Placerville and followed by several others. By 1951, when the last dredges shut down, at least 2.3 million ounces (65.2 million grams) of gold had been produced from the Boise Basin area. Silver was mined along the Crooked River from 1882 until 1921, but a silver mine at Silver Mountain proved unsuccessful. Following a shortage of mercury during World War II, mines in the Stibnite area became the country's largest producer of tungsten and second largest source of mercury. The most important known placer deposit of niobium and tantalum in the United States is located in Bear Valley. From 1953 until 1959, dredges there produced $12.5 million ($138 million today) in niobium, tantalum, and uranium. Other minerals mined in the forest include antimony and molybdenum. U.S. Forest Service Boise National Forest was created on July 1, 1908, from part of Sawtooth National Forest, and originally covered 1,147,360 acres (4,643.2 km2). By the Forest Reserve Act of 1891, the U.S. Congress granted the U.S. President the authority to establish forest reserves out of Public Domain Lands that were subject to disposal (homesteads, sales, etc.) administered by the United States General Land Office, which had been placed under the authority of the U.S. Department of the Interior in 1849. With the passage of the Transfer Act of 1905, forest reserves were transferred to the U.S. Department of Agriculture in the newly created U.S. Forest Service. Present-day Boise National Forest was first protected as part of two forest reserves by proclamations issued by President Theodore Roosevelt: Sawtooth Forest Reserve (created on May 29, 1905, and expanded on November 6, 1906) and Payette Forest Reserve (created on June 3, 1905). After forest reserves were renamed national forests in 1908, Boise National Forest was split from Sawtooth National Forest into an independent national forest. Emile Grandjean was the forest's first supervisor, serving from 1908 to 1922. On April 1, 1944, the entirety of what was then Payette National Forest was transferred to Boise National Forest, and simultaneously Weiser and Idaho national forests were combined to reestablish the present-day Payette National Forest, which is to the north of Boise National Forest. In 1933 the Boise Basin Experimental Forest was created on 8,740 acres (35.4 km2) of the forest near Idaho City to study the management of ponderosa pine. The Lucky Peak Nursery was established in 1959 to produce trees for planting on burned or logged lands on the national forests of the Intermountain region. After the creation of the Civilian Conservation Corps (CCC) in 1933, nine camps and eight subcamps were set up in Boise National Forest, but the number of camps was reduced from 1934 until the program was closed in 1942.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in energy_utilities (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (12): "boise", "idaho", "land", "local", "name", "region", "resources", "river", "snake", "treasure", "valley", "western". | EXACT TITLE in energy_utilities: "Treasure Valley". | EXACT TITLE in outdoor_recreation: "Treasure Valley".
boiseidaholandlocalnameregionresourcesriversnaketreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise River
Q891080 EXACT TITLE 0.900
QID OVERLAP: Q891080 in energy_utilities (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (10): "approximately", "boise", "idaho", "lands", "miles", "river", "snake", "urban", "watershed", "western". | EXACT TITLE in energy_utilities: "Boise River". | EXACT TITLE in outdoor_recreation: "Boise River".
approximatelyboiseidaholandsmilesriversnakeurbanwatershedwestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in energy_utilities (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (15): "ada", "boise", "capital", "downtown", "feet", "home", "idaho", "locally", "major", "miles", "nevada", "north", "river", "treasure", "valley".
adaboisecapitaldowntownfeethomeidaholocallymajormilesnevadanorthrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in energy_utilities (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (12): "ada", "behind", "boise", "capital", "cascade", "district", "home", "idaho", "jurisdiction", "local", "private", "roads".
adabehindboisecapitalcascadedistricthomeidahojurisdictionlocalprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in energy_utilities (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (6): "ada", "among", "boise", "capital", "idaho", "meridian".
adaamongboisecapitalidahomeridian
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in energy_utilities (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "miles".
adaboisedowntowneagleidahomiles
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Kuna, Idaho
Q1515177 QID OVERLAP 0.600
QID OVERLAP: Q1515177 in energy_utilities (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "kuna".
adaadditionalboiseidahokuna
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in energy_utilities (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "nampa".
boisecaldwellcanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
201 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP201 edges
🌲 EVERGREEN2 edges
0.650
acresadaapproximatelyboisecanyoncapacitycubicdamfeetidahomilesmultipleriversystemtreasurevalleywaterwestern
SHARED TOKENS (18): "acres", "ada", "approximately", "boise", "canyon", "capacity", "cubic", "dam", "feet", "idaho", "miles", "multiple", "river", "system", "treasure", "valley", "water", "western". | URL->A (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in energy_utilities: "New York Canal".
0.650
acresadaadditionalbehindboisebureaucanyonconservationcreatingcubicdamdifferentfeethomeidaholandlandsmainmanagedmanagement
SHARED TOKENS (39): "acres", "ada", "additional", "behind", "boise", "bureau", "canyon", "conservation", "creating", "cubic", "dam", "different", "feet", "home", "idaho", "land", "lands", "main", "managed", "management".... | URL->B (1): https://www.blm.gov/programs/national-conservation-lands/idaho/morley-nelson-snake-river-birds-of-prey. | EXACT TITLE in outdoor_recreation: "Morley Nelson Snake River Birds of Prey National Conservation Area".
🌿 BRANCH131 edges
0.550
boiseidaholandmilesnationaloperatedorganizationprivaterecreationwestern
SHARED TOKENS (10): "boise", "idaho", "land", "miles", "national", "operated", "organization", "private", "recreation", "western". | URL->B (1): http://www.bogusbasin.org/. | EXACT TITLE in outdoor_recreation: "Bogus Basin".
0.500
Well ↗ Q43483 EXACT TITLE
anotherclassesconstructioncreatedateenvironmentalpointproviderequireresourcessitestructurevarywaterworld
SHARED TOKENS (15): "another", "classes", "construction", "create", "date", "environmental", "point", "provide", "require", "resources", "site", "structure", "vary", "water", "world". | EXACT TITLE in energy_utilities: "Well". | EXACT TITLE in outdoor_recreation: "Well".
0.500
Tariff ↗ EXACT TITLE
againstamongconsumersdesigneddistributedeconomiceconomyformgrowthlocalmeansnationalnearprotectproviderevenuesource
SHARED TOKENS (17): "against", "among", "consumers", "designed", "distributed", "economic", "economy", "form", "growth", "local", "means", "national", "near", "protect", "provide", "revenue", "source". | EXACT TITLE in energy_utilities: "Tariff".
0.500
acresagenciesamongapproximatelybureauconservationdepartmentdescribedestateexistingfederalidaholandlandsmanagementmanagesmilesmillionnationalnevada
SHARED TOKENS (28): "acres", "agencies", "among", "approximately", "bureau", "conservation", "department", "described", "estate", "existing", "federal", "idaho", "land", "lands", "management", "manages", "miles", "million", "national", "nevada".... | EXACT TITLE in outdoor_recreation: "Bureau of Land Management".
0.500
Wildfire ↗ Q169950 EXACT TITLE
changecreatecreatesdirecteconomicequipmentexamplefiregrowthheatlandlevelsmanagementmitigationnaturalphysicalplantriskurbanwater
SHARED TOKENS (21): "change", "create", "creates", "direct", "economic", "equipment", "example", "fire", "growth", "heat", "land", "levels", "management", "mitigation", "natural", "physical", "plant", "risk", "urban", "water".... | EXACT TITLE in energy_utilities: "Wildfire". | EXACT TITLE in outdoor_recreation: "Wildfire".
0.500
communitydifferentdistributeddistributiondistrictenvironmentalflowincreasinglymajormakesmanagedmeansmultiplenetworkrelationshipsrequirerequiresresilienceresourcesrole
SHARED TOKENS (23): "community", "different", "distributed", "distribution", "district", "environmental", "flow", "increasingly", "major", "makes", "managed", "means", "multiple", "network", "relationships", "require", "requires", "resilience", "resources", "role".... | EXACT TITLE in energy_utilities: "Distributed generation".
0.500
Groundwater ↗ Q161598 EXACT TITLE
annuallybecomecapacitycentralchangecleandistributionenvironmentalexampleformformationlandmajormultiplemunicipaloperatingprimaryprovidepublicreservoirs
SHARED TOKENS (25): "annually", "become", "capacity", "central", "change", "clean", "distribution", "environmental", "example", "form", "formation", "land", "major", "multiple", "municipal", "operating", "primary", "provide", "public", "reservoirs".... | EXACT TITLE in energy_utilities: "Groundwater".
0.500
Natural gas ↗ Q40858 EXACT TITLE
adoptionassetschainchangecommercialcubicfeetformedheatinfrastructurelong-termmajornaturalsmallstandardthroughouttransportationwater
SHARED TOKENS (18): "adoption", "assets", "chain", "change", "commercial", "cubic", "feet", "formed", "heat", "infrastructure", "long-term", "major", "natural", "small", "standard", "throughout", "transportation", "water". | EXACT TITLE in energy_utilities: "Natural gas".
0.500
Pipeline ↗ Q25471856 EXACT TITLE
channelsconstructiondesignenvironmentalevenmainmarketmilesmillionnaturalnetworknorthplannedplanningsystemsystemstransportationwater
SHARED TOKENS (18): "channels", "construction", "design", "environmental", "even", "main", "market", "miles", "million", "natural", "network", "north", "planned", "planning", "system", "systems", "transportation", "water". | EXACT TITLE in energy_utilities: "Pipeline".
0.500
administrationapplyenvironmentalfederalfoodlawprimaryprivateprotectionpublicqualitysafesystemsystemswater
SHARED TOKENS (15): "administration", "apply", "environmental", "federal", "food", "law", "primary", "private", "protection", "public", "quality", "safe", "system", "systems", "water". | EXACT TITLE in energy_utilities: "Safe Drinking Water Act".
0.500
agencieschangecommunitydevelopmentdifferenteconomiceconomyeducationalemergencyenforcementenvironmentenvironmentalfacilitiesgreeninfrastructurelawmanagementofficialparksphysical
SHARED TOKENS (31): "agencies", "change", "community", "development", "different", "economic", "economy", "educational", "emergency", "enforcement", "environment", "environmental", "facilities", "green", "infrastructure", "law", "management", "official", "parks", "physical".... | EXACT TITLE in energy_utilities: "Infrastructure". | EXACT TITLE in outdoor_recreation: "Infrastructure".
0.500
becomebenefitscapacitychangecleancurrentenvironmentalevenexpansionfinancialgreenheatlandlocalmainmajornaturalneedpointproviders
SHARED TOKENS (29): "become", "benefits", "capacity", "change", "clean", "current", "environmental", "even", "expansion", "financial", "green", "heat", "land", "local", "main", "major", "natural", "need", "point", "providers".... | EXACT TITLE in energy_utilities: "Renewable energy".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalbuiltcleanconstructioncriticaldamdesigndownstreamflowhazardlandlifemaintenancemanagementprojectproviderecreationreservoirreservoirsriver
SHARED TOKENS (29): "additional", "built", "clean", "construction", "critical", "dam", "design", "downstream", "flow", "hazard", "land", "life", "maintenance", "management", "project", "provide", "recreation", "reservoir", "reservoirs", "river".... | EXACT TITLE in energy_utilities: "Dam". | EXACT TITLE in outdoor_recreation: "Dam".
0.500
State park ↗ Q1761072 EXACT TITLE
administrationconservationdesignededucationalentitiesexperiencefederalhistorylocalmanagednationalnaturalparkspreservepreservingprogramsratherregionalresourcessouth
SHARED TOKENS (22): "administration", "conservation", "designed", "educational", "entities", "experience", "federal", "history", "local", "managed", "national", "natural", "parks", "preserve", "preserving", "programs", "rather", "regional", "resources", "south".... | EXACT TITLE in outdoor_recreation: "State park".
0.500
acresadaboisedamdiscoveryengineershomeidaholuckymilesnearpeakpointpublicrecreationriverwaters
SHARED TOKENS (17): "acres", "ada", "boise", "dam", "discovery", "engineers", "home", "idaho", "lucky", "miles", "near", "peak", "point", "public", "recreation", "river", "waters". | EXACT TITLE in outdoor_recreation: "Lucky Peak State Park".
0.500
Heat pump ↗ Q131313 EXACT TITLE
adoptionanotherchangedependsdesigneddistrictheatmeansmillionmitigationnaturalneedoperatesratherrolesourcespecificallysystemsystemstoward
SHARED TOKENS (22): "adoption", "another", "change", "depends", "designed", "district", "heat", "means", "million", "mitigation", "natural", "need", "operates", "rather", "role", "source", "specifically", "system", "systems", "toward".... | EXACT TITLE in energy_utilities: "Heat pump".
0.500
beyondboiseconnectsdamdedicatedeaglegreenidaholuckymilesmunicipalitiesparkspeakriversystemtransportationurbanwest
SHARED TOKENS (18): "beyond", "boise", "connects", "dam", "dedicated", "eagle", "green", "idaho", "lucky", "miles", "municipalities", "parks", "peak", "river", "system", "transportation", "urban", "west". | EXACT TITLE in outdoor_recreation: "Boise River Greenbelt".
0.500
boisebureaudamengineersfeetidaholuckynationaloperatedpeakprimaryprovidereclamationreservoirriverupstreamwaterwestern
SHARED TOKENS (18): "boise", "bureau", "dam", "engineers", "feet", "idaho", "lucky", "national", "operated", "peak", "primary", "provide", "reclamation", "reservoir", "river", "upstream", "water", "western". | EXACT TITLE in energy_utilities: "Arrowrock Dam".
0.500
agenciesbureaubusinessescoordinationcurrentdatadepartmenteconomicfederallevelslifelocalmajormanagementneedofficepublicqualityresourcesystem
SHARED TOKENS (20): "agencies", "bureau", "businesses", "coordination", "current", "data", "department", "economic", "federal", "levels", "life", "local", "major", "management", "need", "office", "public", "quality", "resource", "system". | EXACT TITLE in energy_utilities: "Bureau of Labor Statistics".
0.500
assetsbroadercapitalcategorycommunityconstructiondirectlyeconomicemploymentenvironmentalerosionfacilitieshabitatinfrastructurelong-termmunicipaloperatorparksphysicalprivate
SHARED TOKENS (27): "assets", "broader", "capital", "category", "community", "construction", "directly", "economic", "employment", "environmental", "erosion", "facilities", "habitat", "infrastructure", "long-term", "municipal", "operator", "parks", "physical", "private".... | EXACT TITLE in energy_utilities: "Public works".
0.500
Hunting ↗ EXACT TITLE
activitiesagainstbecomecapacityconservationcontrolenvironmentevenexamplefoodformgreenlawmaintenancemanagementmeansnaturalparksprimaryprograms
SHARED TOKENS (24): "activities", "against", "become", "capacity", "conservation", "control", "environment", "even", "example", "food", "form", "green", "law", "maintenance", "management", "means", "natural", "parks", "primary", "programs".... | EXACT TITLE in outdoor_recreation: "Hunting".
0.500
Microgrid ↗ Q5762595 EXACT TITLE
allowsconnectedcontroldistributeddistributioneconomicemergencyentityevenheatlevelslocalmajormultipleoperatedoperatesprotectionprovidesinglesmall
SHARED TOKENS (25): "allows", "connected", "control", "distributed", "distribution", "economic", "emergency", "entity", "even", "heat", "levels", "local", "major", "multiple", "operated", "operates", "protection", "provide", "single", "small".... | EXACT TITLE in energy_utilities: "Microgrid".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciescanyoncentralcommercialconstructioncontroldamdownstreamhabitathistoryidahomajormilesnationalnearnorthprivateprogramspublic
SHARED TOKENS (31): "activities", "agencies", "canyon", "central", "commercial", "construction", "control", "dam", "downstream", "habitat", "history", "idaho", "major", "miles", "national", "near", "north", "private", "programs", "public".... | EXACT TITLE in energy_utilities: "Snake River". | EXACT TITLE in outdoor_recreation: "Snake River".
0.500
activitiesadditionalagenciesallowsdatafacilitiesfederalgovinformationmanagedpermitsplanningplatformrecreationsitesitessystemteam
SHARED TOKENS (18): "activities", "additional", "agencies", "allows", "data", "facilities", "federal", "gov", "information", "managed", "permits", "planning", "platform", "recreation", "site", "sites", "system", "team". | EXACT TITLE in outdoor_recreation: "Recreation.gov".
0.500
acrescascadecenterenvironmentalfacilitiesmanagementnearnevadanorthoperatedoperatesoperationsprotectionproviderresidentsrevenuesitewater
SHARED TOKENS (18): "acres", "cascade", "center", "environmental", "facilities", "management", "near", "nevada", "north", "operated", "operates", "operations", "protection", "provider", "residents", "revenue", "site", "water". | EXACT TITLE in energy_utilities: "Republic Services".
0.500
Compost ↗ Q212254 EXACT TITLE
benefitscommercialconstructioneconomicenvironmentalexamplefoodgreenheatlandmanagementphysicalplantreclamationrequiresurbanwater
SHARED TOKENS (17): "benefits", "commercial", "construction", "economic", "environmental", "example", "food", "green", "heat", "land", "management", "physical", "plant", "reclamation", "requires", "urban", "water". | EXACT TITLE in energy_utilities: "Compost".
0.500
cleanclearcommunicationscontroldifferententityfederalinfrastructureinstitutionlocalmaintainsmarketmultiplenaturaloperatesorganizationpointpublicscalesystems
SHARED TOKENS (23): "clean", "clear", "communications", "control", "different", "entity", "federal", "infrastructure", "institution", "local", "maintains", "market", "multiple", "natural", "operates", "organization", "point", "public", "scale", "systems".... | EXACT TITLE in energy_utilities: "Public utility".
0.500
cleanconservationcontrolcoordinationdirectlyengineersenvironmentalfederalformlawmajornamephysicalprimaryprotectionqualityresourcesafethoughwater
SHARED TOKENS (21): "clean", "conservation", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "law", "major", "name", "physical", "primary", "protection", "quality", "resource", "safe", "though", "water".... | EXACT TITLE in energy_utilities: "Clean Water Act".
0.500
affectsbusinessconsumerscreateseconomicformgrowthlawlicenselicensingmarketprotectionprovidepublicqualityregulatoryrelatedrequiringsafetysites
SHARED TOKENS (23): "affects", "business", "consumers", "creates", "economic", "form", "growth", "law", "license", "licensing", "market", "protection", "provide", "public", "quality", "regulatory", "related", "requiring", "safety", "sites".... | EXACT TITLE in energy_utilities: "Occupational licensing".
0.500
Veolia ↗ Q1632461 EXACT TITLE
activitiesbusinessclearenvironmentenvironmentalgroupmainmajormanagedmanagementnameoperationspublicrevenuesinglewater
SHARED TOKENS (16): "activities", "business", "clear", "environment", "environmental", "group", "main", "major", "managed", "management", "name", "operations", "public", "revenue", "single", "water". | EXACT TITLE in energy_utilities: "Veolia".
0.500
Canal ↗ Q12284 EXACT TITLE
builtchannelscontrolcreatecurrentexampleflowlevelsmanagementnaturalrequiringreservoirsresourcesriversourcethoughvalleywater
SHARED TOKENS (18): "built", "channels", "control", "create", "current", "example", "flow", "levels", "management", "natural", "requiring", "reservoirs", "resources", "river", "source", "though", "valley", "water". | EXACT TITLE in energy_utilities: "Canal".
0.500
Recycling ↗ Q132580 EXACT TITLE
anothercenterconservationcontroldependsdifferenteconomicenvironmentalexamplefoodformmanagementofficepromotesrelatedresourcereusesystemvaluewater
SHARED TOKENS (20): "another", "center", "conservation", "control", "depends", "different", "economic", "environmental", "example", "food", "form", "management", "office", "promotes", "related", "resource", "reuse", "system", "value", "water". | EXACT TITLE in energy_utilities: "Recycling".
0.500
Open space ↗ Q1451377 EXACT TITLE
businesschaincommunityconservationcorridordesigndevelopmentgenericlandmakesplanningpublicsmallstructuresurban
SHARED TOKENS (15): "business", "chain", "community", "conservation", "corridor", "design", "development", "generic", "land", "makes", "planning", "public", "small", "structures", "urban". | EXACT TITLE in outdoor_recreation: "Open space".
0.500
builtcapacityclassificationcommunitydamdatadistributedenvironmentalexactlocalnationaloperatingprimaryprojectregionalrequirereservoirscalesmallstructures
SHARED TOKENS (22): "built", "capacity", "classification", "community", "dam", "data", "distributed", "environmental", "exact", "local", "national", "operating", "primary", "project", "regional", "require", "reservoir", "scale", "small", "structures".... | EXACT TITLE in energy_utilities: "Small hydro".
0.500
adaboisecanyonclassescommunitydevelopmenteducationgovernedidahonampanorthprimaryprogramspublicresidentssouthwestthroughouttreasurevalleywestern
SHARED TOKENS (20): "ada", "boise", "canyon", "classes", "community", "development", "education", "governed", "idaho", "nampa", "north", "primary", "programs", "public", "residents", "southwest", "throughout", "treasure", "valley", "western". | EXACT TITLE in energy_utilities: "College of Western Idaho".
0.490
Electrician ↗ Q165029 EXACT TITLE
dataequipmentexistinginfrastructuremaintenancerelatedrepair
SHARED TOKENS (7): "data", "equipment", "existing", "infrastructure", "maintenance", "related", "repair". | URL->A (1): http://www.bls.gov/ooh/construction-and-extraction/electricians.htm. | EXACT TITLE in energy_utilities: "Electrician".
0.490
departmentidahomanagesparksprogramsrecreationthroughout
SHARED TOKENS (7): "department", "idaho", "manages", "parks", "programs", "recreation", "throughout". | URL->B (1): https://parksandrecreation.idaho.gov/. | EXACT TITLE in outdoor_recreation: "Idaho Department of Parks and Recreation".
0.480
Substation ↗ Q174814 EXACT TITLE
approximatelycentralchangecommercialconnectedcontroldifferentdistributionflowinfrastructurelevelsoperatedplantsystem
SHARED TOKENS (14): "approximately", "central", "change", "commercial", "connected", "control", "different", "distribution", "flow", "infrastructure", "levels", "operated", "plant", "system". | EXACT TITLE in energy_utilities: "Substation".
0.480
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentextractingflowformationhomelandlayermajorregionrelatedsourcevarywater
SHARED TOKENS (14): "beyond", "environment", "extracting", "flow", "formation", "home", "land", "layer", "major", "region", "related", "source", "vary", "water". | EXACT TITLE in energy_utilities: "Aquifer".
0.480
Fishing ↗ Q14373 EXACT TITLE
activitiesactivityadditionalcommercialdirectemploymentenvironmentfoodlong-termmillionnaturalprovidereservoirswater
SHARED TOKENS (14): "activities", "activity", "additional", "commercial", "direct", "employment", "environment", "food", "long-term", "million", "natural", "provide", "reservoirs", "water". | EXACT TITLE in outdoor_recreation: "Fishing".
0.480
educationalengineersfoundationgroupmonitoringnationaloperatesorganizationprogramspromotespublicrelatedwaterweek
SHARED TOKENS (14): "educational", "engineers", "foundation", "group", "monitoring", "national", "operates", "organization", "programs", "promotes", "public", "related", "water", "week". | EXACT TITLE in energy_utilities: "National Ground Water Association".
0.480
acrescanyonfeetidahomilenationalnorthrecreationriversmallsnakewaterswestwestern
SHARED TOKENS (14): "acres", "canyon", "feet", "idaho", "mile", "national", "north", "recreation", "river", "small", "snake", "waters", "west", "western". | EXACT TITLE in energy_utilities: "Hells Canyon".
0.470
idahomunicipalitiesoperatedprovidepublicwater
SHARED TOKENS (6): "idaho", "municipalities", "operated", "provide", "public", "water". | URL->A (1): https://puc.idaho.gov/. | EXACT TITLE in energy_utilities: "Idaho Public Utilities Commission".
0.460
advancedallowsbecomesenvironmentenvironmentalflowmaintenancequalityrecreationresourceriversystemswater
SHARED TOKENS (13): "advanced", "allows", "becomes", "environment", "environmental", "flow", "maintenance", "quality", "recreation", "resource", "river", "systems", "water". | EXACT TITLE in energy_utilities: "Water treatment".
0.460
businessconstructiondesigndifferentdirectlyhomelicensesmaintenancerelatedrequirementsspecializedsystemsvary
SHARED TOKENS (13): "business", "construction", "design", "different", "directly", "home", "licenses", "maintenance", "related", "requirements", "specialized", "systems", "vary". | EXACT TITLE in energy_utilities: "Electrical contractor".
0.460
Pipefitter ↗ Q5407416 EXACT TITLE
centercommercialconstructiondifferenteducationinstitutionalmaintainsnationalrequirerequirementsrequiressystemswater
SHARED TOKENS (13): "center", "commercial", "construction", "different", "education", "institutional", "maintains", "national", "require", "requirements", "requires", "systems", "water". | EXACT TITLE in energy_utilities: "Pipefitter".
0.440
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedirectlyeventslandmajornaturalrelatedresourcetimingurbanwater
SHARED TOKENS (12): "become", "create", "directly", "events", "land", "major", "natural", "related", "resource", "timing", "urban", "water". | EXACT TITLE in energy_utilities: "Stormwater".
0.420
boisedepartmenteventsfacilitiesfieldsidahomanagedparksrecreationriverurban
SHARED TOKENS (11): "boise", "department", "events", "facilities", "fields", "idaho", "managed", "parks", "recreation", "river", "urban". | EXACT TITLE in outdoor_recreation: "Ann Morrison Park".
0.420
acresboisecanyondamdepartmentidahomanagementnearriversnakewater
SHARED TOKENS (11): "acres", "boise", "canyon", "dam", "department", "idaho", "management", "near", "river", "snake", "water". | EXACT TITLE in outdoor_recreation: "Fort Boise Wildlife Management Area".
0.420
activityamongboisebusinesseducationidahoinstitutionmillionprogramspublicwest
SHARED TOKENS (11): "activity", "among", "boise", "business", "education", "idaho", "institution", "million", "programs", "public", "west". | EXACT TITLE in energy_utilities: "Boise State University".
0.420
Trout ↗ Q2258881 EXACT TITLE
foodgenericlifenamenamesnorthproviderelatedsourcethemselvesupstream
SHARED TOKENS (11): "food", "generic", "life", "name", "names", "north", "provide", "related", "source", "themselves", "upstream". | EXACT TITLE in outdoor_recreation: "Trout".
0.420
activityapproximatelycapacitydirectevenformationheatprimarysourcewinterworld
SHARED TOKENS (11): "activity", "approximately", "capacity", "direct", "even", "formation", "heat", "primary", "source", "winter", "world". | EXACT TITLE in energy_utilities: "Geothermal heating".
0.400
activitydependsdirectlyenvironmentalfoodformmajorphysicalsafewater
SHARED TOKENS (10): "activity", "depends", "directly", "environmental", "food", "form", "major", "physical", "safe", "water". | EXACT TITLE in energy_utilities: "Drinking water".
0.400
constructioncontroldesignederosionmanagementneedriversitetemporarywater
SHARED TOKENS (10): "construction", "control", "designed", "erosion", "management", "need", "river", "site", "temporary", "water". | EXACT TITLE in energy_utilities: "Sediment control".
0.400
commercialconsumersdistributionfireinfrastructurenetworkplantrequirementssystemwater
SHARED TOKENS (10): "commercial", "consumers", "distribution", "fire", "infrastructure", "network", "plant", "requirements", "system", "water". | EXACT TITLE in energy_utilities: "Water distribution system".
0.400
actualcapacitycommercialconsumersevenmanagementoperatingpeakpointsingle
SHARED TOKENS (10): "actual", "capacity", "commercial", "consumers", "even", "management", "operating", "peak", "point", "single". | EXACT TITLE in energy_utilities: "Peak demand".
0.400
activityannuallyenforcementevenformmunicipaloperationsvarywaterwaters
SHARED TOKENS (10): "activity", "annually", "enforcement", "even", "form", "municipal", "operations", "vary", "water", "waters". | EXACT TITLE in energy_utilities: "Industrial waste".
0.400
Landfill ↗ Q152810 EXACT TITLE
changeenvironmentalformlandmanagementmunicipalsimplysitesitestemporary
SHARED TOKENS (10): "change", "environmental", "form", "land", "management", "municipal", "simply", "site", "sites", "temporary". | EXACT TITLE in energy_utilities: "Landfill".
0.380
Journeyman ↗ Q582096 EXACT TITLE
becomebusinesseducationexperiencelicenseofficialprotectpublicworking
SHARED TOKENS (9): "become", "business", "education", "experience", "license", "official", "protect", "public", "working". | EXACT TITLE in energy_utilities: "Journeyman".
0.380
anotherenvironmentfacilitymainmunicipalplantreusetreatedwater
SHARED TOKENS (9): "another", "environment", "facility", "main", "municipal", "plant", "reuse", "treated", "water". | EXACT TITLE in energy_utilities: "Wastewater treatment".
0.380
activitybecomeequipmentfeetparticipationsinglespecializedwinterworld
SHARED TOKENS (9): "activity", "become", "equipment", "feet", "participation", "single", "specialized", "winter", "world". | EXACT TITLE in outdoor_recreation: "Snowboarding".
0.380
Rafting ↗ Q207238 EXACT TITLE
activitiesactivitybecomedifferentexperienceriskriverwaterworld
SHARED TOKENS (9): "activities", "activity", "become", "different", "experience", "risk", "river", "water", "world". | EXACT TITLE in outdoor_recreation: "Rafting".
0.360
Reservoir ↗ Q131681 EXACT TITLE
behindbuiltdamexistingformreservoirreservoirswater
SHARED TOKENS (8): "behind", "built", "dam", "existing", "form", "reservoir", "reservoirs", "water". | EXACT TITLE in energy_utilities: "Reservoir". | EXACT TITLE in outdoor_recreation: "Reservoir".
0.360
boisedepartmentenvironmentalfederalidahomainqualityregional
SHARED TOKENS (8): "boise", "department", "environmental", "federal", "idaho", "main", "quality", "regional". | EXACT TITLE in energy_utilities: "Idaho Department of Environmental Quality".
0.360
Picnic ↗ Q506294 EXACT TITLE
differentfoodformhomeparkspublicrequireswater
SHARED TOKENS (8): "different", "food", "form", "home", "parks", "public", "requires", "water". | EXACT TITLE in outdoor_recreation: "Picnic".
0.360
differentlawphysicalriversourcesystemstreatwater
SHARED TOKENS (8): "different", "law", "physical", "river", "source", "systems", "treat", "water". | EXACT TITLE in energy_utilities: "Water right".
0.360
constructioncontroldevelopmenterosionhabitatlandriverwater
SHARED TOKENS (8): "construction", "control", "development", "erosion", "habitat", "land", "river", "water". | EXACT TITLE in outdoor_recreation: "Erosion control".
0.360
Splash pad ↗ Q7578390 EXACT TITLE
fireneedpublicqualityrecreationrisktreatedwater
SHARED TOKENS (8): "fire", "need", "public", "quality", "recreation", "risk", "treated", "water". | EXACT TITLE in outdoor_recreation: "Splash pad".
0.360
bureauconservationlandlandsmanagedmanagementnationalvary
SHARED TOKENS (8): "bureau", "conservation", "land", "lands", "managed", "management", "national", "vary". | EXACT TITLE in outdoor_recreation: "National Conservation Area".
0.340
Wastewater ↗ Q336191 EXACT TITLE
activitiesanothercommercialcommunitydefinitionmunicipalwater
SHARED TOKENS (7): "activities", "another", "commercial", "community", "definition", "municipal", "water". | EXACT TITLE in energy_utilities: "Wastewater".
0.340
Trail ↗ Q628179 EXACT TITLE
examplenaturalnorthpathroutesmallthough
SHARED TOKENS (7): "example", "natural", "north", "path", "route", "small", "though". | EXACT TITLE in outdoor_recreation: "Trail".
0.340
businessdistributionidahonaturaloperatesriversnake
SHARED TOKENS (7): "business", "distribution", "idaho", "natural", "operates", "river", "snake". | EXACT TITLE in energy_utilities: "Idaho Power".
0.340
againstconditioncontactphysicalqualitysafetywater
SHARED TOKENS (7): "against", "condition", "contact", "physical", "quality", "safety", "water". | EXACT TITLE in energy_utilities: "Water quality".
0.340
builddepartmentfederallicensingnaturalregulatoryserving
SHARED TOKENS (7): "build", "department", "federal", "licensing", "natural", "regulatory", "serving". | EXACT TITLE in energy_utilities: "Federal Energy Regulatory Commission".
0.320
completelicensesystemtrainingvaryworking
SHARED TOKENS (6): "complete", "license", "system", "training", "vary", "working". | EXACT TITLE in energy_utilities: "Apprenticeship".
0.320
Lineworker ↗ Q691225 EXACT TITLE
commercialdistributionemergencyfacilitiesinsidemaintains
SHARED TOKENS (6): "commercial", "distribution", "emergency", "facilities", "inside", "maintains". | EXACT TITLE in energy_utilities: "Lineworker".
0.320
centrallandlocalnationalpublicsystem
SHARED TOKENS (6): "central", "land", "local", "national", "public", "system". | EXACT TITLE in outdoor_recreation: "Public land".
0.320
organizationorganizationspublicregulatorysystemwater
SHARED TOKENS (6): "organization", "organizations", "public", "regulatory", "system", "water". | EXACT TITLE in energy_utilities: "Public water system".
0.320
Disc golf ↗ Q876737 EXACT TITLE
completedifferentpathroughlyrulestoward
SHARED TOKENS (6): "complete", "different", "path", "roughly", "rules", "toward". | EXACT TITLE in outdoor_recreation: "Disc golf".
0.300
Project finance ↗ KW CROSS HIGH
amongassetscapitalconstructioncontroldevelopmentdistributedeconomicentityenvironmentalfinancialflowinfrastructurelong-termmarketsmultipleprojectprovideratherreal
SHARED TOKENS (26): "among", "assets", "capital", "construction", "control", "development", "distributed", "economic", "entity", "environmental", "financial", "flow", "infrastructure", "long-term", "markets", "multiple", "project", "provide", "rather", "real"....
0.300
allowscontrolcriticaldevelopmentdirectentitiesevenexamplemakesmanagementneednetworkpeakplantprivatepublicratherreal
SHARED TOKENS (18): "allows", "control", "critical", "development", "direct", "entities", "even", "example", "makes", "management", "need", "network", "peak", "plant", "private", "public", "rather", "real".
0.300
capacitychainconservationdefinesdistrictexampleformgrowthlawlong-termmeansplanningpublicrequiresresource
SHARED TOKENS (15): "capacity", "chain", "conservation", "defines", "district", "example", "form", "growth", "law", "long-term", "means", "planning", "public", "requires", "resource".
0.300
amongauthoritybureauconstructiondepartmentfederalfundedlandlandslawmaintenancemajormeridiannationalnevadaorganizationprojectpublicreclamationriver
SHARED TOKENS (23): "among", "authority", "bureau", "construction", "department", "federal", "funded", "land", "lands", "law", "maintenance", "major", "meridian", "national", "nevada", "organization", "project", "public", "reclamation", "river"....
0.300
activitiesadvancedallowsbusinessesdirectdistributionenvironmentalfieldsmanagementmunicipalnaturalnorthplannedreclamationregionrequirereusesafesourcesystem
SHARED TOKENS (25): "activities", "advanced", "allows", "businesses", "direct", "distribution", "environmental", "fields", "management", "municipal", "natural", "north", "planned", "reclamation", "region", "require", "reuse", "safe", "source", "system"....
0.300
activitiesamongbeyondcommunityconservationcontroldedicatedlicenselicenseslicensingmanagementnaturalregulatoryrequirerequiringresourcerevenuespecifically
SHARED TOKENS (18): "activities", "among", "beyond", "community", "conservation", "control", "dedicated", "license", "licenses", "licensing", "management", "natural", "regulatory", "require", "requiring", "resource", "revenue", "specifically".
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
advancedbehindcapacitycommunicationsconnectcontrolcreatecurrentdescribeddistributeddistributionevengenerichomehoursinformationinfrastructuremanagementmunicipalname
SHARED TOKENS (32): "advanced", "behind", "capacity", "communications", "connect", "control", "create", "current", "described", "distributed", "distribution", "even", "generic", "home", "hours", "information", "infrastructure", "management", "municipal", "name"....
0.300
Campsite ↗ Q832778 EXACT TITLE
facilitiesgroupmeansrelatedsimply
SHARED TOKENS (5): "facilities", "group", "means", "related", "simply". | EXACT TITLE in outdoor_recreation: "Campsite".
0.300
Sagebrush steppe ↗ KW CROSS HIGH
becomecommunityerosionfireformhabitatlandlocalplantqualityrecreationrisksourcewaterwest
SHARED TOKENS (15): "become", "community", "erosion", "fire", "form", "habitat", "land", "local", "plant", "quality", "recreation", "risk", "source", "water", "west".
0.300
acresbureaubusinessdepartmentdevelopmentfederallandlandsmajormanagementmanagesmillionnationalofficeoperationsprivatesystem
SHARED TOKENS (17): "acres", "bureau", "business", "department", "development", "federal", "land", "lands", "major", "management", "manages", "million", "national", "office", "operations", "private", "system".
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
builddifferentdistributionequipmentincreasinglypublicrelatedsafetysouthstreetsupportsystemsystemsthemwestern
SHARED TOKENS (15): "build", "different", "distribution", "equipment", "increasingly", "public", "related", "safety", "south", "street", "support", "system", "systems", "them", "western".
0.300
capacitycommercialdistributedenvironmentequipmentformlifemanagementmillionmonitoringscalesmallstructuresystemsystems
SHARED TOKENS (15): "capacity", "commercial", "distributed", "environment", "equipment", "form", "life", "management", "million", "monitoring", "scale", "small", "structure", "system", "systems".
0.300
becomechangeconditionconservationcurrentfoodhabitatlifelocalpointqualityratherrepairsupportwater
SHARED TOKENS (15): "become", "change", "condition", "conservation", "current", "food", "habitat", "life", "local", "point", "quality", "rather", "repair", "support", "water".
0.300
approximatelycapacitycreatecreatescreatingdevelopmentdownstreamformlocallong-termmainmarketmeansnaturalpeakrequirementsrequiressafetysouthspecialized
SHARED TOKENS (23): "approximately", "capacity", "create", "creates", "creating", "development", "downstream", "form", "local", "long-term", "main", "market", "means", "natural", "peak", "requirements", "requires", "safety", "south", "specialized"....
0.300
Combined sewer ↗ Q361472 KW CROSS HIGH
capacityconstructiondesigndesignedenvironmentaleventsexperiencefacilitiesflowgreeninfrastructuremeansmitigationplantpointrepairrequiringsimplysitesupport
SHARED TOKENS (25): "capacity", "construction", "design", "designed", "environmental", "events", "experience", "facilities", "flow", "green", "infrastructure", "means", "mitigation", "plant", "point", "repair", "requiring", "simply", "site", "support"....
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalcapacitychangecurrentdirectdistributionfinancialfundedgrowthhistorylandmainmajorpricingqualityrequiresresourcesscaleshowssource
SHARED TOKENS (25): "additional", "capacity", "change", "current", "direct", "distribution", "financial", "funded", "growth", "history", "land", "main", "major", "pricing", "quality", "requires", "resources", "scale", "shows", "source"....
0.300
againstallowscommercialcurrentdifferentdirecteconomyflowformnetworkrequiresourcesouthsystemsystemsworld
SHARED TOKENS (16): "against", "allows", "commercial", "current", "different", "direct", "economy", "flow", "form", "network", "require", "source", "south", "system", "systems", "world".
0.300
allowsbecomebuiltconnectedconnectingconsumerscurrentdistributionmarketsmillionneednetworkrisksmallsystemsthroughoutvaryworld
SHARED TOKENS (18): "allows", "become", "built", "connected", "connecting", "consumers", "current", "distribution", "markets", "million", "need", "network", "risk", "small", "systems", "throughout", "vary", "world".
0.300
anothercapacitydevelopmentdifferentenvironmentalfireformhazardlayeredlifemainrathersafetyteamwater
SHARED TOKENS (15): "another", "capacity", "development", "different", "environmental", "fire", "form", "hazard", "layered", "life", "main", "rather", "safety", "team", "water".
0.300
activitiesdesigneddifferentemergencyequipmentevenformlifemainprotectionproviderequiresafetysmallspecializedsupportthemwaterwest
SHARED TOKENS (19): "activities", "designed", "different", "emergency", "equipment", "even", "form", "life", "main", "protection", "provide", "require", "safety", "small", "specialized", "support", "them", "water", "west".
0.300
environmentalfoundationpointsmallwater
SHARED TOKENS (5): "environmental", "foundation", "point", "small", "water". | EXACT TITLE in outdoor_recreation: "Boat ramp".
0.300
activityamongapproximatelyboisebureaucanyoncapacitycenterconservationcreatesdamdirectlyedgefederalfeetformationidaholocalmilesnampa
SHARED TOKENS (35): "activity", "among", "approximately", "boise", "bureau", "canyon", "capacity", "center", "conservation", "creates", "dam", "directly", "edge", "federal", "feet", "formation", "idaho", "local", "miles", "nampa"....
0.300
approximatelycascadefeetformmilemilesnationalnearnevadaofficialparksroughlyroutesouthstatussystemwestern
SHARED TOKENS (17): "approximately", "cascade", "feet", "form", "mile", "miles", "national", "near", "nevada", "official", "parks", "roughly", "route", "south", "status", "system", "western".
0.300
againstbroaderchangecontroleventsexampleexposureinfrastructurelevelsmanagementmitigationnaturalphysicallyrelatedresiliencerisksmallstructuralsystemsupstream
SHARED TOKENS (22): "against", "broader", "change", "control", "events", "example", "exposure", "infrastructure", "levels", "management", "mitigation", "natural", "physically", "related", "resilience", "risk", "small", "structural", "systems", "upstream"....
0.300
activityapproximatelybecomebenefitsdesigneddistributionenvironmentalexpansionmaintenanceoperatingoperationalphysicalprovidepublicregulatoryservingsystemsystemstraffictransportation
SHARED TOKENS (21): "activity", "approximately", "become", "benefits", "designed", "distribution", "environmental", "expansion", "maintenance", "operating", "operational", "physical", "provide", "public", "regulatory", "serving", "system", "systems", "traffic", "transportation"....
0.300
activityanotherassetsbusinesscapitalcentralcontrolcreatedepartmentdescribeddirectentitiesentityexamplefederalgovernedlawmanagementmarketoperating
SHARED TOKENS (27): "activity", "another", "assets", "business", "capital", "central", "control", "create", "department", "described", "direct", "entities", "entity", "example", "federal", "governed", "law", "management", "market", "operating"....
0.300
businessescapacitychangeconsumersdirectdirectlyeconomicheatmanagementpeakplannedpricingrequireresponsesimplysystemwinter
SHARED TOKENS (17): "businesses", "capacity", "change", "consumers", "direct", "directly", "economic", "heat", "management", "peak", "planned", "pricing", "require", "response", "simply", "system", "winter".
0.300
conservationdepartmenteducationenforcementengineersenvironmentalfederalfinancialinformationlevelslocalmonitoringnationalprogramsprotectionpublicregional
SHARED TOKENS (17): "conservation", "department", "education", "enforcement", "engineers", "environmental", "federal", "financial", "information", "levels", "local", "monitoring", "national", "programs", "protection", "public", "regional".
0.300
Energy conservation ↗ KW CROSS HIGH
activitiesanotherconservationeconomicenvironmentalexampleformgreengrowthhourslifemaintenancemonitoringoperationsprofilescalesourcewater
SHARED TOKENS (18): "activities", "another", "conservation", "economic", "environmental", "example", "form", "green", "growth", "hours", "life", "maintenance", "monitoring", "operations", "profile", "scale", "source", "water".
0.300
changeconnectconservationconstructioncontrolcorridorcriticalecologyenvironmentalerosionevenfieldsflowfoodhabitatlandlocalmanagementnationalnatural
SHARED TOKENS (30): "change", "connect", "conservation", "construction", "control", "corridor", "critical", "ecology", "environmental", "erosion", "even", "fields", "flow", "food", "habitat", "land", "local", "management", "national", "natural"....
0.300
becomebusinesscentralcommercialcreatingdevelopmentfinancialhistorymultiplenameorganizationsprojectrisksmallsource
SHARED TOKENS (15): "become", "business", "central", "commercial", "creating", "development", "financial", "history", "multiple", "name", "organizations", "project", "risk", "small", "source".
0.300
amongcapacitycommunitydistributedemploymentincreasinglylocalmilesnearplantprojectrequiringscalesmallsouthwestsystemsystemsworld
SHARED TOKENS (18): "among", "capacity", "community", "distributed", "employment", "increasingly", "local", "miles", "near", "plant", "project", "requiring", "scale", "small", "southwest", "system", "systems", "world".
0.300
amongcapacitycleanconstructioncreatingdamdirectecologyenvironmentalerosionlandnaturalprovideregionreservoirresponseriverrolesourcesystems
SHARED TOKENS (21): "among", "capacity", "clean", "construction", "creating", "dam", "direct", "ecology", "environmental", "erosion", "land", "natural", "provide", "region", "reservoir", "response", "river", "role", "source", "systems"....
0.300
adaboisebuiltbureauconstructioncontroldamdirectlydownstreamengineersfederalfeetidaholuckymilesmultiplenorthoperatingoperationalpeak
SHARED TOKENS (28): "ada", "boise", "built", "bureau", "construction", "control", "dam", "directly", "downstream", "engineers", "federal", "feet", "idaho", "lucky", "miles", "multiple", "north", "operating", "operational", "peak"....
0.300
connectsconsumerscurrentdirectdirectlydistributionevenformlocalmajormarketnetworknorthplantsitethoughwestern
SHARED TOKENS (17): "connects", "consumers", "current", "direct", "directly", "distribution", "even", "form", "local", "major", "market", "network", "north", "plant", "site", "though", "western".
0.300
administrationboisebuiltcanyoncapacitydamfeetidahoinformationmileoperatedprojectreservoirriversnakeupstreamwestern
SHARED TOKENS (17): "administration", "boise", "built", "canyon", "capacity", "dam", "feet", "idaho", "information", "mile", "operated", "project", "reservoir", "river", "snake", "upstream", "western".
0.300
controlcurrentdesigndesigneddistributionenvironmentalexposurefirelevelslocalnationaloperatingprotectionprovideregionrequirementssafesafetysystemsystems
SHARED TOKENS (22): "control", "current", "design", "designed", "distribution", "environmental", "exposure", "fire", "levels", "local", "national", "operating", "protection", "provide", "region", "requirements", "safe", "safety", "system", "systems"....
0.300
environmentformedgovernedprimaryworld
SHARED TOKENS (5): "environment", "formed", "governed", "primary", "world". | EXACT TITLE in outdoor_recreation: "Trail running".
0.300
Sewage treatment ↗ KW CROSS HIGH
advancedapproximatelybusinessesconnectedconstructiondesigndifferentengineersenvironmentevenexamplefieldslandmainmanagementmunicipalneednetworkoperatingplant
SHARED TOKENS (30): "advanced", "approximately", "businesses", "connected", "construction", "design", "different", "engineers", "environment", "even", "example", "fields", "land", "main", "management", "municipal", "need", "network", "operating", "plant"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
applyauthoritybecomesconstructioncontroldepartmentsdesigndistrictengineersenvironmentalestateexamplefacilityjurisdictionlawlocalmainmanagersnationalplanning
SHARED TOKENS (28): "apply", "authority", "becomes", "construction", "control", "departments", "design", "district", "engineers", "environmental", "estate", "example", "facility", "jurisdiction", "law", "local", "main", "managers", "national", "planning"....
0.300
activitiesagenciesapproximatelyauthoritybusinesscapacitycleanconstructioncontroldepartmentdesigndirectdirectlyeconomyengineersenvironmentenvironmentalfacilitiesfederalform
SHARED TOKENS (45): "activities", "agencies", "approximately", "authority", "business", "capacity", "clean", "construction", "control", "department", "design", "direct", "directly", "economy", "engineers", "environment", "environmental", "facilities", "federal", "form"....
0.300
anotherbecomesbeyondcapacitychangeconnectedeconomicexperienceflowformgreenhoursmanagementneedprovideresponsescalesystems
SHARED TOKENS (18): "another", "becomes", "beyond", "capacity", "change", "connected", "economic", "experience", "flow", "form", "green", "hours", "management", "need", "provide", "response", "scale", "systems".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorycontroldescribeddevelopmentexpansionfinanciallong-termmanagementoperationalownershipprivateprovidepublicratherrolespecializedworking
SHARED TOKENS (19): "business", "capital", "category", "control", "described", "development", "expansion", "financial", "long-term", "management", "operational", "ownership", "private", "provide", "public", "rather", "role", "specialized", "working".
0.300
agenciesbuiltconstructiondepartmentsdesignenvironmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivatepublicroadsstructuralsystems
SHARED TOKENS (17): "agencies", "built", "construction", "departments", "design", "environment", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "public", "roads", "structural", "systems".
0.300
acresboisebureaucapacitydamdesigneddistrictidahonamenampanationalnearprojectprovidereclamationrivertreasurevalleywaterwestern
SHARED TOKENS (20): "acres", "boise", "bureau", "capacity", "dam", "designed", "district", "idaho", "name", "nampa", "national", "near", "project", "provide", "reclamation", "river", "treasure", "valley", "water", "western".
0.300
approximatelybehindboisebureaucapacitycenterconstructiondamdesignfeethomeidaholawmilesnationalnorthoperatedprimaryprovidereclamation
SHARED TOKENS (30): "approximately", "behind", "boise", "bureau", "capacity", "center", "construction", "dam", "design", "feet", "home", "idaho", "law", "miles", "national", "north", "operated", "primary", "provide", "reclamation"....
0.300
chainconservationcorridorscreatesdevelopmenteasementsentityestateexamplefederalfinancialgrowthhabitatlandlandslocalmanagedmarketorganizationownership
SHARED TOKENS (30): "chain", "conservation", "corridors", "creates", "development", "easements", "entity", "estate", "example", "federal", "financial", "growth", "habitat", "land", "lands", "local", "managed", "market", "organization", "ownership"....
0.300
Ski resort ↗ Q130003 EXACT TITLE
activitymainnorthsystemwinter
SHARED TOKENS (5): "activity", "main", "north", "system", "winter". | EXACT TITLE in outdoor_recreation: "Ski resort".
0.300
activityrecreationshapethemselveswater
SHARED TOKENS (5): "activity", "recreation", "shape", "themselves", "water". | EXACT TITLE in outdoor_recreation: "Tubing (recreation)".
0.300
authoritybecomesbusinesscapitalcommunitycooperativedistributedformformedgovernedgrowthinfrastructurelocalmanagedmarketsmeansnationaloperatingprovidepublic
SHARED TOKENS (24): "authority", "becomes", "business", "capital", "community", "cooperative", "distributed", "form", "formed", "governed", "growth", "infrastructure", "local", "managed", "markets", "means", "national", "operating", "provide", "public"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
capitalcommercialcommunitydifferentinstitutionalproviderspublicqualityscalesmallsystemsystemsurbanwaterworld
SHARED TOKENS (15): "capital", "commercial", "community", "different", "institutional", "providers", "public", "quality", "scale", "small", "system", "systems", "urban", "water", "world".
0.300
capacitycontroldesignedevenexampleextendingfacilityformgrouphoursinsideoperatingpeakrequiresourcesystemsystemsurbanworld
SHARED TOKENS (19): "capacity", "control", "designed", "even", "example", "extending", "facility", "form", "group", "hours", "inside", "operating", "peak", "require", "source", "system", "systems", "urban", "world".
🫐 BERRY68 edges
0.280
Hiking ↗ Q12014035 EXACT TITLE
activitydescribesorganizationsurban
SHARED TOKENS (4): "activity", "describes", "organizations", "urban". | EXACT TITLE in outdoor_recreation: "Hiking".
0.280
Outdoor gym ↗ Q692630 EXACT TITLE
builtconstructionequipmentpublic
SHARED TOKENS (4): "built", "construction", "equipment", "public". | EXACT TITLE in outdoor_recreation: "Outdoor gym".
0.260
activityallowsdatadatedistributionequipmentexamplehabitatinformationprimaryrecreationreportingspecialized
SHARED TOKENS (13): "activity", "allows", "data", "date", "distribution", "equipment", "example", "habitat", "information", "primary", "recreation", "reporting", "specialized".
0.260
additionalbuiltcapacitydepartmentdistrictexampleformationheatnearplantresourcessourcewater
SHARED TOKENS (13): "additional", "built", "capacity", "department", "district", "example", "formation", "heat", "near", "plant", "resources", "source", "water".
0.260
Net metering ↗ Q2685471 KW CROSS HIGH
allowsconsumerscurrentdesignedevenmarchprivaterequirerequiresretailsinglesmallvary
SHARED TOKENS (13): "allows", "consumers", "current", "designed", "even", "march", "private", "require", "requires", "retail", "single", "small", "vary".
0.260
Boating ↗ Q2141830 EXACT TITLE
activitiesactivityitself
SHARED TOKENS (3): "activities", "activity", "itself". | EXACT TITLE in outdoor_recreation: "Boating".
0.260
capitalcreatingforminfrastructuremarketmultiplenaturalpublicscalesinglespecificallythemwater
SHARED TOKENS (13): "capital", "creating", "form", "infrastructure", "market", "multiple", "natural", "public", "scale", "single", "specifically", "them", "water".
0.260
benefitscategoriescontrolequipmentlicensinglocalneedphysicalratherrequiresafetythemtreated
SHARED TOKENS (13): "benefits", "categories", "control", "equipment", "licensing", "local", "need", "physical", "rather", "require", "safety", "them", "treated".
0.260
activitiesconservationmanagement
SHARED TOKENS (3): "activities", "conservation", "management". | EXACT TITLE in outdoor_recreation: "Wildlife management area".
0.260
activityformpublic
SHARED TOKENS (3): "activity", "form", "public". | EXACT TITLE in outdoor_recreation: "Birdwatching".
0.260
Skiing ↗ Q130949 EXACT TITLE
activityeventswinter
SHARED TOKENS (3): "activity", "events", "winter". | EXACT TITLE in outdoor_recreation: "Skiing".
0.260
controldesigndesignedengineersenvironmentalgreenheatmaintenanceoperatingprovidequalitysystemswater
SHARED TOKENS (13): "control", "design", "designed", "engineers", "environmental", "green", "heat", "maintenance", "operating", "provide", "quality", "systems", "water".
0.260
Solar power ↗ Q1483757 KW CROSS HIGH
builtcapacitychangecommercialcurrentdirectlymitigationprimarysinglesmallsourcesystemsystems
SHARED TOKENS (13): "built", "capacity", "change", "commercial", "current", "directly", "mitigation", "primary", "single", "small", "source", "system", "systems".
0.260
Cycling ↗ Q53121 EXACT TITLE
activityrecreationworld
SHARED TOKENS (3): "activity", "recreation", "world". | EXACT TITLE in energy_utilities: "Cycling". | EXACT TITLE in outdoor_recreation: "Cycling".
0.240
anotherconstructioncreatedevelopmentenvironmentallandmunicipalphysicalprogramsregulatoryrequirementssimply
SHARED TOKENS (12): "another", "construction", "create", "development", "environmental", "land", "municipal", "physical", "programs", "regulatory", "requirements", "simply".
0.240
additionalconservationcurrentdepartmentdevelopmentdirectlydirectsfederalnationalphysicalprojectsystem
SHARED TOKENS (12): "additional", "conservation", "current", "department", "development", "directly", "directs", "federal", "national", "physical", "project", "system".
0.240
changedirectlydistributionexamplefieldsgrowthheatmeanspeakplantprimarywater
SHARED TOKENS (12): "change", "directly", "distribution", "example", "fields", "growth", "heat", "means", "peak", "plant", "primary", "water".
0.240
classificationdifferenteventsformformedhistorynearpatternshapestatusstructuresvary
SHARED TOKENS (12): "classification", "different", "events", "form", "formed", "history", "near", "pattern", "shape", "status", "structures", "vary".
0.240
commercialconnectconnectedconsumersdirectlydistributionequipmentmultiplenearprimarysystemurban
SHARED TOKENS (12): "commercial", "connect", "connected", "consumers", "directly", "distribution", "equipment", "multiple", "near", "primary", "system", "urban".
0.220
eagleidaho
SHARED TOKENS (2): "eagle", "idaho". | EXACT TITLE in outdoor_recreation: "Eagle Island State Park".
0.220
allowsapproximatelyconstructiondatafieldsinsidenationalprogramspublicrelatedtraining
SHARED TOKENS (11): "allows", "approximately", "construction", "data", "fields", "inside", "national", "programs", "public", "related", "training".
0.220
creatingdepartmentdesigneddifferentevenpathpathwayprimaryproviderouteurban
SHARED TOKENS (11): "creating", "department", "designed", "different", "even", "path", "pathway", "primary", "provide", "route", "urban".
0.220
approximatelydesignedfacilitiesfacilityinfrastructuremunicipalpublicsystemstreatwesternworld
SHARED TOKENS (11): "approximately", "designed", "facilities", "facility", "infrastructure", "municipal", "public", "systems", "treat", "western", "world".
0.220
Off-the-grid ↗ Q267162 KW CROSS HIGH
allowsconnecteddesignedenvironmentalfooditselfpublicscalesmallsystemswater
SHARED TOKENS (11): "allows", "connected", "designed", "environmental", "food", "itself", "public", "scale", "small", "systems", "water".
0.220
Water metering ↗ Q268503 KW CROSS HIGH
commercialcubicdeterminefeetflownorthpublicrequirementssystemwaterworld
SHARED TOKENS (11): "commercial", "cubic", "determine", "feet", "flow", "north", "public", "requirements", "system", "water", "world".
0.220
actualchangecontroldownstreamequipmentflowmaintainsprovideresponseupstreamvalue
SHARED TOKENS (11): "actual", "change", "control", "downstream", "equipment", "flow", "maintains", "provide", "response", "upstream", "value".
0.220
Kayaking ↗ Q2094083 EXACT TITLE
sitswater
SHARED TOKENS (2): "sits", "water". | EXACT TITLE in outdoor_recreation: "Kayaking".
0.220
announcedcenterdepartmentdevelopmentfundedhomenamenationaloperatedsystemstransportation
SHARED TOKENS (11): "announced", "center", "department", "development", "funded", "home", "name", "national", "operated", "systems", "transportation".
0.220
categoriesdesigned
SHARED TOKENS (2): "categories", "designed". | EXACT TITLE in outdoor_recreation: "Mountain biking".
0.210
departmentidahopreserving
SHARED TOKENS (3): "department", "idaho", "preserving". | URL->B (1): https://idfg.idaho.gov/.
0.200
suez
EXACT TITLE in energy_utilities: "Suez (disambiguation)".
0.200
advancedcommunitydesigneddifferentequipmentexperiencenorthrequiresriverwater
SHARED TOKENS (10): "advanced", "community", "designed", "different", "equipment", "experience", "north", "requires", "river", "water".
0.200
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
boisecanyonhomeidahomeridianmilesnamenampawestwestern
SHARED TOKENS (10): "boise", "canyon", "home", "idaho", "meridian", "miles", "name", "nampa", "west", "western".
0.200
Leave No Trace ↗ Q559348 KW CROSS HIGH
behindcenterconservationcreateeducationalformedframeworkrecreationresourcesresponse
SHARED TOKENS (10): "behind", "center", "conservation", "create", "educational", "formed", "framework", "recreation", "resources", "response".
0.200
adaboisecanyonhomeidahomainmeridiannampatreasurevalley
SHARED TOKENS (10): "ada", "boise", "canyon", "home", "idaho", "main", "meridian", "nampa", "treasure", "valley".
0.200
authoritycooperativedistrictdistrictsentitylandslocalpublicsubdivisionwater
SHARED TOKENS (10): "authority", "cooperative", "district", "districts", "entity", "lands", "local", "public", "subdivision", "water".
0.200
Solar inverter ↗ Q129316 KW CROSS HIGH
commercialcriticalcurrentdirectequipmentlocalnetworkpointprotectionsystem
SHARED TOKENS (10): "commercial", "critical", "current", "direct", "equipment", "local", "network", "point", "protection", "system".
0.200
commercialdirectlyinfrastructuremunicipalitiesplantservingsystemsystemsurbanwaters
SHARED TOKENS (10): "commercial", "directly", "infrastructure", "municipalities", "plant", "serving", "system", "systems", "urban", "waters".
0.180
Eutrophication ↗ Q156698 KW CROSS HIGH
developmentenvironmentenvironmentalgrowthmainpointriversourcewater
SHARED TOKENS (9): "development", "environment", "environmental", "growth", "main", "point", "river", "source", "water".
0.160
Snowshoe ↗ Q214724 KW CROSS HIGH
allowsequipmentratherrecreationrolespecializedthemwinter
SHARED TOKENS (8): "allows", "equipment", "rather", "recreation", "role", "specialized", "them", "winter".
0.160
Nordic skiing ↗ Q216613 KW CROSS HIGH
allowseventsjurisdictionrequirementsrequiresrulestrainingworld
SHARED TOKENS (8): "allows", "events", "jurisdiction", "requirements", "requires", "rules", "training", "world".
0.160
Native species ↗ Q169480 KW CROSS HIGH
economicenvironmentalhistorylocalnaturalregionspecificallythough
SHARED TOKENS (8): "economic", "environmental", "history", "local", "natural", "region", "specifically", "though".
0.160
Fly fishing ↗ Q898886 KW CROSS HIGH
differenthabitatnaturalnorthsmallspecializedvarywater
SHARED TOKENS (8): "different", "habitat", "natural", "north", "small", "specialized", "vary", "water".
0.160
amongbecomedevelopmentdistributionnationalnaturalresourcesworld
SHARED TOKENS (8): "among", "become", "development", "distribution", "national", "natural", "resources", "world".
0.160
Power station ↗ Q159719 KW CROSS HIGH
connectedcreatescurrentfacilitynaturalplantsourceworld
SHARED TOKENS (8): "connected", "creates", "current", "facility", "natural", "plant", "source", "world".
0.160
definitionfoodmunicipalmunicipalitiespublicrolespecificallytrash
SHARED TOKENS (8): "definition", "food", "municipal", "municipalities", "public", "role", "specifically", "trash".
0.160
distributionmajornationalnaturalpublicstreettrafficwater
SHARED TOKENS (8): "distribution", "major", "national", "natural", "public", "street", "traffic", "water".
0.160
approximatelyboisecaldwellcanyonidaholocallymileswest
SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "idaho", "locally", "miles", "west".
0.140
activitiesbeyondconstructioneventsroadsspecificallytransportation
SHARED TOKENS (7): "activities", "beyond", "construction", "events", "roads", "specifically", "transportation".
0.140
adaboiseidahomainmunicipalnamestreet
SHARED TOKENS (7): "ada", "boise", "idaho", "main", "municipal", "name", "street".
0.140
Black start ↗ Q655257 KW CROSS HIGH
anotheremergencyfacilitymainnetworkplantrequires
SHARED TOKENS (7): "another", "emergency", "facility", "main", "network", "plant", "requires".
0.140
Wind power ↗ Q43302 KW CROSS HIGH
capacitychangeconnectedenvironmentsourcewinterworld
SHARED TOKENS (7): "capacity", "change", "connected", "environment", "source", "winter", "world".
0.140
Septic tank ↗ Q386300 KW CROSS HIGH
connectedenvironmentfacilityprimarysystemsystemstreated
SHARED TOKENS (7): "connected", "environment", "facility", "primary", "system", "systems", "treated".
0.140
Trailhead ↗ Q7832815 KW CROSS HIGH
definesdistributionentitymajorpathwayspointtraffic
SHARED TOKENS (7): "defines", "distribution", "entity", "major", "pathways", "point", "traffic".
0.140
Effluent ↗ Q1057706 KW CROSS HIGH
differentdirectlyfacilityriversourcetreatedwaters
SHARED TOKENS (7): "different", "directly", "facility", "river", "source", "treated", "waters".
0.140
Bicycle safety ↗ Q516366 KW CROSS HIGH
environmentexampleinfrastructuremultiplerisksafetytraffic
SHARED TOKENS (7): "environment", "example", "infrastructure", "multiple", "risk", "safety", "traffic".
0.140
Swimming hole ↗ Q7658373 KW CROSS HIGH
activitybecomehistorynaturalriverwaterworld
SHARED TOKENS (7): "activity", "become", "history", "natural", "river", "water", "world".
0.140
activitiescommerciallicenselicensinglocalmanagementwestern
SHARED TOKENS (7): "activities", "commercial", "license", "licensing", "local", "management", "western".
0.120
Streamflow ↗ Q29425295 KW CROSS HIGH
capacitychannelsflowlandmajorwater
SHARED TOKENS (6): "capacity", "channels", "flow", "land", "major", "water".
0.120
capitaldistributionoperatingqualityriskwildfire
SHARED TOKENS (6): "capital", "distribution", "operating", "quality", "risk", "wildfire".
0.120
idaholandmajormilesriversnake
SHARED TOKENS (6): "idaho", "land", "major", "miles", "river", "snake".
0.120
completeequipmentfeetpointrisksingle
SHARED TOKENS (6): "complete", "equipment", "feet", "point", "risk", "single".
0.120
groupinformationnationalpromotesurbanwater
SHARED TOKENS (6): "group", "information", "national", "promotes", "urban", "water".
0.120
Green belt ↗ KW CROSS HIGH
developmentgreenlandplanningsmallurban
SHARED TOKENS (6): "development", "green", "land", "planning", "small", "urban".
0.120
conservationdesignedeconomyheatsourcetransportation
SHARED TOKENS (6): "conservation", "designed", "economy", "heat", "source", "transportation".
0.120
capacitycategoriesdistributionstructuresupportwater
SHARED TOKENS (6): "capacity", "categories", "distribution", "structure", "support", "water".
0.100
annuallyenvironmentlocalmillionnational
SHARED TOKENS (5): "annually", "environment", "local", "million", "national".
0.100
merelyownershipsourcesystemwater
SHARED TOKENS (5): "merely", "ownership", "source", "system", "water".
◈ Frequently Asked Questions
Energy Utilities × Outdoor Recreation — Treasure Valley
HAIKU · HIGH GATE
How does the Bureau of Reclamation's water management affect recreation access on the Boise River?
The Bureau of Reclamation operates the dam and water infrastructure that controls Boise River flows through Ada County and Canyon County, directly determining water levels for boating, fishing, and floating activities throughout the Treasure Valley. Seasonal water releases and irrigation demands managed by Reclamation shape the recreational window available to residents of Boise, Meridian, Eagle, and Kuna.
What role do hydroelectric facilities play in powering outdoor recreation infrastructure in the Treasure Valley?
Hydroelectric generation from Bureau of Reclamation facilities supplies power to trailhead facilities, campgrounds, and visitor centers across the Boise National Forest and surrounding Treasure Valley lands in Ada County and Canyon County. Energy utilities serving Boise and surrounding municipalities depend on these water-based generation resources to maintain the electrical infrastructure supporting outdoor recreation access.
How do energy transmission corridors intersect with hiking and trail systems in the Treasure Valley?
Utility transmission lines cross through Boise National Forest lands and open space in Ada County between Boise, Eagle, and Meridian, sometimes following or paralleling established trail corridors and recreation areas. Energy utilities must coordinate route maintenance and vegetation management with Forest Service and local outdoor recreation planning to minimize impact on the thousands of acres available for hiking and mountain activities.
Why do water storage levels in Treasure Valley reservoirs affect both power generation and recreation capacity?
Bureau of Reclamation reservoirs across the Treasure Valley store water for dual purposes: hydroelectric power generation for utilities serving Boise, Ada County, and Canyon County, and maintaining recreation opportunities like boating and fishing on those same water bodies. When drought reduces storage levels, energy utilities face reduced hydroelectric output while simultaneously limiting recreation access to reservoir-based activities within miles of Meridian, Kuna, and Eagle.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Energy Utilities × Outdoor Recreation 10 QID bridges 211 edges 5,511 ext links 2026-07-17 20:41:05 UTC 25ebf9b960f9ba42
Energy Utilities corridor ↗ Outdoor Recreation corridor ↗ Outdoor Recreation × Energy Utilities ↗ boisestandard.org/standard ↗
Parent Corridors
Energy Utilities × All Other Verticals