—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Dental ↔ relates to ↔ Legal

14 Wikipedia bridge articles confirmed in both vertical ledgers. 283 deterministic cross-vertical edges. 8,748 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
283 Cross Edges
8,748 External Sources
348 Wikipedia Articles
14 🌲 Evergreen
128 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Dental
× Legal
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
283
External Sources Harvested
8,748
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Zoning
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (14)
ZoningIdahoIdaho LegislatureBoise State UniversityTreasure ValleyNampa, IdahoBoise, IdahoPrivate equityAmericans with Disabilities Act of 1990Ada County, IdahoMeridian, IdahoCanyon County, IdahoCaldwell, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadalandlocalwashingtonwesternbusinesscollegepubliccanyonhomedevelopmentgovernmentsingleeasternnationalproductstechnology
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:23:55 UTC
Content Hash
9519ff671662d850
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in dental (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (15): "development", "form", "govern", "government", "growth", "guidelines", "land", "land-use", "local", "planning", "property", "regulatory", "scale", "single", "zoning". | EXACT TITLE in dental: "Zoning". | EXACT TITLE in legal: "Zoning".
developmentformgoverngovernmentgrowthguidelineslandland-uselocalplanningpropertyregulatoryscalesinglezoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
ed zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
itional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Idaho
Q1221 EXACT TITLE 0.980
QID OVERLAP: Q1221 in dental (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (14): "boise", "eastern", "idaho", "land", "national", "organized", "population", "prior", "products", "sector", "separate", "technology", "washington", "western". | EXACT TITLE in dental: "Idaho". | EXACT TITLE in legal: "Idaho".
boiseeasternidaholandnationalorganizedpopulationpriorproductssectorseparatetechnologywashingtonwestern
gton and Oregon to the west; the state shares a small portion of the Canada–United States border to the north with the Canadian province of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
The most parsimonious explanation we think is that people came down the Pacific Coast, and as they encountered the mouth of the Columbia River, they essentially found an off-ramp from this coastal migration and also found their first viable interior route to the areas that are south of the ice sheet. An early presence of French-Canadian trappers is visible in names and toponyms: Nez Percé, Cœur d'Alène, Boisé, Payette. Some of these names appeared prior to the Lewis and Clark and Astorian expeditions, which included significant numbers of French and Métis guides recruited for their familiarity with the terrain. Idaho, as part of the Oregon Country, was claimed by both the United States and Great Britain until the United States gained undisputed jurisdiction in 1846. From 1843 to 1859, present-day Idaho was under the de facto jurisdiction of the Provisional Government of Oregon. When Oregon became a state in 1859, what is now Idaho was situated in what remained of the original Oregon Territory, designated as the Washington Territory. Between 1849 and the creation of the Idaho Territory in 1863, parts of present-day Idaho were included in the Oregon, Washington, and Dakota Territories. The new Idaho territory included present-day Idaho, Montana, and most of Wyoming. The Lewis and Clark expedition crossed Idaho in 1805 on the way to the Pacific, and in 1806, on the return trip, largely following the Clearwater River in both directions, making it one the last states settled by European Americans. The first non-indigenous settlement was Kullyspell House, established on the shore of Lake Pend Oreille in 1809 by David Thompson of the North West Company for fur trading. In 1812 Donald Mackenzie, working for the Pacific Fur Company at the time, established a post on the lower Clearwater River near present-day Lewiston. This post, known as "MacKenzie's Post" or "Clearwater", operated until the Pacific Fur Company was bought out by the North West Company in 1813, after which the post was abandoned. The first organized non-indigenous communities within the present borders of Idaho were established by Mormon pioneers in 1860. The first permanent, substantial incorporated community was Lewiston, in 1861. Early in its history, Idaho saw a large influx of Chinese immigrants, who by 1870 made up about 28.5% of the territory's population. Idaho achieved statehood in 1890, following a difficult start as a territory, including the transfer of the territorial capital from Lewiston to Boise, disenfranchisement of Mormon polygamists upheld by the U.S. Supreme Court in 1890, and a federal attempt to split the territory between Washington Territory, which gained statehood in 1889, a year before Idaho, and the state of Nevada which had been a state since 1864. Idaho was one of the hardest hit of the Pacific Northwest states during the Great Depression. Prices plummeted for Idaho's major crops: in 1932 a bushel of potatoes brought only ten cents compared to 1919 for $1.51, while Idaho farmers saw their annual income of $685 in 1929 drop to $250 by 1932. Between 1991 and 2002, Idaho expanded its commercial base to include the science and technology sector which accounted for over 25% of its gross state product in 2001. During the COVID-19 pandemic, Idaho enacted statewide crisis standards of care as COVID-19 patients overwhelmed hospitals.
The landscape is rugged, with some of the largest unspoiled natural areas in the United States. For example, at 2.3 million acres (930,000 ha), the Frank Church-River of No Return Wilderness Area is the largest contiguous area of protected wilderness in the continental United States. Idaho is a Rocky Mountain state with abundant natural resources and scenic areas. The state has snow-capped mountain ranges, rapids, vast lakes and steep canyons. The waters of the Snake River run through Hells Canyon, the deepest gorge in the United States. Shoshone Falls falls down cliffs from a height greater than Niagara Falls. By far, the most important river in Idaho is the Snake River, a major tributary of the Columbia River. The Snake River flows from Yellowstone in northwestern Wyoming through the Snake River Plain in southern Idaho before turning north, leaving the state at Lewiston before joining the Columbia in Kennewick. Other major rivers are the Clark Fork/Pend Oreille River, the Spokane River, and, many major tributaries of the Snake River, including the Clearwater River, the Salmon River, the Boise River, and the Payette River. The Salmon River empties into the Snake in Hells Canyon and forms the southern boundary of Nez Perce County on its north shore, of which Lewiston is the county seat. The Port of Lewiston, at the confluence of the Clearwater and the Snake Rivers is the farthest inland seaport on the West Coast at 465 river miles from the Pacific at Astoria, Oregon. The vast majority of Idaho's population lives in the Snake River Plain, a valley running from across the entirety of southern Idaho from east to west. The valley contains the major cities of Boise, Meridian, Nampa, Caldwell, Twin Falls, Idaho Falls, and Pocatello. The plain served as an easy pass through the Rocky Mountains for westward-bound settlers on the Oregon Trail, and many settlers chose to settle the area rather than risking the treacherous route through the Blue Mountains and the Cascade Range to the west. The western region of the plain is known as the Treasure Valley, bound between the Owyhee Mountains to the southwest and the Boise Mountains to the northeast.
Idaho Legislature
Q4256974 EXACT TITLE 0.980
QID OVERLAP: Q4256974 in dental (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (14): "boise", "data", "district", "districts", "government", "idaho", "legislative", "legislature", "members", "population", "representing", "residents", "single", "washington". | EXACT TITLE in dental: "Idaho Legislature". | EXACT TITLE in legal: "Idaho Legislature".
boisedatadistrictdistrictsgovernmentidaholegislativelegislaturememberspopulationrepresentingresidentssinglewashington
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Boise State University
Q891082 EXACT TITLE 0.960
QID OVERLAP: Q891082 in dental (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (13): "among", "boise", "business", "college", "education", "founded", "idaho", "independent", "member", "program", "public", "school", "university". | EXACT TITLE in dental: "Boise State University".
amongboisebusinesscollegeeducationfoundedidahoindependentmemberprogrampublicschooluniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in dental (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (10): "association", "boise", "eastern", "idaho", "land", "local", "resources", "treasure", "valley", "western". | EXACT TITLE in dental: "Treasure Valley". | EXACT TITLE in legal: "Treasure Valley".
associationboiseeasternidaholandlocalresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "nampa", "population", "principal", "student", "university", "western".
boisecanyoncollegehomeidahointerstatemeridiannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "counties", "employers", "home", "idaho", "level", "population", "technology", "treasure", "valley".
adaannualboisecountiesemployershomeidaholevelpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
P
Q476115 QID OVERLAP 0.720
QID OVERLAP: Q476115 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (11): "active", "business", "development", "expansion", "financial", "financing", "firms", "general", "managing", "products", "public".
activebusinessdevelopmentexpansionfinancialfinancingfirmsgeneralmanagingproductspublic
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Americans with Disabilities Act of 1990
QID OVERLAP 0.700
QID OVERLAP: Q1111004 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (10): "ada", "business", "council", "effective", "employees", "employers", "january", "national", "public", "requires".
adabusinesscouncileffectiveemployeesemployersjanuarynationalpublicrequires
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
h made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
actment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (9): "ada", "boise", "district", "home", "idaho", "local", "population", "range", "washington".
adaboisedistricthomeidaholocalpopulationrangewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "ada", "among", "boise", "idaho", "meridian", "population".
adaamongboiseidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "nampa", "population".
boisecaldwellcanyonidahonampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.620
QID OVERLAP: Q849592 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "college", "idaho", "population".
boisecaldwellcanyoncollegeidahopopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in dental (tier:branch) and legal (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
269 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP269 edges
🌿 BRANCH128 edges
0.500
businesscollegecommunitydistricteasterneducationfoundedgeneralidahoindustryjoinofficepublicresidentsschooltechnologytraininguniversitywestern
SHARED TOKENS (19): "business", "college", "community", "district", "eastern", "education", "founded", "general", "idaho", "industry", "join", "office", "public", "residents", "school", "technology", "training", "university", "western". | EXACT TITLE in dental: "College of Eastern Idaho".
0.500
Corporation ↗ Q167037 EXACT TITLE
businessestablishedlegallegislativelegislatureliabilitylocalmemberobligationsofficeownedpracticepublicrecognizedsingleworkers
SHARED TOKENS (16): "business", "established", "legal", "legislative", "legislature", "liability", "local", "member", "obligations", "office", "owned", "practice", "public", "recognized", "single", "workers". | EXACT TITLE in dental: "Corporation". | EXACT TITLE in legal: "Corporation".
0.500
additionaladministrativeappliescannoteffectiveemployeesenvironmentframeworkinjurylifepersonalphysicalqualitysafetyworkworkers
SHARED TOKENS (16): "additional", "administrative", "applies", "cannot", "effective", "employees", "environment", "framework", "injury", "life", "personal", "physical", "quality", "safety", "work", "workers". | EXACT TITLE in dental: "Personal protective equipment".
0.500
amongcollectiondatadateeffectivehealthcarehistorymedicalmedicationpersonalpopulationqualityrangerecordssecuritysinglesupport
SHARED TOKENS (17): "among", "collection", "data", "date", "effective", "healthcare", "history", "medical", "medication", "personal", "population", "quality", "range", "records", "security", "single", "support". | EXACT TITLE in dental: "Electronic health record".
0.500
amongchildestablishedexperiencefamilyfinancialformshomelevellifemembersofficeorganizationpartnersphysicalrangerelationshipsresourcestechnology
SHARED TOKENS (19): "among", "child", "established", "experience", "family", "financial", "forms", "home", "level", "life", "members", "office", "organization", "partners", "physical", "range", "relationships", "resources", "technology". | EXACT TITLE in legal: "Domestic violence".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessdataeducationfeedhealthcarehomeintegrationmedicalonlinephysicalpracticeprofessionalpublicrangerecordssupportsystemtechnology
SHARED TOKENS (18): "access", "data", "education", "feed", "healthcare", "home", "integration", "medical", "online", "physical", "practice", "professional", "public", "range", "records", "support", "system", "technology". | EXACT TITLE in dental: "Telehealth".
0.500
businesscommercialcommunityconductemployeesenvironmentfinancialformationgovernancegovernslegalmarketorganizationspracticesystem
SHARED TOKENS (15): "business", "commercial", "community", "conduct", "employees", "environment", "financial", "formation", "governance", "governs", "legal", "market", "organizations", "practice", "system". | EXACT TITLE in legal: "Corporate law".
0.500
accessagenciescommunityconsumerdefininggovernanceinsurancelocalmedicalmeetingmembersmunicipalnetorganizationorganizationsprimarypublicsafetysectionstatutes
SHARED TOKENS (23): "access", "agencies", "community", "consumer", "defining", "governance", "insurance", "local", "medical", "meeting", "members", "municipal", "net", "organization", "organizations", "primary", "public", "safety", "section", "statutes".... | EXACT TITLE in dental: "Federally Qualified Health Center".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalbeyondconsumerdepartmentemployersemploymentfeegrowthleadingminimumphysicalpresenceprogramregulationrequiredrequiressectionsecurityspecialtyworkers
SHARED TOKENS (20): "additional", "beyond", "consumer", "department", "employers", "employment", "fee", "growth", "leading", "minimum", "physical", "presence", "program", "regulation", "required", "requires", "section", "security", "specialty", "workers". | EXACT TITLE in legal: "H-1B visa".
0.500
additionalagenciescontactdepartmentemployeeslifemedicalmembersprimarypublicresourcesretainsearchsupporttraining
SHARED TOKENS (15): "additional", "agencies", "contact", "department", "employees", "life", "medical", "members", "primary", "public", "resources", "retain", "search", "support", "training". | EXACT TITLE in dental: "Emergency medical services".
0.500
alongsideassociationcollegeeducationfullhealthcareindependentlicensedlocalmaintainmaintenancemedicaloralplanspracticeprimarypriorprofessionalprofessionalspublic
SHARED TOKENS (27): "alongside", "association", "college", "education", "full", "healthcare", "independent", "licensed", "local", "maintain", "maintenance", "medical", "oral", "plans", "practice", "primary", "prior", "professional", "professionals", "public".... | EXACT TITLE in dental: "Dental hygienist".
0.500
americanannualassociationboisebusinesscollegeeducationemploymentenvironmentalestablishedexpansionfullidaholegislaturemembernewsplansprogrampropertypublic
SHARED TOKENS (25): "american", "annual", "association", "boise", "business", "college", "education", "employment", "environmental", "established", "expansion", "full", "idaho", "legislature", "member", "news", "plans", "program", "property", "public".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
accessamongchildcommunitydevelopmentdistributioneducationenvironmentalhealthcarelevellifemedicaloralorganizationsorganizedphysicalpopulationprimarypublicquality
SHARED TOKENS (24): "access", "among", "child", "community", "development", "distribution", "education", "environmental", "healthcare", "level", "life", "medical", "oral", "organizations", "organized", "physical", "population", "primary", "public", "quality".... | EXACT TITLE in dental: "Public health".
0.500
accessactionsamericanassociationdepartmentenvironmentalfederalgovernmentinjuryinstitutionalmedicalmembernationalorganizationorganizationsprogrampublicreportsafetystrategic
SHARED TOKENS (22): "access", "actions", "american", "association", "department", "environmental", "federal", "government", "injury", "institutional", "medical", "member", "national", "organization", "organizations", "program", "public", "report", "safety", "strategic".... | EXACT TITLE in dental: "Centers for Disease Control and Prevention".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessamericanannualbenefitseffectiveestablishedexpandedfamiliesfederalfinancialgeneralgovernmenthealthcarehomeincomeinsurancelow-incomemaintainmedicalmember
SHARED TOKENS (30): "access", "american", "annual", "benefits", "effective", "established", "expanded", "families", "federal", "financial", "general", "government", "healthcare", "home", "income", "insurance", "low-income", "maintain", "medical", "member".... | EXACT TITLE in dental: "Medicaid".
0.500
agenciesbeyondcollegecontinuingdevelopmenteducationfeedformsgeneralgovernmentinstitutionallifeonlinepersonalprofessionalrecognitionrecognizedschoolseparatesupport
SHARED TOKENS (22): "agencies", "beyond", "college", "continuing", "development", "education", "feed", "forms", "general", "government", "institutional", "life", "online", "personal", "professional", "recognition", "recognized", "school", "separate", "support".... | EXACT TITLE in dental: "Continuing education".
0.500
Mediation ↗ Q223871 EXACT TITLE
amongassistanceauthoritycommercialformformsindependentjudgelegallicensingneedspracticeprofessionalreachtraining
SHARED TOKENS (15): "among", "assistance", "authority", "commercial", "form", "forms", "independent", "judge", "legal", "licensing", "needs", "practice", "professional", "reach", "training". | EXACT TITLE in legal: "Mediation".
0.500
Real estate ↗ Q684740 EXACT TITLE
businesscommercialestategeneralgovernmentlandlegalnonprofitownedpersonalpropertypublicrealresourceswater
SHARED TOKENS (15): "business", "commercial", "estate", "general", "government", "land", "legal", "nonprofit", "owned", "personal", "property", "public", "real", "resources", "water". | EXACT TITLE in dental: "Real estate". | EXACT TITLE in legal: "Real estate".
0.500
amongbenefitscompensationemployeesemployersemploymentformgeneralinsuranceliabilitymedicaloutsidepaymentplanssecuritysystemworkers
SHARED TOKENS (17): "among", "benefits", "compensation", "employees", "employers", "employment", "form", "general", "insurance", "liability", "medical", "outside", "payment", "plans", "security", "system", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.500
Snake River ↗ EXACT TITLE
agenciesamericancanyoncommercialconstructioneasternheavilyhistoryidaholeadingnationalpublicsectionvalleywashingtonwestern
SHARED TOKENS (16): "agencies", "american", "canyon", "commercial", "construction", "eastern", "heavily", "history", "idaho", "leading", "national", "public", "section", "valley", "washington", "western". | EXACT TITLE in legal: "Snake River".
0.500
additionalassociationcannotestablishedfederalformfullinjurylicenseoralplanningpracticepresenceprimarypublicrangerequiredsupporttraining
SHARED TOKENS (19): "additional", "association", "cannot", "established", "federal", "form", "full", "injury", "license", "oral", "planning", "practice", "presence", "primary", "public", "range", "required", "support", "training". | EXACT TITLE in dental: "Dental implant".
0.500
Contract ↗ Q93288 EXACT TITLE
businesscodecommercialdateenforcementframeworkgeneralgovernedindependentlegalmeetingnationalobligationspracticeprior
SHARED TOKENS (15): "business", "code", "commercial", "date", "enforcement", "framework", "general", "governed", "independent", "legal", "meeting", "national", "obligations", "practice", "prior". | EXACT TITLE in dental: "Contract". | EXACT TITLE in legal: "Contract".
0.500
agenciescompensationdevelopmentenforcementenvironmentenvironmentalgrowthlegalnationalneedsorganizationspreservationregulatoryresourceresourcessafetystatutes
SHARED TOKENS (17): "agencies", "compensation", "development", "enforcement", "environment", "environmental", "growth", "legal", "national", "needs", "organizations", "preservation", "regulatory", "resource", "resources", "safety", "statutes". | EXACT TITLE in legal: "Environmental law".
0.500
appliesbusinesscodecommercialconductconsumerdistrictemploymentfinancialfinancingformationframeworkgeneralgovernguidelinesinsuranceinterstatelegalmarketsorganizations
SHARED TOKENS (32): "applies", "business", "code", "commercial", "conduct", "consumer", "district", "employment", "financial", "financing", "formation", "framework", "general", "govern", "guidelines", "insurance", "interstate", "legal", "markets", "organizations".... | EXACT TITLE in legal: "Commercial law".
0.500
adaboisecanyoncollegecommunitycountiesdevelopmenteasterneducationgovernedidahonampapopulationprimarypublicresidentssouthweststudenttreasurevalley
SHARED TOKENS (21): "ada", "boise", "canyon", "college", "community", "counties", "development", "eastern", "education", "governed", "idaho", "nampa", "population", "primary", "public", "residents", "southwest", "student", "treasure", "valley".... | EXACT TITLE in dental: "College of Western Idaho".
0.500
childcollectioncouncildevelopmentenforcementfamilyfinancialguidelinesincomemaintenancememberminimumneedsobligationspaymentprimaryrecognizedrequiredrequiresreview
SHARED TOKENS (23): "child", "collection", "council", "development", "enforcement", "family", "financial", "guidelines", "income", "maintenance", "member", "minimum", "needs", "obligations", "payment", "primary", "recognized", "required", "requires", "review".... | EXACT TITLE in legal: "Child support".
0.480
americanassociationchildcollegedevelopmentgrowthhomemaintainoralpresenceprogramrecognizedresourcesspecialty
SHARED TOKENS (14): "american", "association", "child", "college", "development", "growth", "home", "maintain", "oral", "presence", "program", "recognized", "resources", "specialty". | EXACT TITLE in dental: "Pediatric dentistry".
0.460
completecontinuingdevelopmentdistricteducationlegallicensesmaintainminimumoutsidepracticeprofessionalrequired
SHARED TOKENS (13): "complete", "continuing", "development", "district", "education", "legal", "licenses", "maintain", "minimum", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.460
assistancedepartmenteducationemploymentestablishedfederalinjurylaborregulatorysafetystandardsstatutestraining
SHARED TOKENS (13): "assistance", "department", "education", "employment", "established", "federal", "injury", "labor", "regulatory", "safety", "standards", "statutes", "training". | EXACT TITLE in dental: "Occupational Safety and Health Administration".
0.460
authoritycannotdeterminesestablishedintermediateitselfjudgelegallevelproceedingsreviewstandardsystem
SHARED TOKENS (13): "authority", "cannot", "determines", "established", "intermediate", "itself", "judge", "legal", "level", "proceedings", "review", "standard", "system". | EXACT TITLE in legal: "Appellate court".
0.460
additionalemployeesemployersenvironmentgeneralgovernmentinjurylevelpublicregulaterequiredsafetywork
SHARED TOKENS (13): "additional", "employees", "employers", "environment", "general", "government", "injury", "level", "public", "regulate", "required", "safety", "work". | EXACT TITLE in dental: "Occupational safety and health".
0.460
accessamericanassociationcommissioneducationfederalguidelinesmedicalmemberoralpracticeprofessionalquality
SHARED TOKENS (13): "access", "american", "association", "commission", "education", "federal", "guidelines", "medical", "member", "oral", "practice", "professional", "quality". | EXACT TITLE in dental: "Dental therapist".
0.460
assistancecannotcounselestablishedfederalfreefullgovernmentlegalofficepublicrepresentationrequires
SHARED TOKENS (13): "assistance", "cannot", "counsel", "established", "federal", "free", "full", "government", "legal", "office", "public", "representation", "requires". | EXACT TITLE in legal: "Public defender".
0.450
boiseidahointermediatelegislatureoperations
SHARED TOKENS (5): "boise", "idaho", "intermediate", "legislature", "operations". | URL->B (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.440
enforcementenvironmentalgovernslandlegalpersonalpropertypublicrealrelationshipsseparatetrust
SHARED TOKENS (12): "enforcement", "environmental", "governs", "land", "legal", "personal", "property", "public", "real", "relationships", "separate", "trust". | EXACT TITLE in legal: "Property law".
0.440
Trust (law) ↗ Q854022 EXACT TITLE
businessestablishedfederalgovernedincomelegallifepropertypublicrequiressingletrust
SHARED TOKENS (12): "business", "established", "federal", "governed", "income", "legal", "life", "property", "public", "requires", "single", "trust". | EXACT TITLE in dental: "Trust (law)". | EXACT TITLE in legal: "Trust (law)".
0.440
amongcommissiondevelopmentestatefinancialgovernmentlegalnationalpropertyrealsystemtransaction
SHARED TOKENS (12): "among", "commission", "development", "estate", "financial", "government", "legal", "national", "property", "real", "system", "transaction". | EXACT TITLE in legal: "Real estate transaction".
0.440
Patent ↗ Q253623 EXACT TITLE
amongclaimsdisclosureformslegalmemberminimumnationalorganizationpropertypublictechnology
SHARED TOKENS (12): "among", "claims", "disclosure", "forms", "legal", "member", "minimum", "national", "organization", "property", "public", "technology". | EXACT TITLE in legal: "Patent".
0.440
claimsfamilylandlegalpropertypublicrealrepresentingrequiredservesstatutestitle
SHARED TOKENS (12): "claims", "family", "land", "legal", "property", "public", "real", "representing", "required", "serves", "statutes", "title". | EXACT TITLE in dental: "Title (property)". | EXACT TITLE in legal: "Title (property)".
0.440
Aerosol ↗ Q104541 EXACT TITLE
consumerenvironmentformformationformsleadingmaterialmedicalsourcessuspensionsystemwater
SHARED TOKENS (12): "consumer", "environment", "form", "formation", "forms", "leading", "material", "medical", "sources", "suspension", "system", "water". | EXACT TITLE in dental: "Aerosol".
0.440
compensationdevelopmentexpandedfeefullgovernmentlandlegalpaymentpropertypublictitle
SHARED TOKENS (12): "compensation", "development", "expanded", "fee", "full", "government", "land", "legal", "payment", "property", "public", "title". | EXACT TITLE in legal: "Eminent domain".
0.420
Green card ↗ Q6676995 EXACT TITLE
amongcertificatefederalformgeneraljudgememberproceedingsresidencyresidentsworkers
SHARED TOKENS (11): "among", "certificate", "federal", "form", "general", "judge", "member", "proceedings", "residency", "residents", "workers". | EXACT TITLE in legal: "Green card".
0.420
Pregnancy ↗ Q11995 EXACT TITLE
developmentexperienceformfullgrowthmedicaloutsidephysicalrequiredsectiontechnology
SHARED TOKENS (11): "development", "experience", "form", "full", "growth", "medical", "outside", "physical", "required", "section", "technology". | EXACT TITLE in dental: "Pregnancy".
0.420
americanassociationdistrictindependentinsurancemembermembersnetworkoperatingorganizationsplans
SHARED TOKENS (11): "american", "association", "district", "independent", "insurance", "member", "members", "network", "operating", "organizations", "plans". | EXACT TITLE in dental: "Delta Dental".
0.400
adaamericanassociationestablishedmembersnationalorganizationpopulationprofessionalpublishes
SHARED TOKENS (10): "ada", "american", "association", "established", "members", "national", "organization", "population", "professional", "publishes". | EXACT TITLE in dental: "American Dental Association".
0.400
Divorce ↗ Q93190 EXACT TITLE
accessauthoritychilddebtdistributionlegalpropertyrequiredrequiressupport
SHARED TOKENS (10): "access", "authority", "child", "debt", "distribution", "legal", "property", "required", "requires", "support". | EXACT TITLE in legal: "Divorce".
0.400
americanconductinjurylegalliabilitylifemedicalpersonalpropertyquality
SHARED TOKENS (10): "american", "conduct", "injury", "legal", "liability", "life", "medical", "personal", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.400
accesschildcontactfamilylegalmemberparentalphysicalproceedingsstandard
SHARED TOKENS (10): "access", "child", "contact", "family", "legal", "member", "parental", "physical", "proceedings", "standard". | EXACT TITLE in legal: "Child custody".
0.400
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentflowformationgroundwaterhomelandlayermaterialwater
SHARED TOKENS (10): "beyond", "environment", "flow", "formation", "groundwater", "home", "land", "layer", "material", "water". | EXACT TITLE in legal: "Aquifer".
0.400
Assault ↗ Q365680 EXACT TITLE
chargescombinedcontactlegalliabilityphysicalrangeseparatesinglesystem
SHARED TOKENS (10): "charges", "combined", "contact", "legal", "liability", "physical", "range", "separate", "single", "system". | EXACT TITLE in legal: "Assault".
0.400
cannotincomeinjurylegalmalpracticemedicalprofessionalrecognizedstandardstandards
SHARED TOKENS (10): "cannot", "income", "injury", "legal", "malpractice", "medical", "professional", "recognized", "standard", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.400
Credit ↗ Q182076 EXACT TITLE
consumerdatedebtfinancialformgrouppaymentpropertyresourcestrust
SHARED TOKENS (10): "consumer", "date", "debt", "financial", "form", "group", "payment", "property", "resources", "trust". | EXACT TITLE in dental: "Credit". | EXACT TITLE in legal: "Credit".
0.400
authorityfederalgovernmentheavilylandlegislativelegislaturepopulationstatutesstatutory
SHARED TOKENS (10): "authority", "federal", "government", "heavily", "land", "legislative", "legislature", "population", "statutes", "statutory". | EXACT TITLE in legal: "Constitutional law".
0.380
Pro bono ↗ Q127537 EXACT TITLE
communityfreelegalpaymentproprofessionalprofessionalspublicwork
SHARED TOKENS (9): "community", "free", "legal", "payment", "pro", "professional", "professionals", "public", "work". | EXACT TITLE in legal: "Pro bono".
0.380
Dentistry ↗ Q12128 EXACT TITLE
developmenthistoryinstitutionsmedicaloralprimaryspecialtywaterwork
SHARED TOKENS (9): "development", "history", "institutions", "medical", "oral", "primary", "specialty", "water", "work". | EXACT TITLE in dental: "Dentistry".
0.380
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjudgelegalprofessionalschoolsystemuniversity
SHARED TOKENS (9): "college", "department", "education", "judge", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.380
constructiondateitselflaborpersonalpropertyrealsecuritytitle
SHARED TOKENS (9): "construction", "date", "itself", "labor", "personal", "property", "real", "security", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.380
adaamericanassociationcollegemaintenanceoralplanningrecognizedspecialty
SHARED TOKENS (9): "ada", "american", "association", "college", "maintenance", "oral", "planning", "recognized", "specialty". | EXACT TITLE in dental: "Prosthodontics".
0.380
Lawyer ↗ Q40348 EXACT TITLE
educationlegalpracticeprofessionalrangerequiredsystemtrainingwork
SHARED TOKENS (9): "education", "legal", "practice", "professional", "range", "required", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.380
Diabetes ↗ Q12206 EXACT TITLE
beyondformgrouphealthcareincomeleadinglifepopulationsystem
SHARED TOKENS (9): "beyond", "form", "group", "healthcare", "income", "leading", "life", "population", "system". | EXACT TITLE in dental: "Diabetes".
0.380
accessamongeducationexperiencehealthcareinsuranceneedspopulationwork
SHARED TOKENS (9): "access", "among", "education", "experience", "healthcare", "insurance", "needs", "population", "work". | EXACT TITLE in dental: "Rural health".
0.380
Pediatrics ↗ Q123028 EXACT TITLE
americanchildgeneralinsurancemedicalpracticerequiresresourceswork
SHARED TOKENS (9): "american", "child", "general", "insurance", "medical", "practice", "requires", "resources", "work". | EXACT TITLE in dental: "Pediatrics".
0.360
concentrationcontacteffectiveformmarketproductsprofessionalwestern
SHARED TOKENS (8): "concentration", "contact", "effective", "form", "market", "products", "professional", "western". | EXACT TITLE in dental: "Fluoride varnish".
0.360
Tooth decay ↗ Q133772 EXACT TITLE
amongformationoralorganizationpopulationprimarysourceswater
SHARED TOKENS (8): "among", "formation", "oral", "organization", "population", "primary", "sources", "water". | EXACT TITLE in dental: "Tooth decay".
0.360
idaho
SHARED TOKENS (1): "idaho". | URL->B (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.360
developmentfamilyformhistoryleadingoralpopulationprofessional
SHARED TOKENS (8): "development", "family", "form", "history", "leading", "oral", "population", "professional". | EXACT TITLE in dental: "Periodontal disease".
0.360
dataformimmediateintermediateprocessingqualityrangesystem
SHARED TOKENS (8): "data", "form", "immediate", "intermediate", "processing", "quality", "range", "system". | EXACT TITLE in dental: "Digital radiography".
0.360
Creditor ↗ Q157165 EXACT TITLE
debtfinancialgeneralgovernmentorganizationpropertyrepresentssecurity
SHARED TOKENS (8): "debt", "financial", "general", "government", "organization", "property", "represents", "security". | EXACT TITLE in legal: "Creditor".
0.340
Arbitration ↗ Q207946 EXACT TITLE
commercialconsumeremploymentformlocalproceedingsreview
SHARED TOKENS (7): "commercial", "consumer", "employment", "form", "local", "proceedings", "review". | EXACT TITLE in legal: "Arbitration".
0.340
estatelegallifeneedsnetplanningproperty
SHARED TOKENS (7): "estate", "legal", "life", "needs", "net", "planning", "property". | EXACT TITLE in legal: "Estate planning".
0.340
Adoption ↗ Q180472 EXACT TITLE
childgovernedlegalparentalrecognitionrequiresstatutes
SHARED TOKENS (7): "child", "governed", "legal", "parental", "recognition", "requires", "statutes". | EXACT TITLE in legal: "Adoption".
0.340
contactlevelmedicalpriorproducesprofessionalsystem
SHARED TOKENS (7): "contact", "level", "medical", "prior", "produces", "professional", "system". | EXACT TITLE in dental: "Sedation dentistry".
0.340
Inheritance ↗ Q200303 EXACT TITLE
amonglegalobligationspracticepropertystatutorysuccession
SHARED TOKENS (7): "among", "legal", "obligations", "practice", "property", "statutory", "succession". | EXACT TITLE in legal: "Inheritance".
0.340
collegecommissioncommunityeasternidahopublicwestern
SHARED TOKENS (7): "college", "commission", "community", "eastern", "idaho", "public", "western". | EXACT TITLE in dental: "North Idaho College".
0.340
Deed ↗ Q705914 EXACT TITLE
legalliabilitylicensespracticepropertyspecialtytitle
SHARED TOKENS (7): "legal", "liability", "licenses", "practice", "property", "specialty", "title". | EXACT TITLE in dental: "Deed".
0.340
Complaint ↗ Q836925 EXACT TITLE
authoritychargesfederalgovernlegalstatutessupport
SHARED TOKENS (7): "authority", "charges", "federal", "govern", "legal", "statutes", "support". | EXACT TITLE in dental: "Complaint".
0.340
americanassociationeducationexperiencespecialtytrainingwork
SHARED TOKENS (7): "american", "association", "education", "experience", "specialty", "training", "work". | EXACT TITLE in dental: "Cosmetic dentistry".
0.340
americangeneraljudgelegalreviewsinglesystem
SHARED TOKENS (7): "american", "general", "judge", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.340
benefitsdepartmentdevelopmentidahoinsurancelabortechnology
SHARED TOKENS (7): "benefits", "department", "development", "idaho", "insurance", "labor", "technology". | EXACT TITLE in dental: "Idaho Department of Labor".
0.320
communityestateownedpropertyseparatesystem
SHARED TOKENS (6): "community", "estate", "owned", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.320
Partnership ↗ Q728646 EXACT TITLE
businessgovernedorganizationorganizationspartnersreach
SHARED TOKENS (6): "business", "governed", "organization", "organizations", "partners", "reach". | EXACT TITLE in dental: "Partnership".
0.320
benefitsgrowthlifequalityroomspecialty
SHARED TOKENS (6): "benefits", "growth", "life", "quality", "room", "specialty". | EXACT TITLE in dental: "Orthodontics".
0.320
Immigration law ↗ EXACT TITLE
governmentlegalmaintainnationalregulatestatutes
SHARED TOKENS (6): "government", "legal", "maintain", "national", "regulate", "statutes". | EXACT TITLE in legal: "Immigration law".
0.320
amongfoundedidahomeridianpublicuniversity
SHARED TOKENS (6): "among", "founded", "idaho", "meridian", "public", "university". | EXACT TITLE in dental: "Idaho State University".
0.320
americanfinancialofficesorganizationownedsupport
SHARED TOKENS (6): "american", "financial", "offices", "organization", "owned", "support". | EXACT TITLE in dental: "Aspen Dental".
0.320
benefitsestategovernlegalpropertysupport
SHARED TOKENS (6): "benefits", "estate", "govern", "legal", "property", "support". | EXACT TITLE in legal: "Prenuptial agreement".
0.320
Probate ↗ Q6500369 EXACT TITLE
claimsestatelegalpersonalpropertypublic
SHARED TOKENS (6): "claims", "estate", "legal", "personal", "property", "public". | EXACT TITLE in legal: "Probate".
0.320
analysisfilesformoperationsproductsquality
SHARED TOKENS (6): "analysis", "files", "form", "operations", "products", "quality". | EXACT TITLE in dental: "Computer-aided design".
0.320
Jury ↗ Q837675 EXACT TITLE
groupjudgelegalprofessionalsinglesystem
SHARED TOKENS (6): "group", "judge", "legal", "professional", "single", "system". | EXACT TITLE in dental: "Jury". | EXACT TITLE in legal: "Jury".
0.320
Court ↗ Q41487 EXACT TITLE
administrativeauthorityestablishedgovernmentlegallegislature
SHARED TOKENS (6): "administrative", "authority", "established", "government", "legal", "legislature". | EXACT TITLE in legal: "Court".
0.320
legalmigrationminimumnationalorganizationresidency
SHARED TOKENS (6): "legal", "migration", "minimum", "national", "organization", "residency". | EXACT TITLE in legal: "Naturalization".
0.320
coveringexpansionmaterialoutsidestrongtechnology
SHARED TOKENS (6): "covering", "expansion", "material", "outside", "strong", "technology". | EXACT TITLE in dental: "Crown (dental restoration)".
0.300
actionsamonglegallevelpresence
SHARED TOKENS (5): "actions", "among", "legal", "level", "presence". | EXACT TITLE in legal: "Manslaughter".
0.300
adjudicationadministrativeagencieseducationenforcementenvironmentenvironmentalexpandedgovernmentitselflegallegislativepublicregulatereviewsectorstrongsystem
SHARED TOKENS (18): "adjudication", "administrative", "agencies", "education", "enforcement", "environment", "environmental", "expanded", "government", "itself", "legal", "legislative", "public", "regulate", "review", "sector", "strong", "system".
0.300
annualbusinesscompleteconductdebtdevelopmentemployeesfinancialfinancingfirmsformgrowthhistoryinstitutionalmarketmarketsoperatingoperationsownedpublic
SHARED TOKENS (25): "annual", "business", "complete", "conduct", "debt", "development", "employees", "financial", "financing", "firms", "form", "growth", "history", "institutional", "market", "markets", "operating", "operations", "owned", "public"....
0.300
benefitscompensationemployeesemployersemploymentgrouporganizationreachregulaterepresentingsafetysecuritysingletrainingworkworkers
SHARED TOKENS (16): "benefits", "compensation", "employees", "employers", "employment", "group", "organization", "reach", "regulate", "representing", "safety", "security", "single", "training", "work", "workers".
0.300
americanassociationauthoritycommunitydevelopmentdistrictsenvironmentalfoundedlandland-useneedsphysicalplanningregionalregulateregulationresourceswater
SHARED TOKENS (18): "american", "association", "authority", "community", "development", "districts", "environmental", "founded", "land", "land-use", "needs", "physical", "planning", "regional", "regulate", "regulation", "resources", "water".
0.300
landlegalprimarypropertystrong
SHARED TOKENS (5): "land", "legal", "primary", "property", "strong". | EXACT TITLE in legal: "Intellectual property".
0.300
Law firm ↗ Q613142 EXACT TITLE
assistancebusinesslegalpracticeprimary
SHARED TOKENS (5): "assistance", "business", "legal", "practice", "primary". | EXACT TITLE in legal: "Law firm".
0.300
businesscombinedcommissioncompetitivedepartmentfederalgovernedgovernmentlegalmarketoperatingoperationsorganizationregulatoryrequiresreviewsinglestrategictransaction
SHARED TOKENS (19): "business", "combined", "commission", "competitive", "department", "federal", "governed", "government", "legal", "market", "operating", "operations", "organization", "regulatory", "requires", "review", "single", "strategic", "transaction".
0.300
employeesemployersemploymentfederalfeegeneralgovernmentlaborlocalmembermemberspublicrepresentationrequiredsectorsecuritystatuteswork
SHARED TOKENS (18): "employees", "employers", "employment", "federal", "fee", "general", "government", "labor", "local", "member", "members", "public", "representation", "required", "sector", "security", "statutes", "work".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalalongsideamericanassociationcompletedepartmenteducationfederallegallicensednationalofficepracticeprofessionalpropertypublicqualifyingrequirementrequiresschool
SHARED TOKENS (23): "additional", "alongside", "american", "association", "complete", "department", "education", "federal", "legal", "licensed", "national", "office", "practice", "professional", "property", "public", "qualifying", "requirement", "requires", "school"....
0.300
businessformgenerallegalliabilitylicensedmalpracticemedicalorganizedpersonalpracticeprincipalprofessionalprofessionalspublicsinglestatutes
SHARED TOKENS (17): "business", "form", "general", "legal", "liability", "licensed", "malpractice", "medical", "organized", "personal", "practice", "principal", "professional", "professionals", "public", "single", "statutes".
0.300
accessbusinesscannotcommunitycompensationdisclosureemployeesemploymenteventslegalmaterialprogramrequiredresolvedsingle
SHARED TOKENS (15): "access", "business", "cannot", "community", "compensation", "disclosure", "employees", "employment", "events", "legal", "material", "program", "required", "resolved", "single".
0.300
Labour law ↗ Q628967 KW CROSS HIGH
agenciescodecontractorsemployeesemployersemploymentgoverngovernmentlaborlegislatureminimumregulatorystandardsworkworkers
SHARED TOKENS (15): "agencies", "code", "contractors", "employees", "employers", "employment", "govern", "government", "labor", "legislature", "minimum", "regulatory", "standards", "work", "workers".
0.300
agenciesamericanassociationsbenefitsconsumereffectiveexpandedlevelmedicalnationalorganizedpopulationpracticeprofessionalspublicqualityreceivedreportsafetysupply
SHARED TOKENS (22): "agencies", "american", "associations", "benefits", "consumer", "effective", "expanded", "level", "medical", "national", "organized", "population", "practice", "professionals", "public", "quality", "received", "report", "safety", "supply"....
0.300
actionschargescodeemployeesemploymentenvironmentformgenerallegalorganizationspersonalphysicalproprofessionalrelationshipswork
SHARED TOKENS (16): "actions", "charges", "code", "employees", "employment", "environment", "form", "general", "legal", "organizations", "personal", "physical", "pro", "professional", "relationships", "work".
0.300
amongassociationsbusinesscompetitiveemployeesemployersindustrylaborlegalmarketmarketssectorsupportsystemworkers
SHARED TOKENS (15): "among", "associations", "business", "competitive", "employees", "employers", "industry", "labor", "legal", "market", "markets", "sector", "support", "system", "workers".
0.300
administeredamongassociationbenefitsbusinesscommunitycoveringgovernmentinjuryinsurancemedicalmembernationalorganizationplanspublicsystem
SHARED TOKENS (17): "administered", "among", "association", "benefits", "business", "community", "covering", "government", "injury", "insurance", "medical", "member", "national", "organization", "plans", "public", "system".
0.300
administrativeemployeesemployersfamiliesfamilyfederalgovernsgroupguidelineshealthcareinsurancelifemedicalmembersnationalplansrequiresstandardstitleworkers
SHARED TOKENS (20): "administrative", "employees", "employers", "families", "family", "federal", "governs", "group", "guidelines", "healthcare", "insurance", "life", "medical", "members", "national", "plans", "requires", "standards", "title", "workers".
0.300
actionsdepartmenteducationenforcementguidelineshealthcarelevellicenselicensingmedicalnationalpracticeprofessionalsafetytraffictraining
SHARED TOKENS (16): "actions", "department", "education", "enforcement", "guidelines", "healthcare", "level", "license", "licensing", "medical", "national", "practice", "professional", "safety", "traffic", "training".
0.300
Foreclosure ↗ Q231710 KW CROSS HIGH
associationcannotcompletecontractorsdebtfeelegalpaymentprincipalpropertyrealsecuritystatutorytitletrust
SHARED TOKENS (15): "association", "cannot", "complete", "contractors", "debt", "fee", "legal", "payment", "principal", "property", "real", "security", "statutory", "title", "trust".
0.300
associationbusinesscertificateformgovernedincomelegalliabilitylicensemedicalmemberoperatingoperationsorganizationorganizedphysicalprimaryprofessionalrequiredsingle
SHARED TOKENS (20): "association", "business", "certificate", "form", "governed", "income", "legal", "liability", "license", "medical", "member", "operating", "operations", "organization", "organized", "physical", "primary", "professional", "required", "single".
0.300
activeamericanassociationassociationscommercialcommunitydevelopmentestateformgoverngovernedgovernsgrowthlandlegallevellifelocalmanagingmember
SHARED TOKENS (30): "active", "american", "association", "associations", "commercial", "community", "development", "estate", "form", "govern", "governed", "governs", "growth", "land", "legal", "level", "life", "local", "managing", "member"....
0.300
activecannotchaptercodedistrictdistrictseffectivefederalgoverngovernmentitselfjudgeproceedingsstandingsystem
SHARED TOKENS (15): "active", "cannot", "chapter", "code", "district", "districts", "effective", "federal", "govern", "government", "itself", "judge", "proceedings", "standing", "system".
0.300
chapterclaimscodedebtfinancialformgeneralincomepersonalplanspropertysectionstatutesstatutorytitle
SHARED TOKENS (15): "chapter", "claims", "code", "debt", "financial", "form", "general", "income", "personal", "plans", "property", "section", "statutes", "statutory", "title".
0.300
activeadministrativeagenciesannualdistrictestablishedfederalintermediatelegalnationalorganizedpopulationreviewsecuritystrongsystemwashington
SHARED TOKENS (17): "active", "administrative", "agencies", "annual", "district", "established", "federal", "intermediate", "legal", "national", "organized", "population", "review", "security", "strong", "system", "washington".
0.300
associationassociationsbusinesscouncilgenerallegalmembersorganizationsorganizedphysicalpracticepracticingprofessionalpublicregulationseparateserving
SHARED TOKENS (17): "association", "associations", "business", "council", "general", "legal", "members", "organizations", "organized", "physical", "practice", "practicing", "professional", "public", "regulation", "separate", "serving".
0.300
businesscommercialestatefeefinancialformgeneralindependentinstitutionalinsurancelandlegallenderslifeoutsidepaymentpropertyrealrequirementsecurity
SHARED TOKENS (23): "business", "commercial", "estate", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "land", "legal", "lenders", "life", "outside", "payment", "property", "real", "requirement", "security"....
0.300
Annexation ↗ Q194465 EXACT TITLE
actionslegalphysicalrecognizedtitle
SHARED TOKENS (5): "actions", "legal", "physical", "recognized", "title". | EXACT TITLE in legal: "Annexation".
0.300
actionsagenciesauthoritycouncilenvironmentenvironmentalestablishedfederalgovernmentjanuarynationalqualityreportsrequirementrequires
SHARED TOKENS (15): "actions", "agencies", "authority", "council", "environment", "environmental", "established", "federal", "government", "january", "national", "quality", "reports", "requirement", "requires".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
authoritychargescodeconstructioncouncildevelopersdistrictenvironmentalestategeneralinsurancelevellocalnationalplanningproductspublicrealregulatesafety
SHARED TOKENS (22): "authority", "charges", "code", "construction", "council", "developers", "district", "environmental", "estate", "general", "insurance", "level", "local", "national", "planning", "products", "public", "real", "regulate", "safety"....
0.300
actionsclaimsdisclosureemploymentenforcementfinancialgovernmentinstitutionsorganizationorganizationspublicregulatereportresourcessectorwork
SHARED TOKENS (16): "actions", "claims", "disclosure", "employment", "enforcement", "financial", "government", "institutions", "organization", "organizations", "public", "regulate", "report", "resources", "sector", "work".
0.300
effectiveexperienceformqualityreview
SHARED TOKENS (5): "effective", "experience", "form", "quality", "review". | EXACT TITLE in dental: "Clear aligners".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
businessexpansionexplicitlyfinancialgrowthlegalliabilitylicenseslicensingmarketobligationsownedpracticeproductspropertyregulatesystem
SHARED TOKENS (17): "business", "expansion", "explicitly", "financial", "growth", "legal", "liability", "licenses", "licensing", "market", "obligations", "owned", "practice", "products", "property", "regulate", "system".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessactionsbenefitsdatadatefinancialfullgovernmentlevellicenseofficeonlinepersonalprogramrecordsreportresourcessecuritytechnologyuniversity
SHARED TOKENS (20): "access", "actions", "benefits", "data", "date", "financial", "full", "government", "level", "license", "office", "online", "personal", "program", "records", "report", "resources", "security", "technology", "university".
0.300
additionalamericancollegeeducationenvironmentalhistoryhomemaintenancemedicalneedsoralphysicalpracticespecialtytraining
SHARED TOKENS (15): "additional", "american", "college", "education", "environmental", "history", "home", "maintenance", "medical", "needs", "oral", "physical", "practice", "specialty", "training".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
actionsadministrativeamericananalysisassistanceassociationbusinessconducteducationenvironmentestablishedexperiencefamilyformsfullgovernmentlaborlegallegislativelevel
SHARED TOKENS (40): "actions", "administrative", "american", "analysis", "assistance", "association", "business", "conduct", "education", "environment", "established", "experience", "family", "forms", "full", "government", "labor", "legal", "legislative", "level"....
🫐 BERRY141 edges
0.280
annualdemandeducationeffectivegenerallocalneedsoralprogrampublicreachresourcesschoolspecialty
SHARED TOKENS (14): "annual", "demand", "education", "effective", "general", "local", "needs", "oral", "program", "public", "reach", "resources", "school", "specialty".
0.280
medicalmemberssupporttraining
SHARED TOKENS (4): "medical", "members", "support", "training". | EXACT TITLE in dental: "Dental assistant".
0.280
americancommissionexpandedfullgeneralprofileprogramqualityresidencysafetyspecialistsspecialtystandardsworks
SHARED TOKENS (14): "american", "commission", "expanded", "full", "general", "profile", "program", "quality", "residency", "safety", "specialists", "specialty", "standards", "works".
0.280
contractorsemployeesemployersestablishedfederalformationgovernmentindependentlabormembersnationalorganizationsectorworkers
SHARED TOKENS (14): "contractors", "employees", "employers", "established", "federal", "formation", "government", "independent", "labor", "members", "national", "organization", "sector", "workers".
0.280
actionsdateeducationenvironmentalhealthcarehomeleadinglevelmaintainorganizationoutsideprimaryqualitywater
SHARED TOKENS (14): "actions", "date", "education", "environmental", "healthcare", "home", "leading", "level", "maintain", "organization", "outside", "primary", "quality", "water".
0.280
Health equity ↗ Q1512929 KW CROSS HIGH
accessamongcannotcompletedevelopmenthealthcarelevellifeorganizationphysicalpopulationpresencequalityresources
SHARED TOKENS (14): "access", "among", "cannot", "complete", "development", "healthcare", "level", "life", "organization", "physical", "population", "presence", "quality", "resources".
0.280
accessdepartmenteventsexperiencefederalfinancialgovernmentmalpracticeofficesprimaryprofessionalsprogramresourcessupport
SHARED TOKENS (14): "access", "department", "events", "experience", "federal", "financial", "government", "malpractice", "offices", "primary", "professionals", "program", "resources", "support".
0.280
administeredassistanceenvironmentalfederalformgroundwatermaintainownedphysicalprimaryqualityresourcewaterworks
SHARED TOKENS (14): "administered", "assistance", "environmental", "federal", "form", "groundwater", "maintain", "owned", "physical", "primary", "quality", "resource", "water", "works".
0.280
environmentformmaintenanceoral
SHARED TOKENS (4): "environment", "form", "maintenance", "oral". | EXACT TITLE in dental: "Periodontal surgery".
0.280
groundwaterlegalphysicalwater
SHARED TOKENS (4): "groundwater", "legal", "physical", "water". | EXACT TITLE in legal: "Water right".
0.280
agenciesauthorityeffectivegovernmenthealthcareindependentlicensingmarketsofficeproductsregulationregulatorysafetystandards
SHARED TOKENS (14): "agencies", "authority", "effective", "government", "healthcare", "independent", "licensing", "markets", "office", "products", "regulation", "regulatory", "safety", "standards".
0.280
amongdepartmentexpandedguidelineshealthcarelocalmanagingmedicalorganizationpracticepublicpublishessafetysystem
SHARED TOKENS (14): "among", "department", "expanded", "guidelines", "healthcare", "local", "managing", "medical", "organization", "practice", "public", "publishes", "safety", "system".
0.280
authoritydepartmentemployeesfederalfeedmedicalofficesprimaryproductspublicreportssafetysectionwork
SHARED TOKENS (14): "authority", "department", "employees", "federal", "feed", "medical", "offices", "primary", "products", "public", "reports", "safety", "section", "work".
0.260
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotcriticalfamilyjudgelegallifemedicalmemberpersonalprofessionalpropertypublic
SHARED TOKENS (13): "authority", "cannot", "critical", "family", "judge", "legal", "life", "medical", "member", "personal", "professional", "property", "public".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
departmentidahopublic
SHARED TOKENS (3): "department", "idaho", "public". | EXACT TITLE in dental: "Idaho Department of Health and Welfare".
0.260
agenciesauthoritycommissionfederalfinancialindustrylevelliabilityorganizationsprimaryregulationregulatorysecurity
SHARED TOKENS (13): "agencies", "authority", "commission", "federal", "financial", "industry", "level", "liability", "organizations", "primary", "regulation", "regulatory", "security".
0.260
actionsactiveamericanchildcommunityformsgovernmentgroupminimumpermitspracticepublicrequires
SHARED TOKENS (13): "actions", "active", "american", "child", "community", "forms", "government", "group", "minimum", "permits", "practice", "public", "requires".
0.260
businessfinancialgroup
SHARED TOKENS (3): "business", "financial", "group". | EXACT TITLE in dental: "Consolidation (business)".
0.260
collegenetworkuniversity
SHARED TOKENS (3): "college", "network", "university". | EXACT TITLE in dental: "Carrington College".
0.260
additionalcriticaldevelopmentenvironmentalfullmaterialneedsoralpriorreachreceivedroomtechnology
SHARED TOKENS (13): "additional", "critical", "development", "environmental", "full", "material", "needs", "oral", "prior", "reach", "received", "room", "technology".
0.260
Sleep apnea ↗ Q213600 KW CROSS HIGH
additionalanalysisconcentrationdetermineseffectiveexperiencefamilyflowformgeneralhistorylevelmember
SHARED TOKENS (13): "additional", "analysis", "concentration", "determines", "effective", "experience", "family", "flow", "form", "general", "history", "level", "member".
0.260
legalreviewsingle
SHARED TOKENS (3): "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.260
additionaladministeredchilddepartmentemployeesemployersfamilylabormedicalmemberpublicworkworkers
SHARED TOKENS (13): "additional", "administered", "child", "department", "employees", "employers", "family", "labor", "medical", "member", "public", "work", "workers".
0.260
agenciesbusinessformhealthcareincomeinstitutionslegalorganizationpaymentpersonalproductsrangescale
SHARED TOKENS (13): "agencies", "business", "form", "healthcare", "income", "institutions", "legal", "organization", "payment", "personal", "products", "range", "scale".
0.240
Managed care ↗ Q1416012 KW CROSS HIGH
formsgroupgrowthhealthcareinsurancelifemaintenancemedicalorganizationorganizationsqualitysystem
SHARED TOKENS (12): "forms", "group", "growth", "healthcare", "insurance", "life", "maintenance", "medical", "organization", "organizations", "quality", "system".
0.240
Primary care ↗ KW CROSS HIGH
additionalcontactcontinuingfamilygeneralhealthcarephysicalprimaryprincipalprofessionalprofessionalssystem
SHARED TOKENS (12): "additional", "contact", "continuing", "family", "general", "healthcare", "physical", "primary", "principal", "professional", "professionals", "system".
0.240
Biomedical waste ↗ KW CROSS HIGH
contactenvironmentenvironmentalgeneralhealthcarehomeinjurymaterialmedicalofficesoperatingsources
SHARED TOKENS (12): "contact", "environment", "environmental", "general", "healthcare", "home", "injury", "material", "medical", "offices", "operating", "sources".
0.240
amongannualclaimsgovernmentgrouphistorylegaloutsideprogramrepresentationresidencysection
SHARED TOKENS (12): "among", "annual", "claims", "government", "group", "history", "legal", "outside", "program", "representation", "residency", "section".
0.240
activeadministrativeamericancoveringdistrictdistrictseasternfederalidahomeetingwashingtonwestern
SHARED TOKENS (12): "active", "administrative", "american", "covering", "district", "districts", "eastern", "federal", "idaho", "meeting", "washington", "western".
0.240
amonganalysisdatadevelopmenthealthcaremedicalplanningprofessionalspublicregulatorysupporttrust
SHARED TOKENS (12): "among", "analysis", "data", "development", "healthcare", "medical", "planning", "professionals", "public", "regulatory", "support", "trust".
0.240
certificategeneralmedicaloralpracticeprogramrecognizedrequiredrequiresresidencyspecialtytraining
SHARED TOKENS (12): "certificate", "general", "medical", "oral", "practice", "program", "recognized", "required", "requires", "residency", "specialty", "training".
0.240
activeamongannualformhistoryitselfleadinglow-incomeoralorganizationpracticewestern
SHARED TOKENS (12): "active", "among", "annual", "form", "history", "itself", "leading", "low-income", "oral", "organization", "practice", "western".
0.240
Grand jury ↗ Q1323789 KW CROSS HIGH
chargesconductdeterminesindependentlegalmembersphysicalproceedingspublicrequiredreviewseparate
SHARED TOKENS (12): "charges", "conduct", "determines", "independent", "legal", "members", "physical", "proceedings", "public", "required", "review", "separate".
0.240
administrativecannotclaimscommissionemployersemploymentestablishedfederalgovernmentnationalpracticeprior
SHARED TOKENS (12): "administrative", "cannot", "claims", "commission", "employers", "employment", "established", "federal", "government", "national", "practice", "prior".
0.240
communityformformsfreelegalmaterialmembernationalorganizationspublicrecognizedsecurity
SHARED TOKENS (12): "community", "form", "forms", "free", "legal", "material", "member", "national", "organizations", "public", "recognized", "security".
0.240
Probate court ↗ Q7246899 KW CROSS HIGH
actionsauthoritycountiesdeterminesdistributiondistrictestatelegislativemedicationpersonalpropertystatutory
SHARED TOKENS (12): "actions", "authority", "counties", "determines", "distribution", "district", "estate", "legislative", "medication", "personal", "property", "statutory".
0.220
formslife
SHARED TOKENS (2): "forms", "life". | EXACT TITLE in dental: "Sterilization (microbiology)".
0.220
Mental health ↗ Q317309 KW CROSS HIGH
amongcommunitydetermineslevellifemanagingorganizationpersonalprofessionalrelationshipswork
SHARED TOKENS (11): "among", "community", "determines", "level", "life", "managing", "organization", "personal", "professional", "relationships", "work".
0.220
americanamongcannotgenerallegalproceedingspublicrangerequiredsystemtrust
SHARED TOKENS (11): "american", "among", "cannot", "general", "legal", "proceedings", "public", "range", "required", "system", "trust".
0.220
Felony ↗ Q178844 EXACT TITLE
additionalland
SHARED TOKENS (2): "additional", "land". | EXACT TITLE in legal: "Felony".
0.220
Dentist ↗ Q27349 EXACT TITLE
oralprofessional
SHARED TOKENS (2): "oral", "professional". | EXACT TITLE in dental: "Dentist".
0.220
administrativeassociationformgrouplegallifeorganizationspersonalphysicalsafetysystem
SHARED TOKENS (11): "administrative", "association", "form", "group", "legal", "life", "organizations", "personal", "physical", "safety", "system".
0.220
Overtime ↗ Q667022 KW CROSS HIGH
beyondemployeesemployersemploymentlevelnationalreceivedsupplyworkworkersworks
SHARED TOKENS (11): "beyond", "employees", "employers", "employment", "level", "national", "received", "supply", "work", "workers", "works".
0.220
Trademark ↗ Q167270 KW CROSS HIGH
agenciesenforcementlegalmemberminimumofficeprimaryproductspropertysourcesstandards
SHARED TOKENS (11): "agencies", "enforcement", "legal", "member", "minimum", "office", "primary", "products", "property", "sources", "standards".
0.220
Dentures ↗ Q143567 EXACT TITLE
completeoral
SHARED TOKENS (2): "complete", "oral". | EXACT TITLE in dental: "Dentures".
0.220
environmentfinancialgovernmentguidelinesinjurylow-incomenationalorganizationspropertystreettraffic
SHARED TOKENS (11): "environment", "financial", "government", "guidelines", "injury", "low-income", "national", "organizations", "property", "street", "traffic".
0.220
forminsurance
SHARED TOKENS (2): "form", "insurance". | EXACT TITLE in dental: "Dental insurance".
0.220
analysisannualcollectionenvironmentalflowformlifeorganizationphysicalprimaryquality
SHARED TOKENS (11): "analysis", "annual", "collection", "environmental", "flow", "form", "life", "organization", "physical", "primary", "quality".
0.220
assistancecannothomeimmediateinjurylifemedicaloutsidequalityresourcesstreet
SHARED TOKENS (11): "assistance", "cannot", "home", "immediate", "injury", "life", "medical", "outside", "quality", "resources", "street".
0.220
appliescompensationfederalgovernmentlevellifelocalpropertypublicrequirementrequires
SHARED TOKENS (11): "applies", "compensation", "federal", "government", "level", "life", "local", "property", "public", "requirement", "requires".
0.210
governmentidahooffice
SHARED TOKENS (3): "government", "idaho", "office". | URL->B (1): https://sos.idaho.gov/.
0.210
Fluoride ↗ Q44793182 EXACT TITLE
water
SHARED TOKENS (1): "water". | EXACT TITLE in dental: "Fluoride".
0.210
oral
SHARED TOKENS (1): "oral". | EXACT TITLE in dental: "Oral and maxillofacial surgery".
0.210
Family law ↗ Q384014 EXACT TITLE
family
SHARED TOKENS (1): "family". | EXACT TITLE in legal: "Family law".
0.210
assistance
SHARED TOKENS (1): "assistance". | EXACT TITLE in dental: "Discovery (law)".
0.210
Paternity ↗ Q16881001 EXACT TITLE
child
SHARED TOKENS (1): "child". | EXACT TITLE in legal: "Paternity".
0.200
appliesassistancecommunitycounseldistrictgovernmentlevelpublicrequirementrequires
SHARED TOKENS (10): "applies", "assistance", "community", "counsel", "district", "government", "level", "public", "requirement", "requires".
0.200
Expungement ↗ Q2352928 KW CROSS HIGH
enforcementfederalgeneraljudgelegalpriorproceedingspublicrecordsreview
SHARED TOKENS (10): "enforcement", "federal", "general", "judge", "legal", "prior", "proceedings", "public", "records", "review".
0.200
adjacentartificialbridgedentaldentistryimplantsrestorationteethtooth
EXACT TITLE in dental: "Bridge (dentistry)".
0.200
Trade secret ↗ Q602938 KW CROSS HIGH
amongbusinesscommercialcompetitivedisclosureformslegallicensedmaintainproperty
SHARED TOKENS (10): "among", "business", "commercial", "competitive", "disclosure", "forms", "legal", "licensed", "maintain", "property".
0.200
Attorney ↗ Q1289214 EXACT TITLE
south
EXACT TITLE in legal: "Attorney".
0.200
amongcontactdevelopmentenforcementhealthcareinjurylegislativerecognitionregulationworkers
SHARED TOKENS (10): "among", "contact", "development", "enforcement", "healthcare", "injury", "legislative", "recognition", "regulation", "workers".
0.200
establishedfederalgovernmenthistoryjudgelegallocalphysicalpropertysearch
SHARED TOKENS (10): "established", "federal", "government", "history", "judge", "legal", "local", "physical", "property", "search".
0.200
EXACT TITLE in legal: "Subdivision".
0.200
americanapplieseducationfederalgovernmentitselflocalprimaryrequiressection
SHARED TOKENS (10): "american", "applies", "education", "federal", "government", "itself", "local", "primary", "requires", "section".
0.200
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanappliesgovernmentlandlegalproceedingsrequirementstatutory
SHARED TOKENS (10): "administrative", "agencies", "american", "applies", "government", "land", "legal", "proceedings", "requirement", "statutory".
0.200
amongcommissiondistrictlegaloversightownedpublicregulationregulatoryserves
SHARED TOKENS (10): "among", "commission", "district", "legal", "oversight", "owned", "public", "regulation", "regulatory", "serves".
0.200
Plea bargain ↗ Q664736 KW CROSS HIGH
authoritychargesformslegallocalpracticepublicresourcesservesstandards
SHARED TOKENS (10): "authority", "charges", "forms", "legal", "local", "practice", "public", "resources", "serves", "standards".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will".
0.200
adultchildrencleancreatingdecaydentalhighermaterialspreventrisksealantsealantssurfacesteethtoothtreatment
EXACT TITLE in dental: "Dental sealant".
0.200
activeconcentrationcontactdeterminesfreeheavilymarketproductsprofessionalswater
SHARED TOKENS (10): "active", "concentration", "contact", "determines", "free", "heavily", "market", "products", "professionals", "water".
0.200
actionscombinedcompleteformhealthcareitselflegalmedicalpersonalsingle
SHARED TOKENS (10): "actions", "combined", "complete", "form", "healthcare", "itself", "legal", "medical", "personal", "single".
0.200
authoritycodeconsumerdistrictfederalgovernedgovernspropertysectiontitle
SHARED TOKENS (10): "authority", "code", "consumer", "district", "federal", "governed", "governs", "property", "section", "title".
0.180
authoritydistrictdistrictsgovernmentlegislaturelocalorganizedpublicwater
SHARED TOKENS (9): "authority", "district", "districts", "government", "legislature", "local", "organized", "public", "water".
0.180
Disinfectant ↗ Q73984 KW CROSS HIGH
contacteffectiveformformslifemedicalphysicalsectorwork
SHARED TOKENS (9): "contact", "effective", "form", "forms", "life", "medical", "physical", "sector", "work".
0.180
datademanddeterminesdevelopmentleadingofficesoralpracticespecialty
SHARED TOKENS (9): "data", "demand", "determines", "development", "leading", "offices", "oral", "practice", "specialty".
0.180
agenciesdistributionenforcementfederalmedicalnationalrequiredsingletitle
SHARED TOKENS (9): "agencies", "distribution", "enforcement", "federal", "medical", "national", "required", "single", "title".
0.180
agenciesappliesassociationexpandedformsfreegovernmentpriorschool
SHARED TOKENS (9): "agencies", "applies", "association", "expanded", "forms", "free", "government", "prior", "school".
0.180
Damages ↗ Q308922 KW CROSS HIGH
compensationformgeneralinjurylegalmedicalphysicalpropertyrecognized
SHARED TOKENS (9): "compensation", "form", "general", "injury", "legal", "medical", "physical", "property", "recognized".
0.180
accessamongdatamedicaloralplanningsinglestandardtechnology
SHARED TOKENS (9): "access", "among", "data", "medical", "oral", "planning", "single", "standard", "technology".
0.180
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesdeterminesdistributionestatefamilyformsmemberspropertystatutory
SHARED TOKENS (9): "applies", "determines", "distribution", "estate", "family", "forms", "members", "property", "statutory".
0.180
Debtor ↗ Q157470 KW CROSS HIGH
consumerdebtfamilyfullgovernmentlegaloralpersonalrequires
SHARED TOKENS (9): "consumer", "debt", "family", "full", "government", "legal", "oral", "personal", "requires".
0.180
analysisfulllegallegislativeproceedingspropertyrequiresstatutesstatutory
SHARED TOKENS (9): "analysis", "full", "legal", "legislative", "proceedings", "property", "requires", "statutes", "statutory".
0.180
Road transport ↗ KW CROSS HIGH
developmentformsfulllicensinglocalsafetyseparatestandardtraffic
SHARED TOKENS (9): "development", "forms", "full", "licensing", "local", "safety", "separate", "standard", "traffic".
0.180
appliescannotformfulljudgematerialrealstandardsupport
SHARED TOKENS (9): "applies", "cannot", "form", "full", "judge", "material", "real", "standard", "support".
0.160
amongdetermineseasternlandorganizedpropertysystemwater
SHARED TOKENS (8): "among", "determines", "eastern", "land", "organized", "property", "system", "water".
0.160
adaboisegovernmentidahomunicipalpopulationseparatestreet
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "municipal", "population", "separate", "street".
0.160
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsuranceobligationsprimaryprincipalpropertytransactiontrust
SHARED TOKENS (8): "established", "insurance", "obligations", "primary", "principal", "property", "transaction", "trust".
0.160
additionalchargesemployershistorylendersnationalrecordstraffic
SHARED TOKENS (8): "additional", "charges", "employers", "history", "lenders", "national", "records", "traffic".
0.160
cannotconductinsurancelegalliabilitypublicrecognitionsystem
SHARED TOKENS (8): "cannot", "conduct", "insurance", "legal", "liability", "public", "recognition", "system".
0.160
Civil liberties ↗ Q29556 KW CROSS HIGH
authorityexpandinggovernmentlifepersonalpropertysecuritywork
SHARED TOKENS (8): "authority", "expanding", "government", "life", "personal", "property", "security", "work".
0.160
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualbenefitscontractorsemployeesemployersindependentwork
SHARED TOKENS (8): "among", "annual", "benefits", "contractors", "employees", "employers", "independent", "work".
0.160
U visa ↗ Q17086349 KW CROSS HIGH
agenciesenforcementfamilygovernmentimmediatememberspermitsphysical
SHARED TOKENS (8): "agencies", "enforcement", "family", "government", "immediate", "members", "permits", "physical".
0.160
administrativefederaljudgelegalofficepriorproceedingsreview
SHARED TOKENS (8): "administrative", "federal", "judge", "legal", "office", "prior", "proceedings", "review".
0.160
analysisannualdataformsindustrymedicalrepresentationtechnology
SHARED TOKENS (8): "analysis", "annual", "data", "forms", "industry", "medical", "representation", "technology".
0.160
distributiongovernmentpersonalpracticeproductsregulateregulationsystem
SHARED TOKENS (8): "distribution", "government", "personal", "practice", "products", "regulate", "regulation", "system".
0.160
Easement ↗ Q448405 KW CROSS HIGH
accessamongitselflandownedpropertypublicreal
SHARED TOKENS (8): "access", "among", "itself", "land", "owned", "property", "public", "real".
0.160
americanassociationidaholaborlifememberservingwestern
SHARED TOKENS (8): "american", "association", "idaho", "labor", "life", "member", "serving", "western".
0.160
Probation ↗ Q13961 KW CROSS HIGH
applieschildcommunitycontactmaintainpermitprogramrequired
SHARED TOKENS (8): "applies", "child", "community", "contact", "maintain", "permit", "program", "required".
0.160
alongsidematerialoperationsplanningprimaryrequiredsystemwork
SHARED TOKENS (8): "alongside", "material", "operations", "planning", "primary", "required", "system", "work".
0.160
Lawsuit ↗ Q697327 KW CROSS HIGH
actionsbusinessclaimslegalorganizationspublicrepresentingrequired
SHARED TOKENS (8): "actions", "business", "claims", "legal", "organizations", "public", "representing", "required".
0.160
Beneficiary ↗ Q2596417 KW CROSS HIGH
benefitsdevelopmentinsurancelegallifepaymentprimarytrust
SHARED TOKENS (8): "benefits", "development", "insurance", "legal", "life", "payment", "primary", "trust".
0.160
Legal clinic ↗ Q1351667 KW CROSS HIGH
conductexperiencefreelegalproprogramschoolwork
SHARED TOKENS (8): "conduct", "experience", "free", "legal", "pro", "program", "school", "work".
0.160
chaptercodefederalformgoverngovernssectiontitle
SHARED TOKENS (8): "chapter", "code", "federal", "form", "govern", "governs", "section", "title".
0.140
conductlegalpropertyrequiredrequirementsearchstandard
SHARED TOKENS (7): "conduct", "legal", "property", "required", "requirement", "search", "standard".
0.140
amongcontactmedicalpracticeprimarystandardworkers
SHARED TOKENS (7): "among", "contact", "medical", "practice", "primary", "standard", "workers".
0.140
datadevelopmenthealthcareinstitutionsmedicalprocessingtechnology
SHARED TOKENS (7): "data", "development", "healthcare", "institutions", "medical", "processing", "technology".
0.140
Criminal law ↗ Q146491 KW CROSS HIGH
commissioncompensationconductestablishedlegislaturepropertysafety
SHARED TOKENS (7): "commission", "compensation", "conduct", "established", "legislature", "property", "safety".
0.140
Tort ↗ Q158970 KW CROSS HIGH
actionscodeestablishedlegalliabilityobligationsseparate
SHARED TOKENS (7): "actions", "code", "established", "legal", "liability", "obligations", "separate".
0.140
Alimony ↗ Q368305 KW CROSS HIGH
childfamilyfinanciallegalmaintenancerequiredsupport
SHARED TOKENS (7): "child", "family", "financial", "legal", "maintenance", "required", "support".
0.140
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahopopulationschool
SHARED TOKENS (7): "ada", "boise", "canyon", "district", "idaho", "population", "school".
0.140
Legal ethics ↗ Q3655952 KW CROSS HIGH
conductdevelopmentitselflegalmemberspracticeprofessional
SHARED TOKENS (7): "conduct", "development", "itself", "legal", "members", "practice", "professional".
0.140
cannothomemaintainoralpracticeprofessionalprofessionals
SHARED TOKENS (7): "cannot", "home", "maintain", "oral", "practice", "professional", "professionals".
0.140
enforcementformfreelegalpropertypublicsearch
SHARED TOKENS (7): "enforcement", "form", "free", "legal", "property", "public", "search".
0.140
formslandlegalliabilitystandardsystemwater
SHARED TOKENS (7): "forms", "land", "legal", "liability", "standard", "system", "water".
0.120
Family court ↗ Q82749 KW CROSS HIGH
childfamilylegalrelationshipssupportsystem
SHARED TOKENS (6): "child", "family", "legal", "relationships", "support", "system".
0.120
Drug court ↗ Q5308883 KW CROSS HIGH
combinedenforcementjudgeleadingpublicwork
SHARED TOKENS (6): "combined", "enforcement", "judge", "leading", "public", "work".
0.120
Due diligence ↗ Q794134 KW CROSS HIGH
appliesbenefitsbusinesslegalqualitystandard
SHARED TOKENS (6): "applies", "benefits", "business", "legal", "quality", "standard".
0.120
americanfulllegalpriorsystemwater
SHARED TOKENS (6): "american", "full", "legal", "prior", "system", "water".
0.120
counseleffectivefulllegalprofessionalrepresentation
SHARED TOKENS (6): "counsel", "effective", "full", "legal", "professional", "representation".
0.120
americanemploymentpermitresidencysupportwork
SHARED TOKENS (6): "american", "employment", "permit", "residency", "support", "work".
0.120
commercialgovernedlegalpropertyrealrequired
SHARED TOKENS (6): "commercial", "governed", "legal", "property", "real", "required".
0.120
formliabilitypersonalproductspropertypublic
SHARED TOKENS (6): "form", "liability", "personal", "products", "property", "public".
0.100
Oral cancer ↗ Q1143025 KW CROSS HIGH
generallocaloralproductsregional
SHARED TOKENS (5): "general", "local", "oral", "products", "regional".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahopopulation
SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "population".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
Sex offender ↗ Q5659979 KW CROSS HIGH
childcontinuinglegalpublicstatutory
SHARED TOKENS (5): "child", "continuing", "legal", "public", "statutory".
0.100
Summons ↗ Q708245 KW CROSS HIGH
administrativeformgovernmentlegalproceedings
SHARED TOKENS (5): "administrative", "form", "government", "legal", "proceedings".
0.100
Parole ↗ Q5357120 KW CROSS HIGH
additionalformoutsideservingsystem
SHARED TOKENS (5): "additional", "form", "outside", "serving", "system".
0.100
Bail ↗ Q162351 KW CROSS HIGH
additionalchargesformpropertyrequired
SHARED TOKENS (5): "additional", "charges", "form", "property", "required".
0.100
cannotcounselenforcementproceedingsrequired
SHARED TOKENS (5): "cannot", "counsel", "enforcement", "proceedings", "required".
0.100
americanleadinglegalmemberpublic
SHARED TOKENS (5): "american", "leading", "legal", "member", "public".
0.100
actionscodecollectiondebtsection
SHARED TOKENS (5): "actions", "code", "collection", "debt", "section".
0.100
businesslegalownedseparatework
SHARED TOKENS (5): "business", "legal", "owned", "separate", "work".
0.100
Fraud ↗ Q28813 KW CROSS HIGH
benefitscompensationitselflegalproperty
SHARED TOKENS (5): "benefits", "compensation", "itself", "legal", "property".
0.100
Nitrous oxide ↗ Q905750 KW CROSS HIGH
amongconcentrationmedicalorganizationroom
SHARED TOKENS (5): "among", "concentration", "medical", "organization", "room".
0.100
businessfinancialformlegalprincipal
SHARED TOKENS (5): "business", "financial", "form", "legal", "principal".
0.100
departmentgeneraloperatingrequiredsystem
SHARED TOKENS (5): "department", "general", "operating", "required", "system".
0.100
Negligence ↗ Q160070 KW CROSS HIGH
actionsconductinjuryphysicalproperty
SHARED TOKENS (5): "actions", "conduct", "injury", "physical", "property".
0.100
3D printing ↗ Q229367 KW CROSS HIGH
constructionlayermaterialrangetechnology
SHARED TOKENS (5): "construction", "layer", "material", "range", "technology".
◈ Frequently Asked Questions
Dental × Legal — Treasure Valley
HAIKU · HIGH GATE
How does the Americans with Disabilities Act of 1990 affect dental practices in Boise and Nampa?
Dental offices operating in Ada County and Canyon County must comply with ADA accessibility requirements for patient facilities, including examination rooms and waiting areas. Idaho state law enforces these federal standards, requiring Treasure Valley dental practices to provide reasonable accommodations for patients with disabilities.
What zoning considerations apply to dental practices opening in Meridian or Eagle?
Dental offices in Meridian and Eagle must obtain proper zoning approval from local city governments, which classify dental practices under specific commercial or professional use categories. Ada County and Canyon County zoning ordinances determine where dental facilities can operate and what signage or parking requirements apply.
How do Idaho Legislature regulations govern dental business liability in the Treasure Valley?
Idaho Legislature statutes establish liability standards and malpractice insurance requirements that dental businesses throughout Boise, Nampa, and Caldwell must follow. Dental practitioners in Ada County and Canyon County operate under state licensing laws that define legal responsibilities and patient rights.
What legal structure should a new dental practice choose when operating in the Boise area?
A dental business in Boise or Eagle may operate as a sole proprietorship, LLC, or professional corporation under Idaho state business law, each with different liability and tax implications. Canyon County and Ada County both recognize these legal entities equally, though malpractice insurance and professional licensing requirements remain uniform across the Treasure Valley.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Dental × Legal 14 QID bridges 283 edges 8,748 ext links 2026-07-17 20:23:55 UTC 8944efb06274a3e3
Dental corridor ↗ Legal corridor ↗ Legal × Dental ↗ boisestandard.org/standard ↗
Parent Corridors
Dental × All Other Verticals