—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Dental ↔ relates to ↔ Healthcare

34 Wikipedia bridge articles confirmed in both vertical ledgers. 325 deterministic cross-vertical edges. 9,334 external source links harvested. Every edge provenance-stamped. Every claim auditable.

34 QID Bridge Articles
325 Cross Edges
9,334 External Sources
382 Wikipedia Articles
34 🌲 Evergreen
192 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Dental
× Healthcare
QID Bridge Articles
34
confirmed Wikipedia overlap
Total Cross Edges
325
External Sources Harvested
9,334
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  17 shared tokens
QID Bridge Titles (20)
IdahoElectronic health recordDentistryPrimary careTelehealthFederally Qualified Health CenterEmergency medical servicesPublic healthMedicaidDental implantRural healthBoise State UniversityPediatric dentistryPediatricsOrthodonticsIdaho State UniversityTreasure ValleyMental healthPreventive healthcareHealth equity
Shared Semantics (20 tokens)
idahopopulationhealthcareboisepatientspublicpatienttreatmentsupportdentaldiseaseprimaryresearchhomeresourcesinformationsystemsaccessinsuranceclinical
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:23:03 UTC
Content Hash
e0ea6a89a7222905
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
34 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (17): "boise", "capital", "early", "idaho", "land", "million", "national", "north", "organized", "population", "products", "significant", "small", "southeast", "technology", "washington", "western". | EXACT TITLE in dental: "Idaho". | EXACT TITLE in healthcare: "Idaho".
boisecapitalearlyidaholandmillionnationalnorthorganizedpopulationproductssignificantsmallsoutheasttechnologywashingtonwestern
gton and Oregon to the west; the state shares a small portion of the Canada–United States border to the north with the Canadian province of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
The most parsimonious explanation we think is that people came down the Pacific Coast, and as they encountered the mouth of the Columbia River, they essentially found an off-ramp from this coastal migration and also found their first viable interior route to the areas that are south of the ice sheet. An early presence of French-Canadian trappers is visible in names and toponyms: Nez Percé, Cœur d'Alène, Boisé, Payette. Some of these names appeared prior to the Lewis and Clark and Astorian expeditions, which included significant numbers of French and Métis guides recruited for their familiarity with the terrain. Idaho, as part of the Oregon Country, was claimed by both the United States and Great Britain until the United States gained undisputed jurisdiction in 1846. From 1843 to 1859, present-day Idaho was under the de facto jurisdiction of the Provisional Government of Oregon. When Oregon became a state in 1859, what is now Idaho was situated in what remained of the original Oregon Territory, designated as the Washington Territory. Between 1849 and the creation of the Idaho Territory in 1863, parts of present-day Idaho were included in the Oregon, Washington, and Dakota Territories. The new Idaho territory included present-day Idaho, Montana, and most of Wyoming. The Lewis and Clark expedition crossed Idaho in 1805 on the way to the Pacific, and in 1806, on the return trip, largely following the Clearwater River in both directions, making it one the last states settled by European Americans. The first non-indigenous settlement was Kullyspell House, established on the shore of Lake Pend Oreille in 1809 by David Thompson of the North West Company for fur trading. In 1812 Donald Mackenzie, working for the Pacific Fur Company at the time, established a post on the lower Clearwater River near present-day Lewiston. This post, known as "MacKenzie's Post" or "Clearwater", operated until the Pacific Fur Company was bought out by the North West Company in 1813, after which the post was abandoned. The first organized non-indigenous communities within the present borders of Idaho were established by Mormon pioneers in 1860. The first permanent, substantial incorporated community was Lewiston, in 1861. Early in its history, Idaho saw a large influx of Chinese immigrants, who by 1870 made up about 28.5% of the territory's population. Idaho achieved statehood in 1890, following a difficult start as a territory, including the transfer of the territorial capital from Lewiston to Boise, disenfranchisement of Mormon polygamists upheld by the U.S. Supreme Court in 1890, and a federal attempt to split the territory between Washington Territory, which gained statehood in 1889, a year before Idaho, and the state of Nevada which had been a state since 1864. Idaho was one of the hardest hit of the Pacific Northwest states during the Great Depression. Prices plummeted for Idaho's major crops: in 1932 a bushel of potatoes brought only ten cents compared to 1919 for $1.51, while Idaho farmers saw their annual income of $685 in 1929 drop to $250 by 1932. Between 1991 and 2002, Idaho expanded its commercial base to include the science and technology sector which accounted for over 25% of its gross state product in 2001. During the COVID-19 pandemic, Idaho enacted statewide crisis standards of care as COVID-19 patients overwhelmed hospitals.
The landscape is rugged, with some of the largest unspoiled natural areas in the United States. For example, at 2.3 million acres (930,000 ha), the Frank Church-River of No Return Wilderness Area is the largest contiguous area of protected wilderness in the continental United States. Idaho is a Rocky Mountain state with abundant natural resources and scenic areas. The state has snow-capped mountain ranges, rapids, vast lakes and steep canyons. The waters of the Snake River run through Hells Canyon, the deepest gorge in the United States. Shoshone Falls falls down cliffs from a height greater than Niagara Falls. By far, the most important river in Idaho is the Snake River, a major tributary of the Columbia River. The Snake River flows from Yellowstone in northwestern Wyoming through the Snake River Plain in southern Idaho before turning north, leaving the state at Lewiston before joining the Columbia in Kennewick. Other major rivers are the Clark Fork/Pend Oreille River, the Spokane River, and, many major tributaries of the Snake River, including the Clearwater River, the Salmon River, the Boise River, and the Payette River. The Salmon River empties into the Snake in Hells Canyon and forms the southern boundary of Nez Perce County on its north shore, of which Lewiston is the county seat. The Port of Lewiston, at the confluence of the Clearwater and the Snake Rivers is the farthest inland seaport on the West Coast at 465 river miles from the Pacific at Astoria, Oregon. The vast majority of Idaho's population lives in the Snake River Plain, a valley running from across the entirety of southern Idaho from east to west. The valley contains the major cities of Boise, Meridian, Nampa, Caldwell, Twin Falls, Idaho Falls, and Pocatello. The plain served as an easy pass through the Rocky Mountains for westward-bound settlers on the Oregon Trail, and many settlers chose to settle the area rather than risking the treacherous route through the Blue Mountains and the Cascade Range to the west. The western region of the plain is known as the Treasure Valley, bound between the Owyhee Mountains to the southwest and the Boise Mountains to the northeast.
Electronic health record
Q10871684 EXACT TITLE 1.000
QID OVERLAP: Q10871684 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (29): "age", "clinical", "clinicians", "collection", "conditions", "data", "date", "delivery", "digital", "healthcare", "history", "identify", "information", "long-term", "medication", "multiple", "need", "networks", "patient", "patients".... | EXACT TITLE in dental: "Electronic health record".
ageclinicalclinicianscollectionconditionsdatadatedeliverydigitalhealthcarehistoryidentifyinformationlong-termmedicationmultipleneednetworkspatientpatientspopulationproviderprovidersprovidingrecordrecordsrisksupportsystems
ther information networks and exchanges. EHRs may include a range of data, including demographics, medical history, medication and allergies, immunization status, laboratory test results, radiology images, vital signs, personal statistics like age and weight, and billing information. For several decades, EHRs have been touted as key to increasing quality of care. EHR combines all patients' demographics into a large pool, which assists providers in the creation of "new treatments or innovation in healthcare delivery" to improve quality outcomes in healthcare. Combining multiple types of clinical data within electronic health records has enabled clinicians to identify and stratify patients with chronic conditions. EHR systems may also support improvements in quality of care through the use of data and analytics to help prevent hospitalizations among high-risk patients. EHR systems are designed to store data accurately and to capture a patient's state across time. It eliminates the need to track down a patient's previous paper medical records and assists in ensuring data is up-to-date, accurate, and legible. It also allows open communication between the patient and the provider while providing "privacy and security." EHR is cost-efficient, decreases the risk of lost paperwork, and can reduce risk of data replication as there is only one modifiable file, which means the file is more likely up to date. Due to the digital information being searchable and in a single file, EMRs (electronic medical records) are more effective when extracting medical data to examine possible trends and long-term changes in a patient.
Terminology The terms electronic health record (EHR), electronic patient record (EPR), and electronic medical record (EMR) have often been used interchangeably, but "subtle" differences exist. The EHR is a more longitudinal collection of the electronic health information of individual patients or populations. The EMR, in contrast, is the patient record created by providers for specific encounters in hospitals and ambulatory environments and can serve as a data source for an EHR. EMRs are essentially digital versions of the paper documents used in a clinician's office, typically functioning as an internal system within a practice. An EMR includes the medical and treatment history of patients treated by that specific practice. In contrast, a personal health record (PHR) is an electronic application for recording individual medical data that the individual patient controls and may make available to health providers. Comparison with paper-based records While there is ongoing debate regarding the advantages of electronic health records compared with paper records, the research literature presents a more nuanced view of their benefits and limitations. Increasing discontent and burnout among healthcare professionals is well documented as of 2023, with several studies finding that a leading cause of job frustration and increasing stress for most doctors and nurses is the increasing burden of increasingly complex record-keeping, paperwork, and administrative workloads.. Proponents of EHR note that these systems can substantially reduce such burdens, for example cutting time spent on insurance eligibility tasks by more than 80%. But along with increased convenience, transparency, portability, and accessibility, there is also an increased risk that sensitive information may be accessed by unauthorized persons or unscrupulous users (versus paper medical records). This is acknowledged by the increased security requirements for electronic medical records included in the Health Insurance Portability and Accountability Act (HIPAA) and by large-scale breaches in confidential records reported by EMR users. Meanwhile, handwritten paper medical records may be poorly legible, which can contribute to medical errors. Pre-printed forms, standardization of abbreviations, and standards for penmanship were encouraged to improve the reliability of paper medical records. An example of possible medical errors is the administration of medication. Medication is an intervention that can turn a person's status from stable to unstable very quickly. With paper documentation it is very easy to not properly document the administration of medication, the time given, or errors such as giving the "wrong drug, dose, form, or not checking for allergies," and could affect the patient negatively. It has been reported that these errors have been reduced by "55-83%" because records are now online and require specific steps to avoid these errors. Electronic records may help with the standardization of forms, terminology, and data input. Digitization of forms facilitates the collection of data for epidemiology and clinical studies. However, standardization may create challenges for local practice. Overall, those with EMRs that have automated notes and records, order entry, and clinical decision support had fewer complications, lower mortality rates, and lower costs. EMRs can be continuously updated (within certain legal limitations: see below). If the ability to exchange records between different EMR systems were perfected ("interoperability"), it would facilitate the coordination of health care delivery in non-affiliated health care facilities. In addition, data from an electronic system can be used anonymously for statistical reporting in matters such as quality improvement, resource management, and public health communicable disease surveillance.
Comparison with paper-based records While there is ongoing debate regarding the advantages of electronic health records compared with paper records, the research literature presents a more nuanced view of their benefits and limitations. Increasing discontent and burnout among healthcare professionals is well documented as of 2023, with several studies finding that a leading cause of job frustration and increasing stress for most doctors and nurses is the increasing burden of increasingly complex record-keeping, paperwork, and administrative workloads.. Proponents of EHR note that these systems can substantially reduce such burdens, for example cutting time spent on insurance eligibility tasks by more than 80%. But along with increased convenience, transparency, portability, and accessibility, there is also an increased risk that sensitive information may be accessed by unauthorized persons or unscrupulous users (versus paper medical records). This is acknowledged by the increased security requirements for electronic medical records included in the Health Insurance Portability and Accountability Act (HIPAA) and by large-scale breaches in confidential records reported by EMR users. Meanwhile, handwritten paper medical records may be poorly legible, which can contribute to medical errors. Pre-printed forms, standardization of abbreviations, and standards for penmanship were encouraged to improve the reliability of paper medical records. An example of possible medical errors is the administration of medication. Medication is an intervention that can turn a person's status from stable to unstable very quickly. With paper documentation it is very easy to not properly document the administration of medication, the time given, or errors such as giving the "wrong drug, dose, form, or not checking for allergies," and could affect the patient negatively. It has been reported that these errors have been reduced by "55-83%" because records are now online and require specific steps to avoid these errors. Electronic records may help with the standardization of forms, terminology, and data input. Digitization of forms facilitates the collection of data for epidemiology and clinical studies. However, standardization may create challenges for local practice. Overall, those with EMRs that have automated notes and records, order entry, and clinical decision support had fewer complications, lower mortality rates, and lower costs. EMRs can be continuously updated (within certain legal limitations: see below). If the ability to exchange records between different EMR systems were perfected ("interoperability"), it would facilitate the coordination of health care delivery in non-affiliated health care facilities. In addition, data from an electronic system can be used anonymously for statistical reporting in matters such as quality improvement, resource management, and public health communicable disease surveillance.
Dentistry
Q12128 EXACT TITLE 1.000
QID OVERLAP: Q12128 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (27): "accredited", "blood", "conditions", "dental", "dentist", "dentistry", "diagnosis", "disease", "focused", "guide", "history", "hospitals", "management", "medicine", "oral", "patients", "primary", "private", "require", "research".... | EXACT TITLE in dental: "Dentistry". | EXACT TITLE in healthcare: "Dentistry".
accreditedbloodconditionsdentaldentistdentistrydiagnosisdiseasefocusedguidehistoryhospitalsmanagementmedicineoralpatientsprimaryprivaterequireresearchspecialtystudysurgeryteeththerapiststreatmentwork
rliest evidence dating to tens of thousands of years go, and rich evidence from 7000 BC on. Dentistry is thought to have been the first specialization in medicine which has gone on to develop its own accredited degree with its own specializations. Dentistry is often also understood to subsume the now largely defunct medical specialty of stomatology (the study of the mouth and its disorders and diseases) for which reason the two terms are used interchangeably in certain regions. However, some specialties such as oral and maxillofacial surgery (facial reconstruction/OMFS) may require both medical and dental degrees to accomplish. Dental treatments are carried out by a dental team, which often consists of a dentist and dental auxiliaries (such as dental assistants, dental hygienists, dental technicians, and dental therapists). Most dentists either work in private practices (primary care), dental hospitals, or (secondary care) institutions (prisons, armed forces bases, etc.). The modern movement of evidence-based dentistry calls for the use of high-quality scientific research and evidence to guide decision-making such as in manual tooth conservation, use of fluoride water treatment and fluoride toothpaste, dealing with oral diseases such as tooth decay and periodontitis, as well as systematic diseases such as osteoporosis, diabetes, celiac disease, cancer, autoimmune diseases, and HIV/AIDS which could also affect the oral cavity.
IV/AIDS which could also affect the oral cavity. Other practices relevant to evidence-based dentistry include radiology of the mouth to inspect teeth deformity or oral malaises, haematology (study of blood) to avoid bleeding complications during dental surgery, cardiology (due to various severe complications arising from dental surgery with patients with heart disease), etc. Etymology The term dentistry comes from dentist, which comes from French dentiste, which comes from the French and Latin words for tooth.
tal medicine and oral medicine, is the branch of medicine focused on the teeth, gums, and mouth. It consists of the study, diagnosis, prevention, management, and treatment of diseases, disorders, and conditions of the mouth, most commonly focused on dentition (the development and arrangement of teeth) as well as the oral mucosa. Dentistry may also encompass other aspects of the craniofacial complex including the temporomandibular joint. The practitioner is called a dentist. The history of dentistry is older than the written history of humanity and civilization, with the earliest evidence dating to tens of thousands of years go, and rich evidence from 7000 BC on. Dentistry is thought to have been the first specialization in medicine which has gone on to develop its own accredited degree with its own specializations. Dentistry is often also understood to subsume the now largely defunct medical specialty of stomatology (the study of the mouth and its disorders and diseases) for which reason the two terms are used interchangeably in certain regions. However, some specialties such as oral and maxillofacial surgery (facial reconstruction/OMFS) may require both medical and dental degrees to accomplish. Dental treatments are carried out by a dental team, which often consists of a dentist and dental auxiliaries (such as dental assistants, dental hygienists, dental technicians, and dental therapists). Most dentists either work in private practices (primary care), dental hospitals, or (secondary care) institutions (prisons, armed forces bases, etc.). The modern movement of evidence-based dentistry calls for the use of high-quality scientific research and evidence to guide decision-making such as in manual tooth conservation, use of fluoride water treatment and fluoride toothpaste, dealing with oral diseases such as tooth decay and periodontitis, as well as systematic diseases such as osteoporosis, diabetes, celiac disease, cancer, autoimmune diseases, and HIV/AIDS which could also affect the oral cavity.
Primary care
EXACT TITLE 1.000
QID OVERLAP: Q3259956 in dental (tier:branch) and healthcare (tier:evergreen). | SHARED TOKENS (16): "additional", "clinical", "family", "general", "healthcare", "medicine", "patient", "patients", "physical", "point", "primary", "professional", "professionals", "provider", "require", "system". | EXACT TITLE in healthcare: "Primary care".
additionalclinicalfamilygeneralhealthcaremedicinepatientpatientsphysicalpointprimaryprofessionalprofessionalsproviderrequiresystem
-day healthcare given by a health care provider. Typically, this provider acts as the first contact and principal point of continuing care for patients within a healthcare system, and coordinates any additional care the patient may require. Patients commonly receive primary care from professionals such as a primary care physician (general practitioner or family physician), a physician assistant, a physical therapist, or a nurse practitioner. In some localities, such a professional may be a registered nurse, a pharmacist, a clinical officer (as in parts of Africa), or an Ayurvedic or other traditional medicine professional (as in parts of Asia).
an (general practitioner or family physician), a physician assistant, a physical therapist, or a nurse practitioner. In some localities, such a professional may be a registered nurse, a pharmacist, a clinical officer (as in parts of Africa), or an Ayurvedic or other traditional medicine professional (as in parts of Asia).
In the United Kingdom, patients can access primary care services through their local general practice, community pharmacy, optometrist, dental surgery and community hearing care providers. Services are generally provided free-at-the-point-contact through the National Health Service. In the UK, unlike many other countries, patients do not normally have direct access to hospital consultants and the GP controls access to secondary care. This practice is referred to as "gatekeeping"; the future of this role has been questioned by researchers who conclude "Gatekeeping policies should be revisited to accommodate the government's aim to modernise the NHS in terms of giving patients more choice and facilitate more collaborative work between GPs and specialists. At the same time, any relaxation of gatekeeping should be carefully evaluated to ensure the clinical and non-clinical benefits outweigh the costs". United States As of 2012, there were about six primary care professional societies in the United States, including American College of Physicians, American Academy of Family Physicians, the Society of General Internal Medicine, the American Academy of Pediatrics, the American Osteopathic Association, and the American Geriatrics Society. A 2009 report by the New England Healthcare Institute determined that increased demand for primary care by older, sicker patients and decreased supply of primary care practitioners has led to a crisis in primary care delivery. The research identified a set of innovations that could enhance the quality, efficiency, and effectiveness of primary care in the United States. On March 23, 2010, President Obama signed the Patient Protection and Affordable Care Act (ACA) into law. The law is estimated to have expanded health insurance coverage by 20 million people by early 2016 and is expected to expand health care to 34 million people by 2021. The success of the expansion of health insurance under the ACA in large measure depends on the availability of primary care physicians. The ACA has drastically exacerbated the projected deficit of primary care physicians needed to ensure care for insured Americans. According to the Association of American Medical Colleges (AAMC), without the ACA, the United States would have been short roughly 64,000 physicians by 2020; with the implementation of the ACA, it will be 91,000 physicians short. According to the AAMC's November 2009 physician work force report, nationally, the rate of physicians providing primary care is 79.4 physicians per 100,000 residents. Primary healthcare results in better health outcomes, reduced health disparities, and lower spending, including on avoidable emergency department visits and hospital care. That said, primary care physicians are an important component in ensuring that the healthcare system as a whole is sustainable. However, despite their importance to the healthcare system, the primary care position has suffered in terms of its prestige in part due to the differences in salary compared to doctors that decide to specialize. A 2010 national study of physician wages conducted by the UC Davis Health System found that specialists are paid as much as 52 percent more than primary care physicians, even though primary care physicians see far more patients. In 2005, primary care physicians earned $60.48 per hour; specialists, on average earned $88.34. A follow-up study conducted by the UC Davis Health System found that earnings throughout the careers of primary care physicians averaged as much as $2.8 million less than the earnings of their specialist colleagues. This discrepancy in pay has potentially made primary care a less attractive choice for medical school graduates. In 2015, almost 19,000 doctors graduated from American medical schools, and only 7 percent of graduates chose a career in primary care. The average age of a primary care physician in the United States is 47 years old, and one-quarter of all primary care physicians are nearing retirement.
Telehealth
Q46994 EXACT TITLE 1.000
QID OVERLAP: Q46994 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (34): "access", "clinical", "clinicians", "conditions", "data", "digital", "education", "funding", "healthcare", "home", "information", "integration", "management", "medicine", "mobility", "monitoring", "patient", "patients", "physical", "practice".... | EXACT TITLE in dental: "Telehealth". | EXACT TITLE in healthcare: "Telehealth".
accessclinicalcliniciansconditionsdatadigitaleducationfundinghealthcarehomeinformationintegrationmanagementmedicinemobilitymonitoringpatientpatientsphysicalpracticepractitionersprofessionalproviderpublicrecordsruralstaffsupportsurgerysystem+4
t an intervening health care provider." When rural settings, lack of transport, a lack of mobility, conditions due to outbreaks, epidemics or pandemics, decreased funding, or a lack of staff restrict access to care, telemedicine may bridge the gap and can even improve retention in treatment as well as provide distance-learning; meetings, supervision, and presentations between practitioners; online information and health data management and healthcare system integration.
gration. EHealth encompasses a wide range of applications, including but not limited to the following: Two clinicians discussing a case via video conference; Robotic surgery performed through remote access; Physical therapy conducted using digital monitoring instruments, live feed, and application combinations; Diagnostic tests transferred between facilities for interpretation by a higher specialist; Home monitoring through continuous transmission of patient health data; Online consultations between patients and practitioners; Video remote interpretation services for clinical visits.
Telehealth versus telemedicine Telehealth is sometimes discussed interchangeably with telemedicine, the latter being more common than the former. Telehealth has been described as a disruptive innovation in healthcare because it enables medical services to be delivered remotely using communication technologies. The Health Resources and Services Administration distinguishes telehealth from telemedicine in its scope, defining telemedicine only as describing remote clinical services, such as diagnosis and monitoring, while telehealth includes preventative, promotive, and curative care delivery. This includes the above-mentioned non-clinical applications, like administration and provider education. The United States Department of Health and Human Services states that the term telehealth includes "non-clinical services, such as provider training, administrative meetings, and continuing medical education", and that the term telemedicine means "remote clinical services". The World Health Organization uses telemedicine to describe all aspects of health care including preventive care. The American Telemedicine Association uses the terms telemedicine and telehealth interchangeably, although it acknowledges that telehealth is sometimes used more broadly for remote health not involving active clinical treatments. eHealth is another related term, used particularly in the U.K. and Europe, as an umbrella term that includes telehealth, electronic medical records, and other components of health information technology. Methods and modalities Telehealth requires good Internet access by participants, usually in the form of a strong, reliable broadband connection, and broadband mobile communication technology of at least the fourth generation (4G) or long-term evolution (LTE) standard to overcome issues with video stability and bandwidth restrictions. As broadband infrastructure has improved, telehealth usage has become more widely feasible. Healthcare providers often begin telehealth with a needs assessment which assesses hardships that can be improved by telehealth such as travel time, costs or time off work. Collaborators such as technology companies can ease the transition. Delivery can come within four distinct domains: live video (synchronous), store-and-forward (asynchronous), remote patient monitoring, and mobile health. Audio-based telemedicine, primarily through telephone consultations, has been studied as a tool for managing chronic conditions.
F
Q5440668 EXACT TITLE 1.000
QID OVERLAP: Q5440668 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (40): "access", "act", "agencies", "barriers", "board", "center", "centers", "clinic", "clinical", "clinics", "communities", "community", "comprehensive", "consumer", "coverage", "defined", "defining", "federally", "grants", "insurance".... | EXACT TITLE in dental: "Federally Qualified Health Center". | EXACT TITLE in healthcare: "Federally Qualified Health Center".
accessactagenciesbarriersboardcentercentersclinicclinicalclinicscommunitiescommunitycomprehensiveconsumercoveragedefineddefiningfederallygrantsinsurancelocalmedicaidmembersnetoperatedorganizationpatientspractitionersprimarypublic+10
ers serve patients regardless of immigration status, insurance coverage, or ability to pay. FQHCs are a key component of the nation's primary care safety net and aim to reduce barriers to health care access for low/moderate-income and minority populations. The majority of FQHCs are local health centers operated by non-profits, but public agencies, such as municipal governments, also operate clinics, accounting for 7% of all FQHCS. Consumer governance is a defining feature of FQHCs, mandating that at least 51% of governing board members must be patients of the center. Defined by Medicare and Medicaid statutes, FQHCs include organizations i) receiving grants under Section 330 of the Public Health Service Act (PHSA), ii) clinics meeting certification requirements (known as FQHC "Look-Alikes"), and iii) outpatient facilities operated by tribal or urban Indian organizations.
vices mandated under Section 330 of the PHSA. History Federally Qualified Health Centers (FQHCs) were established in 1965 as part of President Lyndon Johnson's War on Poverty to improve health care access in low-income and medically underserved areas. During the 1980s, local health centers faced challenges in securing reimbursements from Medicare and Medicaid due to restrictive state payment rates and eligibility criteria, limiting their financial resources. A major turning point came at the end of the decade with the creation of the Federally Qualified Health Center designation, under the Omnibus Budget Reconciliation Act. Introduced for Medicaid in 1989 and Medicare in 1990, this designation allowed HRSA-funded health centers to receive cost-based reimbursement rates. Covered services included those provided by physicians, physician assistants, nurse practitioners, certified nurse midwives, clinical psychologists, and clinical social workers. The FQHC designation also introduced "Health Center Program look-alikes," which meet all HRSA funding requirements under Section 330 of the Public Health Service Act but do not receive direct HRSA funding. These look-alikes are eligible for FQHC reimbursement rates and other benefits available to HRSA-funded centers. FQHCs demonstrated notable success in delivering high-quality, cost-effective health care to vulnerable populations despite the challenges involved. In recognition of this, Congress permanently authorized the program. The Affordable Care Act (ACA) significantly expanded FQHCs by allocating $11 billion through the Community Health Center Fund between 2011 and 2015, supporting the establishment and expansion of delivery sites. By 2014, the number of FQHCs grew by 82.7% to 6,376, with most new sites in urban areas. A 2019 study shows that new markets were less likely to serve rural or high-poverty populations compared to earlier ones. FQHCs have evolved into comprehensive medical homes offering person-centered care and addressing disparities among low/moderate-income and minority populations. Federal initiatives, including the Health Center Growth Initiative in 2002, the $11 billion Community Health Center Fund under the 2010 Affordable Care Act, the 2009 American Recovery and Reinvestment Act, and subsequent investments, have further increased the number of FQHC sites to over 8,000, serving approximately 1 in 13 Americans. In June 2011, the Department of Health and Human Services announced the Federally Qualified Health Center Advanced Primary Care Practice (FQHC APCP) demonstration project. This demonstration project is conducted under the authority of Section 1115A of the Social Security Act, which was added by section 3021 of the ACA and establishes the Center for Medicare and Medicaid Innovation (Innovation Center). The CMS and Innovation Center in partnership with HRSA would operate the demonstration.
Overview FQHCs adhere to an "open door" policy, offering care regardless of patients' financial ability to pay, and predominantly serve low-income and uninsured individuals and Medicaid beneficiaries. As defined under Medicare and Medicaid statutes, FQHCs include organizations receiving grants under Section 330 of the Public Health Service Act (PHSA), FQHC Look-Alikes (certified clinics meeting Section 330 requirements but without HRSA funding), and outpatient facilities operated by tribal or urban Indian organizations. These centers provide a range of services, including those offered by physicians, physician assistants, nurse practitioners, nurse midwives, clinical psychologists, social workers, and other health professionals. They also deliver diabetes self-management training, medical nutrition therapy, and preventive primary health services mandated by Section 330. FQHCs serve as essential health care providers, offering medical, dental and behavioral health care to individuals irrespective of their insurance status or income. They also address non-financial barriers to health care through enabling services, such as housing support, transportation, and nutritional assistance. FQHCs must comply with standards set by the HRSA, including governance, quality reporting, and operational criteria, and ensure accessibility through a sliding fee scale based on patients' income. Federal regulations partially determine FQHC locations, requiring them to be situated in medically underserved areas (MUAs) or regions with medically underserved populations (MUPs). According to the HRSA, MUAs are characterized by a shortage of primary care providers, elevated infant mortality rates, high poverty levels, or a significant elderly population.
Emergency medical services
Q860447 EXACT TITLE 1.000
QID OVERLAP: Q860447 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (23): "additional", "agencies", "department", "emergency", "employees", "hospital", "members", "model", "patient", "patients", "point", "primary", "providing", "public", "qualified", "resources", "search", "support", "systems", "throughout".... | EXACT TITLE in dental: "Emergency medical services".
additionalagenciesdepartmentemergencyemployeeshospitalmembersmodelpatientpatientspointprimaryprovidingpublicqualifiedresourcessearchsupportsystemsthroughouttreatmentuniturgent
at least basic first aid certifications, such as basic life support (BLS). In English-speaking countries, they are known as emergency medical technicians (EMTs) and paramedics, with the latter having additional training such as advanced life support (ALS) skills. Physicians and nurses may also provide pre-hospital care to varying degrees in certain countries, a model which is popular in Europe. History Precursors Emergency care in the field has been rendered in different forms since the beginning of recorded history. The New Testament contains the parable of the Good Samaritan, in which a man who has been beaten is cared for by a passing Samaritan. Luke 10:34 (NIV) – "He went to him and bandaged his wounds, pouring on oil and wine.
First aid consists of basic skills that are commonly taught to members of the public, such as cardiopulmonary resuscitation, bandaging wounds and saving someone from choking. Basic Life Support (BLS) is often the lowest level of training that can be held by those who treat patients on an ambulance. Commonly, it includes administering oxygen therapy, some drugs and a few invasive treatments. BLS personnel may either operate a BLS ambulance on their own, or assist a higher qualified crewmate on an ALS ambulance. In English-speaking countries, BLS ambulance crew members are known as emergency medical technicians, emergency care assistants or Primary care paramedics in Canada. Intermediate Life Support (ILS), also known as Limited Advanced Life Support (LALS), is positioned between BLS and ALS but is less common than both. It is commonly a BLS provider with a moderately expanded skill set (such as an AEMT, but where it is present it usually replaces BLS. Advanced Life Support (ALS) has a considerably expanded range of skills such as intravenous therapy, endotracheal intubation, cricothyrotomy and interpretation of electrocardiograms. The scope of this higher tier response varies considerably by country. Paramedics commonly provide ALS, but some countries require it to be a higher level of care and instead employ physicians in this role. Additionally Advanced Life Support includes administering therapeutic doses of electrical shock to those who are in cardiac arrest or using drugs to stimulate the heart, Airway therapy, and so on and so forth. Most ambulances are equipped with advanced Life Support equipment and have paramedics on board. While some fire departments have ambulances, first aid and squads utilize ambulances for emergency medical services. Critical Care Transport (CCT or CCP), also known as medical retrieval or rendez vous MICU protocol in some countries (Australia, NZ, Great Britain, and Francophone Canada) refers to the critical care transport of patients between hospitals (as opposed to pre-hospital). Such services are a key element in regionalized systems of hospital care where intensive care services are centralized to a few specialist hospitals. An example of this is the Emergency Medical Retrieval Service in Scotland.
Emergency medical technicians are usually able to perform a wide range of emergency care skills, such as automated defibrillation, care of spinal injuries and oxygen therapy. In few jurisdictions, some EMTs are able to perform duties as IV and IO cannulation, administration of a limited number of drugs (including but not limited to Epinephrine, Narcan, Oxygen, Aspirin, Nitroglycerin – dependent on country, state, and medical direction), more advanced airway procedures, CPAP, and limited cardiac monitoring. Most advanced procedures and skills are not within the national scope of practice for an EMT. As such most states require additional training and certifications to perform above the national curriculum standards. In the United States, an EMT certification requires intense courses and training in field skills. Certifications are state-specific and last varying durations, though National Registry certification simplifies the reciprocity process in many states.
Public health
Q189603 EXACT TITLE 1.000
QID OVERLAP: Q189603 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (34): "access", "behavioral", "communities", "community", "comprehensive", "delivery", "disease", "distribution", "education", "entire", "focused", "healthcare", "level", "major", "management", "occupational", "oral", "organized", "physical", "policy".... | EXACT TITLE in dental: "Public health".
accessbehavioralcommunitiescommunitycomprehensivedeliverydiseasedistributioneducationentirefocusedhealthcarelevelmajormanagementoccupationaloralorganizedphysicalpolicypopulationprimaryprivatepublicresourcesrisksafetysignificantsmallsocial+4
and breastfeeding, delivery of vaccinations, promoting ventilation and improved air quality both indoors and outdoors, suicide prevention, smoking cessation, obesity education, increasing healthcare accessibility and distribution of condoms to control the spread of sexually transmitted diseases. There is a significant disparity in access to health care and public health initiatives between developed countries and developing countries, as well as within developing countries. In developing countries, public health infrastructures are still forming. There may not be enough trained healthcare workers, monetary resources, or, in some cases, sufficient knowledge to provide even a basic level of medical care and disease prevention. A major public health concern in developing countries is poor maternal and child health, exacerbated by malnutrition and poverty and limited implementation of comprehensive public health policies. Developed nations are at greater risk of certain public health crises, including childhood obesity, although overweight populations in low- and middle-income countries are catching up. From the beginnings of human civilization, communities promoted health and fought disease at the population level. In complex, pre-industrialized societies, interventions designed to reduce health risks could be the initiative of different stakeholders, such as army generals, the clergy or rulers. Great Britain became a leader in the development of public health initiatives, beginning in the 19th century, due to the fact that it was the first modern urban nation worldwide. The public health initiatives that began to emerge initially focused on sanitation (for example, the Liverpool and London sewerage systems), control of infectious diseases (including vaccination and quarantine) and an evolving infrastructure of various sciences, e.g.
tion, smoking cessation, obesity education, increasing healthcare accessibility and distribution of condoms to control the spread of sexually transmitted diseases. There is a significant disparity in access to health care and public health initiatives between developed countries and developing countries, as well as within developing countries. In developing countries, public health infrastructures are still forming. There may not be enough trained healthcare workers, monetary resources, or, in some cases, sufficient knowledge to provide even a basic level of medical care and disease prevention. A major public health concern in developing countries is poor maternal and child health, exacerbated by malnutrition and poverty and limited implementation of comprehensive public health policies. Developed nations are at greater risk of certain public health crises, including childhood obesity, although overweight populations in low- and middle-income countries are catching up. From the beginnings of human civilization, communities promoted health and fought disease at the population level. In complex, pre-industrialized societies, interventions designed to reduce health risks could be the initiative of different stakeholders, such as army generals, the clergy or rulers. Great Britain became a leader in the development of public health initiatives, beginning in the 19th century, due to the fact that it was the first modern urban nation worldwide. The public health initiatives that began to emerge initially focused on sanitation (for example, the Liverpool and London sewerage systems), control of infectious diseases (including vaccination and quarantine) and an evolving infrastructure of various sciences, e.g.
Components Public health is a complex term, composed of many elements and different practices. It is a multi-faceted, interdisciplinary field. For example, epidemiology, biostatistics, social sciences and management of health services are all relevant. Other important sub-fields include environmental health, community health, behavioral health, health economics, public policy, mental health, health education, health politics, occupational safety, disability, gender issues in health, and sexual and reproductive health. Modern public health practice requires multidisciplinary teams of public health workers and professionals. Teams might include epidemiologists, biostatisticians, physician assistants, public health nurses, midwives, medical microbiologists, pharmacists, economists, sociologists, geneticists, data managers, environmental health officers (public health inspectors), bioethicists, gender experts, sexual and reproductive health specialists, physicians, and veterinarians. The elements and priorities of public health have evolved over time, and are continuing to evolve. Common public health initiatives include promotion of hand-washing and breastfeeding, delivery of vaccinations, suicide prevention, smoking cessation, obesity education, increasing healthcare accessibility and distribution of condoms to control the spread of sexually transmitted diseases. Methods Public health aims are achieved through surveillance of cases and the promotion of healthy behaviors, communities and environments. Analyzing the determinants of health of a population and the threats it faces is the basis for public health. Many diseases are preventable through simple, nonmedical methods. For example, research has shown that the simple act of handwashing with soap can prevent the spread of many contagious diseases. In other cases, treating a disease or controlling a pathogen can be vital to preventing its spread to others, either during an outbreak of infectious disease or through contamination of food or water supplies. Public health, together with primary care, secondary care, and tertiary care, is part of a country's overall health care system.
Medicaid
Q1141363 EXACT TITLE 1.000
QID OVERLAP: Q1141363 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (45): "access", "act", "adult", "adults", "annual", "average", "children", "coverage", "eligibility", "established", "expanded", "families", "federal", "financial", "funding", "general", "government", "healthcare", "high", "home".... | EXACT TITLE in dental: "Medicaid". | EXACT TITLE in healthcare: "Medicaid".
accessactadultadultsannualaveragechildrencoverageeligibilityestablishedexpandedfamiliesfederalfinancialfundinggeneralgovernmenthealthcarehighhomeincomeinsurancelong-termlow-incomemaintainmedicaidmembermillionplanspolicy+15
Medicaid is the largest source of funding for medical and health-related services for people with low income in the United States, providing taxpayer-funded health insurance to 85 million low-income and disabled people as of 2022; in 2019, the program paid for half of all U.S. births. In 2023, the total (federal and state) annual cost of Medicaid was $870 billion, with an average cost per enrollee of $7,600 for 2021. 37% of enrollees were children, but they only accounted for 15% of the spending, ($3,000 per person) while seniors and disabled persons accounted for 21% of enrollees and 52% of spending (more than $18,000 per person). In general, Medicaid recipients must be U.S. citizens or qualified non-citizens, and may include low-income adults, their children, and people with certain disabilities. Medicaid also covers long-term services and supports, including both nursing home care and home- and community-based services, for those with low incomes and minimal assets. Of the 7.7 million Americans who used long-term services and supports in 2020, about 5.6 million were covered by Medicaid. Along with Medicare, Tricare, ChampVA, and CHIP, Medicaid is one of the several Federal Government-sponsored medical insurance programs in the United States. Medicaid covers healthcare costs for people with low incomes; Medicare is a universal program providing health coverage for the elderly; and the CHIP program covers uninsured children in families with incomes that are too high to be covered by Medicaid. Medicaid offers elder care benefits not normally covered by Medicare, including nursing home care and personal care services. There are also dual health plans for people who have both Medicaid and Medicare. Research shows that existence of the Medicaid program improves health outcomes, health insurance coverage, access to health care, and recipients' financial security and provides economic benefits to states and health providers.
2025 Medicaid cuts in the second Trump administration In 2025, Republican Congressional leaders John Thune and Mike Johnson announced goals of cutting 1.5 to 2 trillion dollars of the US federal budget, with President Donald Trump stating that cuts to Medicaid would only include "abuse or waste". The 2025 budget resolution, which was passed by the House of Representatives with only Republicans votes, proposed cutting $880 billion from the Standing Committee for Energy and Commerce, which includes many areas, such as Medicaid and Medicare. On July 4, 2025, President Donald Trump signed the One Big Beautiful Bill Act, intended in part to implement this resolution. The act cut Medicaid in a number of ways: while it did not repeal the ACA's Medicaid expansion, it mandated work requirements for able-bodied Medicaid recipients. It also requires Medicaid recipients above the federal poverty line to pay more fees for coverage; adds new verification requirements; increases the number of times states need to check the eligibility of their Medicaid expansion recipients; prohibits Medicaid from funding nonprofits that provide abortion care; makes it harder for illegal immigrants to use Medicaid; bans pharmacy benefit managers from using spread pricing; and puts limits on so-called "provider taxes" that states impose on healthcare providers to fund their portion of Medicaid spending. The non-partisan Congressional Budget Office (CBO) estimated that it will reduce the number of people on Medicaid by several million.; the CBO estimates that the work requirements in particular will lead 11 million to lose their Medicaid coverage, many of whom already work or qualify for exemptions but will not be able to get through the red tape. The bill prompted claims that undocumented immigrants are on Medicaid. Undocumented immigrants are already ineligible for full Medicaid benefits, and many undocumented immigrants access state-funded health programs rather than federal Medicaid. According to a CBO analysis, the bill's provisions could lead some states to cut back those state-funded health programs, potentially causing an estimated 1.4 million people to lose state-level health coverage, including undocumented immigrants. When commenting on the Trump administration's One Big Beautiful Bill Act and the impact of the Medicaid provisions on the economy, USDA Secretary Brooke Rollins stated that 34 million able-bodied adults on Medicaid should be working.
Arizona: AHCCCS California: Medi-Cal Connecticut: HUSKY D Illinois: HealthChoice Illinois Iowa: Hawk-i Healthy and Well-Kids in Iowa Maine: MaineCare Massachusetts: MassHealth New Jersey: NJ FamilyCare Oregon: Oregon Health Plan Oklahoma: Soonercare Tennessee: TennCare Washington: Washington Apple Health Wisconsin: BadgerCare As of January 2012, Medicaid and/or CHIP funds could be obtained to help pay employer health care premiums in Alabama, Alaska, Arizona, Colorado, Florida, and Georgia. Differences by state While states have significant autonomy in implementing the Medicaid program, their flexibility is bounded by federal requirements designed to ensure a baseline of coverage and access. For example, federal law mandates that certain services, such as inpatient and outpatient hospital services, laboratory and X-ray services, and physician services, must be covered by all state Medicaid programs. Additionally, states must adhere to federal guidelines regarding beneficiary protections and quality standards.
Dental implant
Q143680 EXACT TITLE 1.000
QID OVERLAP: Q143680 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (29): "act", "additional", "association", "dental", "dentist", "dentistry", "denture", "established", "federal", "full", "function", "implants", "injury", "law", "long-term", "oral", "practice", "primary", "procedures", "public".... | EXACT TITLE in dental: "Dental implant". | EXACT TITLE in healthcare: "Dental implant".
actadditionalassociationdentaldentistdentistrydentureestablishedfederalfullfunctionimplantsinjurylawlong-termoralpracticeprimaryprocedurespublicrelatedsignificantstudysupportsurgeonssurgeryteeththerapytreatment
from the Greek λόγος lógos 'word,' 'study,') is the term for the placement of dental implants by a dentist, specialist dentist in oral surgery, or oral and maxillofacial surgeons. With a license to practice, every dentist obtains permission to practice the full range of dentistry and thus also to place dental implants. The 'focus area in implantology' established in 2001 by the European Association of Dental Implantologists (BDIZ EDI) before the Federal Constitutional Court is not an additional designation according to the training regulations and is not granted under public law. A dental implant (also known as an endosseous implant or fixture) is a prosthesis that interfaces with the bone of the jaw or skull to support a dental prosthesis such as a crown, bridge, denture, or facial prosthesis or to act as an orthodontic anchor. The basis for modern dental implants is a biological process called osseointegration, in which materials such as titanium or zirconia form an intimate bond to the bone. The implant fixture is first placed so that it is likely to osseointegrate, then a dental prosthetic is added. A variable amount of healing time is required for osseointegration before either the dental prosthetic (a tooth, bridge, or denture) is attached to the implant or an abutment is placed which will hold a dental prosthetic or crown. Success or failure of implants depends primarily on the thickness and health of the bone and gingival tissues that surround the implant, but also on the health of the person receiving the treatment and drugs which affect the chances of osseointegration. The amount of stress that will be put on the implant and fixture during normal function is also evaluated. Planning the position and number of implants is key to the long-term health of the prosthetic since biomechanical forces created during chewing can be significant. The position of implants is determined by the position and angle of adjacent teeth, by lab simulations or by using computed tomography with CAD/CAM simulations and surgical guides called stents. The prerequisites for long-term success of osseointegrated dental implants are healthy bone and gingiva. Since both can atrophy after tooth extraction, pre-prosthetic procedures such as sinus lifts or gingival grafts are sometimes required to recreate ideal bone and gingiva. The final prosthetic can be either fixed, where a person cannot remove the denture or teeth from their mouth, or removable, where they can remove the prosthetic. In each case an abutment is attached to the implant fixture. Where the prosthetic is fixed, the crown, bridge or denture is fixed to the abutment either with lag screws or with dental cement. Where the prosthetic is removable, a corresponding adapter is placed in the prosthetic so that the two pieces can be secured together. The risks and complications related to implant therapy divide into those that occur during surgery (such as excessive bleeding or nerve injury, inadequate primary stability), those that occur in the first six months (such as infection and failure to osseointegrate) and those that occur long-term (such as peri-implantitis and mechanical failures). In the presence of healthy tissues, a well-integrated implant with appropriate biomechanical loads can have 5-year plus survival rates from 93 to 98 percent and 10-to-15-year lifespans for the prosthetic teeth.
nown as an endosseous implant or fixture) is a prosthesis that interfaces with the bone of the jaw or skull to support a dental prosthesis such as a crown, bridge, denture, or facial prosthesis or to act as an orthodontic anchor. The basis for modern dental implants is a biological process called osseointegration, in which materials such as titanium or zirconia form an intimate bond to the bone. The implant fixture is first placed so that it is likely to osseointegrate, then a dental prosthetic is added. A variable amount of healing time is required for osseointegration before either the dental prosthetic (a tooth, bridge, or denture) is attached to the implant or an abutment is placed which will hold a dental prosthetic or crown. Success or failure of implants depends primarily on the thickness and health of the bone and gingival tissues that surround the implant, but also on the health of the person receiving the treatment and drugs which affect the chances of osseointegration. The amount of stress that will be put on the implant and fixture during normal function is also evaluated. Planning the position and number of implants is key to the long-term health of the prosthetic since biomechanical forces created during chewing can be significant. The position of implants is determined by the position and angle of adjacent teeth, by lab simulations or by using computed tomography with CAD/CAM simulations and surgical guides called stents. The prerequisites for long-term success of osseointegrated dental implants are healthy bone and gingiva. Since both can atrophy after tooth extraction, pre-prosthetic procedures such as sinus lifts or gingival grafts are sometimes required to recreate ideal bone and gingiva. The final prosthetic can be either fixed, where a person cannot remove the denture or teeth from their mouth, or removable, where they can remove the prosthetic. In each case an abutment is attached to the implant fixture. Where the prosthetic is fixed, the crown, bridge or denture is fixed to the abutment either with lag screws or with dental cement. Where the prosthetic is removable, a corresponding adapter is placed in the prosthetic so that the two pieces can be secured together. The risks and complications related to implant therapy divide into those that occur during surgery (such as excessive bleeding or nerve injury, inadequate primary stability), those that occur in the first six months (such as infection and failure to osseointegrate) and those that occur long-term (such as peri-implantitis and mechanical failures). In the presence of healthy tissues, a well-integrated implant with appropriate biomechanical loads can have 5-year plus survival rates from 93 to 98 percent and 10-to-15-year lifespans for the prosthetic teeth.
CAD/CAM simulations and surgical guides called stents. The prerequisites for long-term success of osseointegrated dental implants are healthy bone and gingiva. Since both can atrophy after tooth extraction, pre-prosthetic procedures such as sinus lifts or gingival grafts are sometimes required to recreate ideal bone and gingiva. The final prosthetic can be either fixed, where a person cannot remove the denture or teeth from their mouth, or removable, where they can remove the prosthetic. In each case an abutment is attached to the implant fixture. Where the prosthetic is fixed, the crown, bridge or denture is fixed to the abutment either with lag screws or with dental cement. Where the prosthetic is removable, a corresponding adapter is placed in the prosthetic so that the two pieces can be secured together. The risks and complications related to implant therapy divide into those that occur during surgery (such as excessive bleeding or nerve injury, inadequate primary stability), those that occur in the first six months (such as infection and failure to osseointegrate) and those that occur long-term (such as peri-implantitis and mechanical failures). In the presence of healthy tissues, a well-integrated implant with appropriate biomechanical loads can have 5-year plus survival rates from 93 to 98 percent and 10-to-15-year lifespans for the prosthetic teeth.
Rural health
Q3473027 EXACT TITLE 1.000
QID OVERLAP: Q3473027 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (25): "access", "barriers", "communities", "coverage", "delivery", "disease", "education", "experience", "foods", "funding", "healthcare", "housing", "identify", "insurance", "medicine", "needs", "policy", "population", "research", "risk".... | EXACT TITLE in dental: "Rural health". | EXACT TITLE in healthcare: "Rural health".
accessbarrierscommunitiescoveragedeliverydiseaseeducationexperiencefoodsfundinghealthcarehousingidentifyinsurancemedicineneedspolicypopulationresearchriskruralstudytelehealthurbanwork
elds, including wilderness medicine, geography, midwifery, nursing, sociology, economics, and telehealth or telemedicine. Rural populations often experience health disparities and greater barriers in access to healthcare compared to urban populations. Globally, rural populations face increased burdens of noncommunicable diseases such as cardiovascular disease, cancer, diabetes, and chronic obstructive pulmonary disorder, contributing to worse health outcomes and higher mortality rates. Factors contributing to these health disparities include remote geography, increased rates of health risk behaviors, lower population density, decreased health insurance coverage among the population, lack of health infrastructure, and work force demographics. People living in rural areas also tend to have less education, lower socioeconomic status, and higher rates of alcohol and smoking when compared to their urban counterparts. Additionally, the rate of poverty is higher in rural populations globally, contributing to health disparities due to an inability to access healthy foods, healthcare, and housing. Many countries have made it a priority to increase funding for research on rural health.
of alcohol and smoking when compared to their urban counterparts. Additionally, the rate of poverty is higher in rural populations globally, contributing to health disparities due to an inability to access healthy foods, healthcare, and housing. Many countries have made it a priority to increase funding for research on rural health.
Life expectancy and mortality Rural areas within the U.S. have been found to have a lower life expectancy than urban areas by approximately 2.4 years. Rural U.S. populations are at a greater risk of mortality due to non-communicable diseases such as heart disease, cancer, chronic lower respiratory disease, and stroke, as well as unintentional injuries such as automobile accidents and opioid overdoses compared to urban populations. In 1999, the age-adjusted death rate was 7% higher in rural areas compared to urban areas. However, by 2019 this difference had widened, with rural areas experiencing a 20% higher death rate compared to in urban areas. There is some evidence to suggest that the gap may be widening as more public health resources are directed away from rural areas towards densely populated urban areas. These trends are also observed on a global scale, as rural communities are more likely to have lower life expectancies than urban counterparts. Data collected from 174 countries found the maternal mortality rate to be 2.5 times higher in rural areas compared to urban areas. Additionally, the likelihood that a child born in a rural area will die before the age of 5 is 1.7 times higher than a child born in an urban area. Factors contributing to the increased risk of maternal and child mortality include healthcare worker shortages, as well as a lack of health facilities and resources in rural areas. Health determinants Access to healthcare People in rural areas generally have less access to healthcare than their urban counterparts. Fewer medical practitioners, mental health programs, and healthcare facilities in these areas often mean less preventative care and longer response times in emergencies. Geographic isolation also creates longer travel times to healthcare facilities, acting as a barrier to accessing care in rural communities. The lack of resources in rural areas have resulted in utilization of telehealth services to improve access to speciality care, as well as mobile preventative care and treatment programs. Teleheath services have the potential to greatly improve access to providers in remote areas, however, barriers such as lack of stable internet access create disparities to accessing this care. There have also been increased efforts to attract health professionals to isolated locations, such as increasing the number of medical students from rural areas and improving financial incentives for rural practices. Rural communities face healthcare worker shortages that are more than twice as high as urban communities. For example, Canadians living in rural areas have access to half as many physicians (1 per 1,000 residents) and have to travel five times the distance to access these services compared to urban counterparts. There is also a lack of specialist physicians, such as dermatologists or oncologists, in rural communities, resulting in a higher reliance on primary care physicians and emergency rooms for healthcare. Rural areas, especially in Africa, have greater difficulties in recruiting and retaining qualified and skilled professionals in the healthcare field. In recent years, over 30% physicians from sub-Saharan Africa have left low-income rural areas and moved to higher-income countries due to burnout. This creates further physician shortages and a higher risk of burnout on the physicians that remain in rural communities. In sub-Saharan African countries such as Zambia and Malawi, urban areas have disproportionately more of the countries' skilled physicians, nurses, and midwives despite a majority of the population living in rural areas. In South Africa alone, 43% of the population lives in rural areas, but only 12% of doctors actually practice there. This is similar to the realities in Ghana, which implemented the Community-based Health Planning and Services (CHPS) program, designed to promote community health through preventive and primary care, though the initiative has faced issues due to the uneven distribution of healthcare professionals across all communities. The gap in services is due, in part, to the focus of funding on higher-population areas. Only 20% of the Chinese government's public health spending went to the rural health system in the 1990s, which served 70% of the Chinese population. In the United States, between 1990 and 2000, 228 rural hospitals closed, leading to a reduction of 8,228 hospital beds. In order to improve health care availability in rural areas, it is important to understand the needs of each community. Each area has unique barriers to accessing care.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (18): "boise", "business", "college", "division", "education", "founded", "high", "idaho", "independent", "member", "million", "program", "programs", "public", "reported", "research", "school", "university". | EXACT TITLE in dental: "Boise State University".
boisebusinesscollegedivisioneducationfoundedhighidahoindependentmembermillionprogramprogramspublicreportedresearchschooluniversity
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
A program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
CAA Division I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
Pediatric dentistry
Q2086597 EXACT TITLE 1.000
QID OVERLAP: Q2086597 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (25): "accessible", "association", "children", "college", "comprehensive", "counseling", "dental", "dentist", "dentistry", "detection", "early", "home", "information", "maintain", "needed", "oral", "patient", "pediatric", "program", "recognized".... | EXACT TITLE in dental: "Pediatric dentistry".
accessibleassociationchildrencollegecomprehensivecounselingdentaldentistdentistrydetectionearlyhomeinformationmaintainneededoralpatientpediatricprogramrecognizedresourcesriskspecialtysurgeonsteeth
Pediatric (also paediatric or pædiatric) dentists promote the dental health of children as well as serve as educational resources for parents. It is recommended by the American Academy of Pediatric Dentistry (AAPD) and the American Academy of Pediatrics (AAP) that a dental visit occurs after the presence of the first tooth or by a child's first birthday. The AAPD has said that it is important to establish a comprehensive and accessible ongoing relationship between the dentist and patient – referring to this as the patient's "dental home". This is because early oral examination aids in the detection of the early stages of tooth decay. Early detection is essential to maintain oral health, modify aberrant habits, and treat as needed and as simply as possible.
ish or paedodontics in Commonwealth English) is the branch of dentistry dealing with children from birth through adolescence. The specialty of pediatric dentistry is recognized by the American Dental Association, Royal College of Dentists of Canada, and Royal Australasian College of Dental Surgeons. Pediatric (also paediatric or pædiatric) dentists promote the dental health of children as well as serve as educational resources for parents. It is recommended by the American Academy of Pediatric Dentistry (AAPD) and the American Academy of Pediatrics (AAP) that a dental visit occurs after the presence of the first tooth or by a child's first birthday. The AAPD has said that it is important to establish a comprehensive and accessible ongoing relationship between the dentist and patient – referring to this as the patient's "dental home". This is because early oral examination aids in the detection of the early stages of tooth decay. Early detection is essential to maintain oral health, modify aberrant habits, and treat as needed and as simply as possible.
History In 1909 Minnie Evangeline Jordon established the first dental practice in the United States devoted only to pediatric patients. In 1925 she published the first textbook on pediatric dentistry, titled Operative Dentistry for Children. The first dental care brought to public school was Alfred Fones in 1914, which was near 6 decades after the first woman, Lucy Hobbs Taylor, who received a DDS. Education Pediatric dentistry is one of the ten dental specialties recognized by American Dental Association. Other specialties include dental public health, endodontics, oral and maxillofacial pathology, oral and maxillofacial radiology, oral and maxillofacial surgery, orthodontics and dentofacial orthopedics, periodontics, and prosthodontics. The first step would be obtaining a college degree in biomedical science, health science, or social science as long as all biomedical course pre-requisites are met courses. While in college, one can explore the profession by shadowing in a pediatric dental office or children's hospital, or working on academic research that studies oral health of children. Second step would be attending a dental school that involves four years of education and training. One can graduate with Doctor of Dental Surgery (DDS) or Doctor of Dental Medicine (DMD). Both degrees are equivalent and people receive the same training as required by the CODA (Commission on Dental Accreditation). During the first two years of dental school, dental students will take didactic classes on biomedical sciences and hands on classes to learn technical procedures in a pre-clinical laboratory setting. Third and fourth years of dental school focus on clinical care under the supervision of attending faculty who are licensed dentists. Before graduating, all dental students must pass National Board Dental Examination part I and part II, as well as clinical skill exams (e.g., ADEX, WREB, etc) to become a licensed general dentist. In order to specialize in pediatric dentistry, one should receive additional in-depth training from an accredited postgraduate residency program. A pediatric dentistry residency program can be 24 months or more in length. At the end, resident dentists are awarded a certificate in pediatric dentistry with or without a master's degree depending on their program type. Specialized training covers all aspects of oral health care from infancy through adolescence, encompassing behavior management, preventive dentistry, restorative dentistry, sedation dentistry, oral trauma management, interceptive orthodontics, oral medicine and pathology. The majority of residency training is spent on treating pediatric patients in a dental clinic or hospital operating room where the patient is under general anesthesia. Following successful completion of post-graduate training, one becomes Board-eligible for the American Board of Pediatric Dentistry(ABPD) examination. The first part of the Board exam is a written exam. Once passing the written exam, one moves on to the second part, which is an oral examination testing on clinical knowledge.
Pediatrics
Q123028 EXACT TITLE 1.000
QID OVERLAP: Q123028 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (16): "adults", "age", "centers", "children", "clinics", "coverage", "general", "hospitals", "insurance", "medicine", "patients", "pediatric", "practice", "research", "resources", "work". | EXACT TITLE in dental: "Pediatrics".
adultsagecenterschildrenclinicscoveragegeneralhospitalsinsurancemedicinepatientspediatricpracticeresearchresourceswork
glish), also spelled paediatrics (British English) and also known as underage medicine, is the branch of medicine that involves the medical care of infants, toddlers, children, adolescents, and young adults. Within the Commonwealth, pediatrics covers patients until the age of 18, except in India where the pediatric age is 12. The American Academy of Pediatrics recommends people seek pediatric care through the age of 21, but some pediatric subspecialists continue to care for adults up to 26, depending on insurance coverage for young adults who reside with parents. Worldwide age limits of pediatrics have been trending upward year after year. A medical doctor who specializes in this area is known as a pediatrician, or paediatrician. The word pediatrics and its cognates mean "healer of children", derived from the two Greek words: παῖς (pais "child") and ἰατρός (iatros "doctor, healer"). Pediatricians work in clinics, research centers, universities, general hospitals and children's hospitals, including those who practice pediatric subspecialties (e.g.
, except in India where the pediatric age is 12. The American Academy of Pediatrics recommends people seek pediatric care through the age of 21, but some pediatric subspecialists continue to care for adults up to 26, depending on insurance coverage for young adults who reside with parents. Worldwide age limits of pediatrics have been trending upward year after year. A medical doctor who specializes in this area is known as a pediatrician, or paediatrician. The word pediatrics and its cognates mean "healer of children", derived from the two Greek words: παῖς (pais "child") and ἰατρός (iatros "doctor, healer"). Pediatricians work in clinics, research centers, universities, general hospitals and children's hospitals, including those who practice pediatric subspecialties (e.g.
The earliest mentions of child-specific medical problems appear in the Hippocratic Corpus, published in the fifth century B.C., and the famous Sacred Disease. These publications discussed topics such as childhood epilepsy and premature births. From the first to fourth centuries A.D., Greek philosophers and physicians Celsus, Soranus of Ephesus, Aretaeus, Galen, and Oribasius, also discussed specific illnesses affecting children in their works, such as rashes, epilepsy, and meningitis. Already Hippocrates, Aristotle, Celsus, Soranus, and Galen understood the differences in growing and maturing organisms that necessitated different treatment: Ex toto non sic pueri ut viri curari debent ("In general, boys should not be treated in the same way as men"). Some of the oldest traces of pediatrics can be discovered in Ancient India where children's doctors were called kumara bhrtya. Even though some pediatric works existed during this time, they were scarce and rarely published due to a lack of knowledge in pediatric medicine. Sushruta Samhita, an ayurvedic text composed during the sixth century BCE, contains information about pediatrics. Another ayurvedic text from this period is Kashyapa Samhita. A second century AD manuscript by the Greek physician and gynecologist Soranus of Ephesus dealt with neonatal pediatrics. Byzantine physicians Oribasius, Aëtius of Amida, Alexander Trallianus, and Paulus Aegineta contributed to the field. The Byzantines also built brephotrophia (crêches). Islamic Golden Age writers served as a bridge for Greco-Roman and Byzantine medicine and added ideas of their own, especially Haly Abbas, Yahya Serapion, Abulcasis, Avicenna, and Averroes. The Persian philosopher and physician al-Razi (865–925), sometimes called the father of pediatrics, published a monograph on pediatrics titled Diseases in Children. Also among the first books about pediatrics was Libellus [Opusculum] de aegritudinibus et remediis infantium 1472 ("Little Book on Children's Diseases and Treatment"), by the Italian pediatrician Paolo Bagellardo. In sequence came Bartholomäus Metlinger's Ein Regiment der Jungerkinder 1473, Cornelius Roelans (1450–1525) no title Buchlein, or Latin compendium, 1483, and Heinrich von Louffenburg (1391–1460) Versehung des Leibs written in 1429 (published 1491), together forming the Pediatric Incunabula, four great medical treatises on children's physiology and pathology. While more information about childhood diseases became available, there was little evidence that children received the same kind of medical care that adults did. It was during the seventeenth and eighteenth centuries that medical experts started offering specialized care for children. The Swedish physician Nils Rosén von Rosenstein (1706–1773) is considered the founder of modern pediatrics as a medical specialty, while his work The diseases of children, and their remedies (1764) is considered "the first modern textbook on the subject". However, it was not until the nineteenth century that medical professionals acknowledged pediatrics as a separate field of medicine.
Orthodontics
Q118301 EXACT TITLE 0.980
QID OVERLAP: Q118301 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (14): "dental", "dentistry", "diagnosis", "foods", "high", "management", "patients", "plan", "reported", "require", "specialty", "surgery", "teeth", "treatment". | EXACT TITLE in dental: "Orthodontics".
dentaldentistrydiagnosisfoodshighmanagementpatientsplanreportedrequirespecialtysurgeryteethtreatment
ess fresh fruit and vegetables and overall softer foods in childhood, causing smaller jaws with less room for the teeth to erupt. Treatment may require several months to a few years and entails using dental braces and other appliances to gradually adjust tooth position and jaw alignment. In cases where the malocclusion is severe, jaw surgery may be incorporated into the treatment plan.
History Though it was rare until the Industrial Revolution, there is evidence of the issue of overcrowded, irregular, and protruding teeth afflicting individuals. Evidence from Greek and Etruscan materials suggests that attempts to treat this disorder date back to 1000 BC, showcasing primitive yet impressively well-crafted orthodontic appliances. In the 18th and 19th centuries, a range of devices for the "regulation" of teeth were described by various dentistry authors who occasionally put them into practice. As a modern science, orthodontics dates back to the mid-1800s. The field's influential contributors include Norman William Kingsley (1829–1913) and Edward Angle (1855–1930). Angle created the first basic system for classifying malocclusions, a system that remains in use today. Beginning in the mid-1800s, Norman Kingsley published Oral Deformities, which is now credited as one of the first works to begin systematically documenting orthodontics. Being a major presence in American dentistry during the latter half of the 19th century, not only was Kingsley one of the early users of extraoral force to correct protruding teeth, but he was also one of the pioneers for treating cleft palates and associated issues. During the era of orthodontics under Kingsley and his colleagues, the treatment was focused on straightening teeth and creating facial harmony. Ignoring occlusal relationships, it was typical to remove teeth for a variety of dental issues, such as malalignment or overcrowding. The concept of an intact dentition was not widely appreciated in those days, making bite correlations seem irrelevant. In the late 1800s, the concept of occlusion was essential for creating reliable prosthetic replacement teeth. This idea was further refined and ultimately applied in various ways when dealing with healthy dental structures as well. As these concepts of prosthetic occlusion progressed, it became an invaluable tool for dentistry. It was in 1890 that the work and impact of Dr. Edwards H. Angle began to be felt, with his contribution to modern orthodontics particularly noteworthy. Initially focused on prosthodontics, he taught in Pennsylvania and Minnesota before directing his attention towards dental occlusion and the treatments needed to maintain it as a normal condition, thus becoming known as the "father of modern orthodontics". By the beginning of the 20th century, orthodontics had become more than just the straightening of crooked teeth. The concept of ideal occlusion, as postulated by Angle and incorporated into a classification system, enabled a shift towards treating malocclusion, which is any deviation from normal occlusion. Having a full set of teeth on both arches was highly sought after in orthodontic treatment due to the need for exact relationships between them. Extraction as an orthodontic procedure was heavily opposed by Angle and those who followed him. As occlusion became the key priority, facial proportions and aesthetics were neglected. To achieve ideal occlusals without using external forces, Angle postulated that having perfect occlusion was the best way to gain optimum facial aesthetics. With the passing of time, it became quite evident that even an exceptional occlusion was not suitable when considered from an aesthetic point of view. Not only were there issues related to aesthetics, but it usually proved impossible to keep a precise occlusal relationship achieved by forcing teeth together over extended durations with the use of robust elastics, something Angle and his students had previously suggested. Charles Tweed in America and Raymond Begg in Australia (who both studied under Angle) re-introduced dentistry extraction into orthodontics during the 1940s and 1950s so they could improve facial esthetics while also ensuring better stability concerning occlusal relationships. In the postwar period, cephalometric radiography started to be used by orthodontists for measuring changes in tooth and jaw position caused by growth and treatment. The x-rays showed that many Class II and III malocclusions were due to improper jaw relations as opposed to misaligned teeth. It became evident that orthodontic therapy could adjust mandibular development, leading to the formation of functional jaw orthopedics in Europe and extraoral force measures in the US. These days, both functional appliances and extraoral devices are applied around the globe with the aim of amending growth patterns and forms. Consequently, pursuing true, or at least improved, jaw relationships had become the main objective of treatment by the mid-20th century. At the beginning of the twentieth century, orthodontics was in need of an upgrade. The American Journal of Orthodontics was created for this purpose in 1915; before it, there were no scientific objectives to follow, nor any precise classification system and brackets that lacked features. Until the mid-1970s, braces were made by wrapping metal around each tooth. With advancements in adhesives, it became possible to instead bond metal brackets to the teeth. In 1972, Lawrence F. Andrews gave an insightful definition of the ideal occlusion in permanent teeth. This has had meaningful effects on orthodontic treatments that are administered regularly, and these are: 1. Correct interarchal relationships 2. Correct crown angulation (tip) 3. Correct crown inclination (torque) 4. No rotations 5. Tight contact points 6. Flat Curve of Spee (0.0–2.5 mm), and based on these principles, he discovered a treatment system called the straight-wire appliance system, or the pre-adjusted edgewise system. Introduced in 1976, Larry Andrews' pre-adjusted edgewise appliance, more commonly known as the straight wire appliance, has since revolutionized fixed orthodontic treatment. The advantage of the design lies in its bracket and archwire combination, which requires only minimal wire bending from the orthodontist or clinician. It's aptly named after this feature: the angle of the slot and thickness of the bracket base ultimately determine where each tooth is situated with little need for extra manipulation. Prior to the invention of a straight wire appliance, orthodontists were utilizing a non-programmed standard edgewise fixed appliance system, or Begg's pin and tube system.
Fixed appliances Fixed orthodontic appliances are predominantly derived from the edgewise appliance approach, which typically begins with round wires before transitioning to rectangular archwires for improving tooth alignment. These rectangluar wires promote precision in the positioning of teeth following initial treatment. In contrast to the Begg appliance, which was based solely on round wires and auxiliary springs, the Tip-Edge system emerged in the early 21st century. This innovative technology allowed for the utilization of rectangular archwires to precisely control tooth movement during the finishing stages after initial treatment with round wires. Thus, almost all modern fixed appliances can be considered variations on this edgewise appliance system. Early 20th-century orthodontist Edward Angle made a major contribution to the world of dentistry. He created four distinct appliance systems that have been used as the basis for many orthodontic treatments today, barring a few exceptions. They are E-arch, pin and tube, ribbon arch, and edgewise systems. E-arch Edward H. Angle made a significant contribution to the dental field when he released the 7th edition of his book in 1907, which outlined his theories and detailed his technique. This approach was founded upon the iconic "E-Arch" or 'the-arch' shape as well as inter-maxillary elastics. This device was different from any other appliance of its period as it featured a rigid framework to which teeth could be tied effectively in order to recreate an arch form that followed pre-defined dimensions. Molars were fitted with braces, and a powerful labial archwire was positioned around the arch. The wire ended in a thread, and to move it forward, an adjustable nut was used, which allowed for an increase in circumference.
Idaho State University
Q1656608 EXACT TITLE 0.940
QID OVERLAP: Q1656608 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (12): "campus", "enrollment", "founded", "high", "idaho", "isu", "meridian", "programs", "public", "research", "students", "university". | EXACT TITLE in dental: "Idaho State University". | EXACT TITLE in healthcare: "Idaho State University".
campusenrollmentfoundedhighidahoisumeridianprogramspublicresearchstudentsuniversity
Idaho State University (ISU) is a public research university in Pocatello, Idaho, United States. Founded in 1901 as the Academy of Idaho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
Established in 2011, the Career Path Internship (CPI) program provides students an opportunity to gain professional experience while in school. All CPI internships are paid positions that are aligned with the student's major or career goals. In 2016 the CPI program provided professional experience in approximately 1,000 internships both on and off campus. The CPI program has seen exceptional growth in past years with a 2016 budget estimated at $2.3 million. ISU offers two doctoral level nursing programs after the Idaho State Board of Education approved a doctoral degree in advanced nursing practice, which will now give ISU two doctoral-level nursing programs. The first offered is a Doctor of Philosophy (Ph.D.) degree in nursing beginning summer 2013 and the only one in the state. ISU received top designation for nuclear training and was tagged Regional Center of Excellence. The Energy Systems Technology and Education Center (ESTEC) at the ISU College of Technology will soon be coordinating the nuclear energy education and training for technicians in a nine-state region. The Nuclear Energy Institute (NEI) has designated ESTEC as the Northwest Regional Center of Excellence for Nuclear Education and Training. The top designation includes the states of Idaho, Montana, Washington, Oregon, South Dakota, North Dakota, Utah, and Nebraska. ESTEC is one of five regional NEI-designated centers in the country. ISU's new doctoral experimental psychology program, the only program of its type in Idaho, accepted its first three students fall 2011. The new experimental psychology doctoral program complements ISU's doctoral clinical psychology program, created in the early 1990s. Eventually, the experimental psychology program plans to accept six students annually. A new Idaho State University geosciences doctoral program is approved to begin in August 2013. The Center for Sports Concussion at ISU, opened in 2009, is housed within the Department of Sport Science and Physical Education. The purpose of the Center for Sports Concussion is to offer educational outreach on concussion identification and management practices to athletic administrators, coaches, and parent groups throughout Idaho in accordance with Idaho law and demonstrated need, and to facilitate baseline and post-concussion neuro-cognitive testing to athletes participating in sports programs throughout eastern Idaho. The university awards The Teaching Literature Book Award for the best book on teaching literature at the post-secondary or graduate level. The prize is conferred in odd numbered years, and the inaugural award was conferred in 2015.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (11): "association", "boise", "idaho", "land", "local", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in dental: "Treasure Valley". | EXACT TITLE in healthcare: "Treasure Valley".
associationboiseidaholandlocalregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Mental health
Q317309 EXACT TITLE 0.900
QID OVERLAP: Q317309 in dental (tier:branch) and healthcare (tier:evergreen). | SHARED TOKENS (10): "behavior", "community", "competing", "individual", "level", "organization", "professional", "relationships", "social", "work". | EXACT TITLE in healthcare: "Mental health".
behaviorcommunitycompetingindividuallevelorganizationprofessionalrelationshipssocialwork
Mental health encompasses emotional, psychological, and social well-being, influencing cognition, perception, and behavior. Mental health plays a crucial role in an individual's daily life when managing stress, engaging with others, and contributing to life overall. According to the World Health Organization (WHO), it is a "state of well-being in which the individual realizes their abilities, can cope with the normal stresses of life, can work productively and fruitfully, and can contribute to their community". It likewise determines how an individual handles stress, interpersonal relationships, and decision-making. Mental health includes subjective well-being, perceived self-efficacy, autonomy, competence, intergenerational dependence, and self-actualization of one's intellectual and emotional potential, among others. Mental health also includes emotional, psychological, and social well-being, and it affects how people manage stress and make everyday decisions. From the perspectives of positive psychology or holism, mental health is thus not merely the absence of mental illness. Rather, it is a broader state of well-being that includes an individual's ability to enjoy life and to create a balance between life activities and efforts to achieve psychological resilience.
Mental health, as defined by the Public Health Agency of Canada, is an individual's capacity to feel, think, and act in ways to achieve a better quality of life while respecting personal, social, and cultural boundaries. Impairment of any of these is a risk factor for mental disorders, or mental illnesses, which is a component of mental health. In 2019, about 970 million people worldwide suffered from a mental disorder, with anxiety and depression being the most common. The number of people diagnosed with mental disorders has risen significantly over the years. Mental disorders are defined as health conditions that affect and alter cognitive functioning, emotional responses, and behavior associated with distress and/or impaired functioning. The ICD-11 is the global standard used to diagnose, treat, research, and report various mental disorders. In the United States, the DSM-5 is used as the classification system of mental disorders. Mental health is associated with a number of lifestyle factors such as diet, exercise, stress, drug use and abuse, social connections, and interactions.
Mental illnesses are more common than cancer, diabetes, or heart disease. As of 2021, over 22 percent of all Americans over the age of 18 meet the criteria for having a mental illness. Evidence suggests that 970 million people worldwide have a mental disorder. Major depression ranks third among the top 10 leading causes of disease worldwide. By 2030, it is predicted to become the leading cause of disease worldwide. Over 700 thousand people commit suicide every year and around 14 million attempt it. A World Health Organization (WHO) report estimates the global cost of mental illness at nearly $2.5 trillion (two-thirds in indirect costs) in 2010, with a projected increase to over $6 trillion by 2030. Evidence from the WHO suggests that nearly half of the world's population is affected by mental illness with an impact on their self-esteem, relationships and ability to function in everyday life. An individual's emotional health can impact their physical health. Poor mental health can lead to problems such as the inability to make adequate decisions and substance use disorders. Good mental health can improve life quality whereas poor mental health can worsen it. According to Richards, Campania, & Muse-Burke, "There is growing evidence that is showing emotional abilities are associated with pro-social behaviors such as stress management and physical health." Their research also concluded that people who lack emotional expression are inclined to anti-social behaviors (e.g., substance use disorder and alcohol use disorder, physical fights, vandalism), which reflects one's mental health and suppressed emotions.
Preventive healthcare
Q1773974 QID OVERLAP 0.800
QID OVERLAP: Q1773974 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (24): "adults", "blood", "children", "counseling", "date", "dental", "disease", "education", "healthcare", "high", "home", "identify", "index", "individual", "information", "level", "maintain", "million", "organization", "primary"....
adultsbloodchildrencounselingdatedentaldiseaseeducationhealthcarehighhomeidentifyindexindividualinformationlevelmaintainmillionorganizationprimaryproviderrelatedriskstudy
e of chronic diseases and deaths from these diseases. There are many methods for prevention of disease. One of them is prevention of teenage smoking through information giving. It is recommended that adults and children aim to visit their doctor for regular check-ups, even if they feel healthy, to perform disease screening, identify risk factors for disease, discuss tips for a healthy and balanced lifestyle, stay up to date with immunizations and boosters, and maintain a good relationship with a healthcare provider. In pediatrics, some common examples of primary prevention are encouraging parents to turn down the temperature of their home water heater in order to avoid scalding burns, encouraging children to wear bicycle helmets, and suggesting that people use the air quality index (AQI) to check the level of pollution in the outside air before engaging in sporting activities. Some common disease screenings include checking for hypertension (high blood pressure), hyperglycemia (high blood sugar, a risk factor for diabetes mellitus), hypercholesterolemia (high blood cholesterol), screening for colon cancer, depression, HIV and other common types of sexually transmitted disease such as chlamydia, syphilis, and gonorrhea, mammography (to screen for breast cancer), colorectal cancer screening, a Pap test (to check for cervical cancer), and screening for osteoporosis. Genetic testing can also be performed to screen for mutations that cause genetic disorders or predisposition to certain diseases such as breast or ovarian cancer.
Obesity Obesity is a major risk factor for a wide variety of conditions including cardiovascular diseases, hypertension, certain cancers, and type 2 diabetes. In order to prevent obesity, it is recommended that individuals adhere to a consistent exercise regimen as well as a nutritious and balanced diet. A healthy individual should aim for acquiring 10% of their energy from proteins, 15-20% from fat, and over 50% from complex carbohydrates, while avoiding alcohol as well as foods high in fat, salt, and sugar. Sedentary adults should aim for at least half an hour of moderate-level daily physical activity and eventually increase to include at least 20 minutes of intense exercise, three times a week. Preventive health care offers many benefits to those that chose to participate in taking an active role in the culture. The medical system in our society is geared toward curing acute symptoms of disease after the fact that they have brought us into the emergency room. An ongoing epidemic within American culture is the prevalence of obesity. Healthy eating and regular exercise play a significant role in reducing an individual's risk for type 2 diabetes. A 2008 study concluded that about 23.6 million people in the United States had diabetes, including 5.7 million that had not been diagnosed. 90 to 95 percent of people with diabetes have type 2 diabetes.
Lung cancer is the leading cause of cancer-related deaths in the United States and Europe and is a major cause of death in other countries. Tobacco is an environmental carcinogen and the major underlying cause of lung cancer. Between 25% and 40% of all cancer deaths and about 90% of lung cancer cases are associated with tobacco use. Other carcinogens include asbestos and radioactive materials. Both smoking and second-hand exposure from other smokers can lead to lung cancer and eventually death. Prevention of tobacco use is paramount to prevention of lung cancer. Individual, community, and statewide interventions can prevent or cease tobacco use. 90% of adults in the U.S. who have ever smoked did so prior to the age of 20. In-school prevention/educational programs, as well as counseling resources, can help prevent and cease adolescent smoking. Other cessation techniques include group support programs, nicotine replacement therapy (NRT), hypnosis, and self-motivated behavioral change. Studies have shown long term success rates (>1 year) of 20% for hypnosis and 10%-20% for group therapy. Cancer screening programs serve as effective sources of secondary prevention. The Mayo Clinic, Johns Hopkins, and Memorial Sloan-Kettering hospitals conducted annual x-ray screenings and sputum cytology tests and found that lung cancer was detected at higher rates, earlier stages, and had more favorable treatment outcomes, which supports widespread investment in such programs. Legislation can also affect smoking prevention and cessation. In 1992, Massachusetts (United States) voters passed a bill adding an extra 25 cent tax to each pack of cigarettes, despite intense lobbying and $7.3 million spent by the tobacco industry to oppose this bill. Tax revenue goes toward tobacco education and control programs and has led to a decline of tobacco use in the state. Lung cancer and tobacco smoking are increasing worldwide, especially in China. China is responsible for about one-third of the global consumption and production of tobacco products. Tobacco control policies have been ineffective as China is home to 350 million regular smokers and 750 million passive smokers and the annual death toll is over 1 million. Recommended actions to reduce tobacco use include decreasing tobacco supply, increasing tobacco taxes, widespread educational campaigns, decreasing advertising from the tobacco industry, and increasing tobacco cessation support resources. In Wuhan, China, a 1998 school-based program implemented an anti-tobacco curriculum for adolescents and reduced the number of regular smokers, though it did not significantly decrease the number of adolescents who initiated smoking.
H
Q1512929 QID OVERLAP 0.800
QID OVERLAP: Q1512929 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (18): "access", "defined", "demographic", "disease", "distributed", "groups", "healthcare", "individual", "level", "need", "organization", "physical", "population", "providing", "related", "resources", "social", "systems".
accessdefineddemographicdiseasedistributedgroupshealthcareindividuallevelneedorganizationphysicalpopulationprovidingrelatedresourcessocialsystems
Health equity is social equity in health. Disparities in health outcomes can be related to differences in access to social determinants of health, specifically from wealth, power and prestige. Individuals who have consistently been deprived of these three determinants are significantly disadvantaged from health inequities, and face worse health outcomes than those who are able to access certain resources. This is especially important in areas with increased diversity across social, ethnic, and racial groups, as underrepresentation in healthcare systems is a global issue. In order to achieve health equity, resources must be allocated based on an individual need-based principle. Health equity is distinct from formal equal opportunity, such as simply providing every individual with equal access to health care. Health equity is also connected with Scientific Equity, which describes the scientific methods by which to achieve Health Equity. According to the World Health Organization, "Health is a state of complete physical, mental and social well-being and not merely the absence of disease or infirmity". The quality of health and how health is distributed among economic and social status in a society can provide insight into the level of development within that society. Health is a basic human right and human need, and all human rights are interconnected. Thus, health must be discussed along with all other basic human rights. Health equity is defined by the CDC as "the state in which everyone has a fair and just opportunity to attain their highest level of health". It is closely associated with the social justice movement, with good health considered a fundamental human right. These inequities may include differences in the "presence of disease, health outcomes, or access to health care" between populations with a different race, ethnicity, gender, sexual orientation, disability, or socioeconomic status. Health inequity differs from health inequality in that the latter term is used in a number of countries to refer to those instances whereby the health of two demographic groups (not necessarily ethnic or racial groups) differs despite similar access to health care services. It can be further described as differences in health that are avoidable, unfair, and unjust, and cannot be explained by natural causes, such as biology, or differences in choice. Thus, if one population dies younger than another because of genetic differences, which is a non-remediable/controllable factor, the situation would be classified as a health inequality. Conversely, if a population has a lower life expectancy due to lack of access to medications, the situation would be classified as a health inequity. These inequities may include differences in the "presence of disease, health outcomes, or access to health care". Although, it is important to recognize the difference in health equity and equality, as having equality in health is essential to begin achieving health equity.
e health equity, resources must be allocated based on an individual need-based principle. Health equity is distinct from formal equal opportunity, such as simply providing every individual with equal access to health care. Health equity is also connected with Scientific Equity, which describes the scientific methods by which to achieve Health Equity. According to the World Health Organization, "Health is a state of complete physical, mental and social well-being and not merely the absence of disease or infirmity". The quality of health and how health is distributed among economic and social status in a society can provide insight into the level of development within that society. Health is a basic human right and human need, and all human rights are interconnected. Thus, health must be discussed along with all other basic human rights. Health equity is defined by the CDC as "the state in which everyone has a fair and just opportunity to attain their highest level of health". It is closely associated with the social justice movement, with good health considered a fundamental human right. These inequities may include differences in the "presence of disease, health outcomes, or access to health care" between populations with a different race, ethnicity, gender, sexual orientation, disability, or socioeconomic status. Health inequity differs from health inequality in that the latter term is used in a number of countries to refer to those instances whereby the health of two demographic groups (not necessarily ethnic or racial groups) differs despite similar access to health care services. It can be further described as differences in health that are avoidable, unfair, and unjust, and cannot be explained by natural causes, such as biology, or differences in choice. Thus, if one population dies younger than another because of genetic differences, which is a non-remediable/controllable factor, the situation would be classified as a health inequality. Conversely, if a population has a lower life expectancy due to lack of access to medications, the situation would be classified as a health inequity. These inequities may include differences in the "presence of disease, health outcomes, or access to health care". Although, it is important to recognize the difference in health equity and equality, as having equality in health is essential to begin achieving health equity.
closely associated with the social justice movement, with good health considered a fundamental human right. These inequities may include differences in the "presence of disease, health outcomes, or access to health care" between populations with a different race, ethnicity, gender, sexual orientation, disability, or socioeconomic status. Health inequity differs from health inequality in that the latter term is used in a number of countries to refer to those instances whereby the health of two demographic groups (not necessarily ethnic or racial groups) differs despite similar access to health care services. It can be further described as differences in health that are avoidable, unfair, and unjust, and cannot be explained by natural causes, such as biology, or differences in choice. Thus, if one population dies younger than another because of genetic differences, which is a non-remediable/controllable factor, the situation would be classified as a health inequality. Conversely, if a population has a lower life expectancy due to lack of access to medications, the situation would be classified as a health inequity. These inequities may include differences in the "presence of disease, health outcomes, or access to health care". Although, it is important to recognize the difference in health equity and equality, as having equality in health is essential to begin achieving health equity.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "employers", "home", "idaho", "level", "locally", "major", "north", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployershomeidaholevellocallymajornorthpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Artificial intelligence in healthcare
Q28324961 QID OVERLAP 0.800
QID OVERLAP: Q28324961 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (18): "analysis", "clinical", "data", "diagnosis", "disease", "healthcare", "monitoring", "patient", "patients", "professionals", "public", "regulatory", "related", "software", "support", "systems", "treatment", "trust".
analysisclinicaldatadiagnosisdiseasehealthcaremonitoringpatientpatientsprofessionalspublicregulatoryrelatedsoftwaresupportsystemstreatmenttrust
Disease diagnosis Accurate and early diagnosis of diseases is still a challenge in healthcare. Recognizing medical conditions and their symptoms is a complex problem. AI can assist clinicians with data processing capabilities to save time and improve accuracy. Through the use of machine learning, artificial intelligence can substantially aid doctors in patient diagnosis through the analysis of mass electronic health records (EHRs). AI can help early prediction, for example, of Alzheimer's disease and dementias, by looking through large numbers of similar cases and possible treatments. In 2023 a study reported higher satisfaction rates with ChatGPT-generated responses compared with those from physicians for medical questions posted on Reddit's r/AskDocs. Evaluators preferred ChatGPT's responses to physician responses in 78.6% of 585 evaluations, noting better quality and empathy. The authors noted that these were isolated questions taken from an online forum, not in the context of an established patient-physician relationship.
Telehealth Telehealth is the treatment of patients remotely. Pivovarov and Elhada (2015) propose using wearable devices to allow for constant monitoring of a patient and the ability to notice changes via AI that may be less distinguishable by humans.
Dermatology Medical imaging (such as X-ray and photography) is a commonly used tool in dermatology and the development of deep learning has been strongly tied to image processing. Han et al. showed keratinocytic skin cancer detection from face photographs. Esteva et al. demonstrated dermatologist-level classification of skin cancer from lesion images. Noyan et al. demonstrated a convolutional neural network that achieved 94% accuracy at identifying skin cells from microscopic Tzanck smear images. Concerns have been raised, however, regarding the limited diversity of datasets, particularly the underrepresentation of darker skin tones, which may reduce generalizability across populations. In addition to skin cancer detection and analysis of tissue samples of histological smears, AI has been used in chronic and aesthetic dermatology. MDalgorithms has developed a mobile application MDacne which uses machine learning to grade acne severity from smartphone selfies and generate treatment regimens. AI has also been used to diagnose inflammatory skin conditions such as rosacea, where an AI tool was reported to achieve accuracy rates of approximately 88–90% in identifying the disorder. MDhair applies AI analysis to scalp photographs to personalize hair loss treatments, with clinical trials reporting reductions in shedding, increased density, and improved scalp hydration. A large study involving over one million individuals describes the use of AI-based systems in collecting demographic and clinical data on skin and hair health, enabling the identification of population-level trends. According to some researchers, AI algorithms have been shown to be more effective than dermatologists at identifying cancer. However, a 2021 review article found that a majority of papers analyzing the performance of AI algorithms designed for skin cancer classification failed to use external test sets. Only four research studies were found in which the AI algorithms were tested on clinics, regions, or populations distinct from those it was trained on, and in each of those four studies, the performance of dermatologists was found to be on par with that of the algorithm. Moreover, only one study was set in the context of a full clinical examination; others were based on interaction through web-apps or online questionnaires, with most based entirely on context-free images of lesions. In this study, it was found that dermatologists significantly outperformed the algorithms.
Health Insurance Portability and Accountability Act
Q606563 QID OVERLAP 0.800
QID OVERLAP: Q606563 in dental (tier:branch) and healthcare (tier:evergreen). | SHARED TOKENS (26): "act", "change", "coverage", "employees", "employers", "entities", "families", "family", "federal", "governs", "group", "healthcare", "information", "insurance", "law", "members", "national", "patient", "patients", "plans"....
actchangecoverageemployeesemployersentitiesfamiliesfamilyfederalgovernsgrouphealthcareinformationinsurancelawmembersnationalpatientpatientsplansprovidersprovisionsrequirestandardstitleworkers
The Health Insurance Portability and Accountability Act of 1996 (HIPAA or the Kennedy–Kassebaum Act) is a United States Act of Congress enacted by the 104th United States Congress and signed into law by President Bill Clinton on August 21, 1996. It aimed to alter the transfer of healthcare information and stipulated guidelines by which personally identifiable information maintained by the healthcare and healthcare insurance industries should be protected from fraud and theft, and addressed some limitations on healthcare insurance coverage. It generally prohibits healthcare providers and businesses called covered entities from disclosing protected information to anyone other than a patient and the patient's authorized representatives without their consent. The law does not restrict patients from accessing their own information, except in limited cases.
ormation however they choose, nor does it require confidentiality where a patient discloses medical information to family members, friends, or other individuals not employees of a covered entity. The act consists of five titles: Title I protects health insurance coverage for workers and their families if they change or lose their jobs. Title II, known as the Administrative Simplification (AS) provisions, requires the establishment of national standards for electronic health care transactions and national identifiers for providers, health insurance plans, and employers. Title III sets guidelines for pre-tax medical spending accounts. Title IV sets guidelines for group health plans. Title V governs company-owned life insurance policies.
Title I protects health insurance coverage for workers and their families if they change or lose their jobs. Title II, known as the Administrative Simplification (AS) provisions, requires the establishment of national standards for electronic health care transactions and national identifiers for providers, health insurance plans, and employers. Title III sets guidelines for pre-tax medical spending accounts. Title IV sets guidelines for group health plans. Title V governs company-owned life insurance policies.
I
Q30253346 EXACT TITLE 0.780
QID OVERLAP: Q30253346 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (4): "department", "idaho", "public", "welfare". | EXACT TITLE in dental: "Idaho Department of Health and Welfare".
departmentidahopublicwelfare
Idaho Department of Health and Welfare is a public health agency in the state of Idaho. History The department was founded in 1972. Functions The department provides healthcare services, records management, children and family services, food assistance programs, and healthcare services.
Health informatics
Q870895 QID OVERLAP 0.760
QID OVERLAP: Q870895 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (13): "approaches", "behavior", "data", "healthcare", "hospitals", "information", "management", "patient", "research", "software", "study", "systems", "technology".
approachesbehaviordatahealthcarehospitalsinformationmanagementpatientresearchsoftwarestudysystemstechnology
oftware engineering, information engineering, bioinformatics, bio-inspired computing, theoretical computer science, information systems, data science, information technology, autonomic computing, and behavior informatics. In academic institutions, health informatics includes research focuses on applications of artificial intelligence in healthcare and designing medical devices based on embedded systems.
ds with computing fields, in particular computer engineering, software engineering, information engineering, bioinformatics, bio-inspired computing, theoretical computer science, information systems, data science, information technology, autonomic computing, and behavior informatics. In academic institutions, health informatics includes research focuses on applications of artificial intelligence in healthcare and designing medical devices based on embedded systems.
ons of artificial intelligence in healthcare and designing medical devices based on embedded systems. In some countries the term informatics is also used in the context of applying library science to data management in hospitals where it aims to develop methods and technologies for the acquisition, processing, and study of patient data, An umbrella term of biomedical informatics has been proposed. Subject areas Dutch former professor of medical informatics Jan van Bemmel has described medical informatics as the theoretical and practical aspects of information processing and communication based on knowledge and experience derived from processes in medicine and health care. The Faculty of Clinical Informatics has identified six high level domains of core competency for clinical informaticians:
O
Q504033 EXACT TITLE 0.760
QID OVERLAP: Q504033 in dental (tier:evergreen) and healthcare (tier:branch). | SHARED TOKENS (3): "oral", "surgery", "treatment". | EXACT TITLE in dental: "Oral and maxillofacial surgery".
oralsurgerytreatment
Oral and maxillofacial surgery (OMFS) is a surgical speciality focusing on reconstructive surgery of the face, facial trauma surgery, the mouth, head and neck, and jaws, as well as facial plastic surgery including cleft lip and cleft palate surgery and rhinoplasty.
Specialty An oral and maxillofacial surgeon is a specialist surgeon who treats the entire craniomaxillofacial complex: anatomical area of the mouth, jaws, face, and skull, head and neck as well as associated structures.
United Kingdom and Europe In countries such as the UK and most of Europe, it is recognised as a specialty of medicine with a degree in medicine and an additional degree in dentistry being compulsory. The scope of practice is mainly head and neck cancer, microvascular reconstruction, craniofacial surgery and cranio-maxillofacial trauma, skin cancer, facial deformity, cleft lip and palate, craniofacial surgery, TMJ surgery and cosmetic facial surgery. In the UK, maxillofacial surgery is a speciality of the Royal College of Surgeons of England, and the Royal College of Surgeons of Edinburgh. Intercollegiate Board Certification is provided through the JCIE, and is the same as plastic surgery, ENT, general surgery, orthopaedics, paediatric surgery, neurosurgery and cardiothoracic surgery. The FRCS (Fellowship of the Royal College of Surgeons) is the specialist exam at the end of surgical training, and is required to work as a Consultant Surgeon in maxillofacial surgery. In the EU, OMFS is defined within Directive 2005/36 on professional qualifications (updated 2021). The two OMFS specialties are 'dual degree' dental, oral, and maxillofacial surgery (DOMFS) and 'single medical degree' maxillofacial surgery (MFS). In some cases a dental degree may be required to enter speciality training but in all cases the medical degree must be obtained before starting OMFS speciality training. In Poland, maxillofacial surgery has always been dominated by dentists and still the majority of current OMFS trainees are dental graduates. Since 2019, Norway switched from dual degree requirement for maxillofacial surgery to medical degree only.
P
Q938196 QID OVERLAP 0.740
QID OVERLAP: Q938196 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (12): "conditions", "dental", "dentist", "dentistry", "diagnosis", "disease", "implants", "periodontal", "periodontics", "specialty", "teeth", "treatment".
conditionsdentaldentistdentistrydiagnosisdiseaseimplantsperiodontalperiodonticsspecialtyteethtreatment
cs (from Ancient Greek περί, perí – 'around'; and ὀδούς, odoús – 'tooth', genitive ὀδόντος, odóntos) is the specialty of dentistry that studies supporting structures of teeth, as well as diseases and conditions that affect them. The supporting tissues are known as the periodontium, which includes the gingiva (gums), alveolar bone, cementum, and the periodontal ligament.
Gingival diseases Gingivitis is a common condition that affects the gingiva or mucosal tissues that surround the teeth. The condition is a form of periodontal disease; however, it is the least devastating, in that it does not involve irreversible damage or changes to the periodontium (gingiva, periodontal ligament, cementum or alveolar bone). It is commonly detected by patients when gingival bleeding occurs spontaneously during brushing or eating. It is also characterized by generalized inflammation, swelling, and redness of the mucosal tissues. Gingivitis is typically painless and is most commonly a result of plaque biofilm accumulation, in association with reduced or poor oral hygiene. Other factors may increase a person's risk of gingivitis, including but not limited to systemic conditions such as uncontrolled diabetes mellitus and some medications. The signs and symptoms of gingivitis can be reversed through improved oral hygiene measures and increased plaque disruption.
Periodontal diseases Periodontal disease encompasses a number of diseases of the periodontal tissues that result in attachment loss and destruction of alveolar bone. Periodontal diseases take on many different forms but are usually a result of a coalescence of bacterial plaque biofilm accumulation of the red complex bacteria (e.g. P. gingivalis, T. forsythia, and T. denticola) of the gingiva and teeth, combined with host immuno-inflammatory mechanisms and other risk factors that can lead to destruction of the supporting bone around natural teeth. Untreated, these diseases can lead to alveolar bone loss and tooth loss. As of 2013, periodontal disease accounted for 70.8% of teeth lost in patients with the disease in South Korea. Periodontal disease is the second most common cause of tooth loss (second to dental caries) in Scotland. Twice-daily brushing and flossing are a way to help prevent periodontal diseases. Healthy gingiva can be described as stippled, pale or coral pink in Caucasian people, with various degrees of pigmentation in other races. The gingival margin is located at the cemento-enamel junction without the presence of pathology. The gingival pocket between the tooth and the gingival should be no deeper than 1–3mm to be considered healthy. There is also the absence of bleeding on gentle probing. Periodontal diseases can be caused by a variety of factors, the most prominent being dental plaque. Dental plaque forms a bacterial biofilm on the tooth surface; if not adequately removed from the tooth surface in close proximity to the gingiva, a host-microbial interaction gets underway. This results in the imbalance between host and bacterial factors which can in turn result in a change from health to disease. Other local or systemic factors can result in or further progress the manifestation of periodontal disease. Other factors can include age, socio-economic status, oral hygiene education and diet. Systemic factors may include uncontrolled diabetes or tobacco smoking. Signs and symptoms of periodontal disease: bleeding gums, gingival recession, halitosis (bad breath), mobile teeth, ill-fitting dentures and buildup of plaque and calculus. Individual risk factors include: gender, smoking and alcohol consumption, diabetes, obesity and metabolic syndrome, osteoporosis and Vitamin D conditions, stress and genetic factors. 2018 AAP/EFP classification of periodontal and peri-implant diseases and conditions In 2017, the American Academy of Periodontology (AAP) and the European Federation of Periodontology (EFP) together collaborated to revise and adopt a new classification system for periodontal conditions to aid in a more personalized approach to patient care.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "college", "footprint", "home", "idaho", "meridian", "nampa", "population", "university", "western".
boisecanyoncollegefootprinthomeidahomeridiannampapopulationuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
D
Q5259419 EXACT TITLE 0.720
QID OVERLAP: Q5259419 in dental (tier:evergreen) and healthcare (tier:evergreen). | SHARED TOKENS (2): "dental", "insurance". | EXACT TITLE in dental: "Dental insurance". | EXACT TITLE in healthcare: "Dental insurance".
dentalinsurance
Dental insurance is a form of health insurance designed to pay a portion of the costs associated with dental care. American dental insurance The American Dental Association has lobbied against the US government providing dental insurance coverage for all Medicare recipients. In the US, two-thirds of dentists do not accept dental insurance through Medicaid.
Indemnity Dental Insurance Plan With indemnity dental plans, the insurance company generally pays the dentist a percentage of the cost of services. Restrictions may include the co-payment requirements, waiting period, stated deductible, annual limitations, graduated percentage scales based on the type of procedure, and the length of time that the policy has been owned. Dental Health Maintenance Organization (DHMO) Dental Health Maintenance Organization plans entail dentists contracting with a dental insurance company that dentists agree to accept an insurance fee schedule and give their customers a reduced cost for services as an In-Network Provider. Many DHMO insurance plans have little or no waiting periods and no annual maximum benefit limitations, while covering major the United States, Participating Provider Network or PPO, also referred to as Preferred Provider Organization, is an organization governed by medical doctors, hospitals, other health centers, and medical care providers. This organization has an agreement with an insurer or the third party administrator to provide health insurance to the people associated with their client at reduced or low rates. Participating Provider Network plan may work similar to a DHMO while using an In-Network facility. However, a PPO allows Out-of-Network or Non-Participating Providers to be used for service.
Dental Health Maintenance Organization (DHMO) Dental Health Maintenance Organization plans entail dentists contracting with a dental insurance company that dentists agree to accept an insurance fee schedule and give their customers a reduced cost for services as an In-Network Provider. Many DHMO insurance plans have little or no waiting periods and no annual maximum benefit limitations, while covering major the United States, Participating Provider Network or PPO, also referred to as Preferred Provider Organization, is an organization governed by medical doctors, hospitals, other health centers, and medical care providers. This organization has an agreement with an insurer or the third party administrator to provide health insurance to the people associated with their client at reduced or low rates. Participating Provider Network plan may work similar to a DHMO while using an In-Network facility. However, a PPO allows Out-of-Network or Non-Participating Providers to be used for service. Any difference of fees will become the financial responsibility of the patient, unless otherwise specified. Payouts Dental insurance companies divide benefits, services, or procedures into categories and refer to them with American Dental Association (ADA) 3-4 digit code. As an example, Preventive and Diagnostic procedures often include exams (ADA code 0120), x-rays (ADA code 0210), and basic cleanings or prophylaxis (ADA code 1110). Basic procedures often include fillings, periodontics, endodontics, and oral surgery. Major procedures often are crowns, dentures, and implants. Procedures such as periodontics, endodontics, and oral surgery may be considered major, depending on the policy. Some dental insurance plans may have an annual maximum benefit limit. Once the annual maximum benefit is exhausted any additional treatments may become the patient's responsibility. Each year, the annual maximum is reissued.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (9): "ada", "boise", "capital", "home", "idaho", "local", "population", "private", "washington".
adaboisecapitalhomeidaholocalpopulationprivatewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
boisecaldwellcanyoncollegeidaholocallypopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (6): "ada", "boise", "capital", "idaho", "meridian", "population".
adaboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "nampa", "population".
boisecaldwellcanyonidahonampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in dental (tier:branch) and healthcare (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
291 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP291 edges
🌿 BRANCH192 edges
0.500
accreditationadaassociationcoveragecurrentdentalestablishedmembersnationalorganizationpopulationprofessionalprovidingrelativestudentstherapists
SHARED TOKENS (16): "accreditation", "ada", "association", "coverage", "current", "dental", "established", "members", "national", "organization", "population", "professional", "providing", "relative", "students", "therapists". | EXACT TITLE in dental: "American Dental Association".
0.500
accessadditionaladultsassociationchildrencollegecomprehensivedeliveryestablishedfamilyhomeinformationmanagementmodelpatientpatientsprimaryproviderprovidingresources
SHARED TOKENS (22): "access", "additional", "adults", "association", "children", "college", "comprehensive", "delivery", "established", "family", "home", "information", "management", "model", "patient", "patients", "primary", "provider", "providing", "resources".... | EXACT TITLE in healthcare: "Medical home".
0.500
clinicalcliniciansclinicscommunitiescommunitycounselingdepartmentdiseaseeducationenvironmentfamilygroupgroupshealthcarehospitalhospitalslevelmajormanagementmembers
SHARED TOKENS (43): "clinical", "clinicians", "clinics", "communities", "community", "counseling", "department", "disease", "education", "environment", "family", "group", "groups", "healthcare", "hospital", "hospitals", "level", "major", "management", "members".... | EXACT TITLE in dental: "Community health". | EXACT TITLE in healthcare: "Community health".
0.500
adultboardbusinesscollegecommunitycomprehensiveeducationenrollmentfoundedgeneralidahoindustrynorthofficepublicresidentsschoolstudentstechnologyuniversity
SHARED TOKENS (22): "adult", "board", "business", "college", "community", "comprehensive", "education", "enrollment", "founded", "general", "idaho", "industry", "north", "office", "public", "residents", "school", "students", "technology", "university".... | EXACT TITLE in dental: "College of Eastern Idaho".
0.500
clinicclinicaldentistdentistrydirecteducationexperiencehospitalindividualmedicinepharmacyphysicalpracticepracticingqualifiedreceivedrequirementresidencyschoolspecialty
SHARED TOKENS (24): "clinic", "clinical", "dentist", "dentistry", "direct", "education", "experience", "hospital", "individual", "medicine", "pharmacy", "physical", "practice", "practicing", "qualified", "received", "requirement", "residency", "school", "specialty".... | EXACT TITLE in dental: "Residency (medicine)". | EXACT TITLE in healthcare: "Residency (medicine)".
0.500
deliverydirectdirectlyemployersfamilyfinancialhealthcareinsuranceinsurermodelnetworkspatientsprimaryproviderprovidersrelationshipsstandardsystems
SHARED TOKENS (18): "delivery", "direct", "directly", "employers", "family", "financial", "healthcare", "insurance", "insurer", "model", "networks", "patients", "primary", "provider", "providers", "relationships", "standard", "systems". | EXACT TITLE in healthcare: "Direct primary care".
0.500
additionalbarriersbehaviorconditionsemployeeemployeesenvironmentequipmentframeworkindividualinjuryneededoccupationalphysicalpolicyrisksafetysignificantworkworkers
SHARED TOKENS (21): "additional", "barriers", "behavior", "conditions", "employee", "employees", "environment", "equipment", "framework", "individual", "injury", "needed", "occupational", "physical", "policy", "risk", "safety", "significant", "work", "workers".... | EXACT TITLE in dental: "Personal protective equipment".
0.500
Health care ↗ Q31207 EXACT TITLE
accessadditionalalliedbarrierscommunitiesconditionscoveragedentistrydiagnosisdiseaseestablishedfinancialgeneralhealthcarehistoryincomeinformationinjuryinsurancemedicine
SHARED TOKENS (38): "access", "additional", "allied", "barriers", "communities", "conditions", "coverage", "dentistry", "diagnosis", "disease", "established", "financial", "general", "healthcare", "history", "income", "information", "injury", "insurance", "medicine".... | EXACT TITLE in dental: "Health care". | EXACT TITLE in healthcare: "Health care".
0.500
accreditedboardcampuscollegecommissioncommunitycomprehensiveearlyenrollmentidahonearnorthpublicstudentswestern
SHARED TOKENS (15): "accredited", "board", "campus", "college", "commission", "community", "comprehensive", "early", "enrollment", "idaho", "near", "north", "public", "students", "western". | EXACT TITLE in dental: "North Idaho College".
0.500
Pregnancy ↗ Q11995 EXACT TITLE
ageaverageblooddeliveryearlyexperiencefullhighinsidelong-termmultiplephysicalproceduresrisktechnology
SHARED TOKENS (15): "age", "average", "blood", "delivery", "early", "experience", "full", "high", "inside", "long-term", "multiple", "physical", "procedures", "risk", "technology". | EXACT TITLE in dental: "Pregnancy".
0.500
Assisted living ↗ EXACT TITLE
adultadultsarticleboardbusinesscommunitydefinitionsearlyenvironmentexpansionfacilityfederalgovernmentgrouphomehousingindustryinformationmedicationmodel
SHARED TOKENS (36): "adult", "adults", "article", "board", "business", "community", "definitions", "early", "environment", "expansion", "facility", "federal", "government", "group", "home", "housing", "industry", "information", "medication", "model".... | EXACT TITLE in healthcare: "Assisted living".
0.500
Tooth decay ↗ Q133772 EXACT TITLE
adultschildrenconditionscurrentdentaldetectiondiseasefunctionhighmanagementmillionoralorganizationperiodontalpointpopulationprimaryproducedreportedrisk
SHARED TOKENS (25): "adults", "children", "conditions", "current", "dental", "detection", "disease", "function", "high", "management", "million", "oral", "organization", "periodontal", "point", "population", "primary", "produced", "reported", "risk".... | EXACT TITLE in dental: "Tooth decay".
0.500
educationidahomedicinenetworknewspartnershipprimarypublicregionresearchresidentsschoolstudentsuniversitywashington
SHARED TOKENS (15): "education", "idaho", "medicine", "network", "news", "partnership", "primary", "public", "region", "research", "residents", "school", "students", "university", "washington". | EXACT TITLE in healthcare: "University of Washington School of Medicine".
0.500
actconditionsdecemberdepartmenteducationemploymentestablishedfederalinjurylaborlawoccupationalprovidingregulatorysafetysettingstandardsstatutesworking
SHARED TOKENS (19): "act", "conditions", "december", "department", "education", "employment", "established", "federal", "injury", "labor", "law", "occupational", "providing", "regulatory", "safety", "setting", "standards", "statutes", "working". | EXACT TITLE in dental: "Occupational Safety and Health Administration".
0.500
Nursing ↗ Q121176 EXACT TITLE
actclinicaldemandeducationfamilieshealthcareinjurymemberspatientsplanpracticepractitionersprofessionalsprovidersprovidingpublicqualifiedspecialistssupplysupport
SHARED TOKENS (22): "act", "clinical", "demand", "education", "families", "healthcare", "injury", "members", "patients", "plan", "practice", "practitioners", "professionals", "providers", "providing", "public", "qualified", "specialists", "supply", "support".... | EXACT TITLE in healthcare: "Nursing".
0.500
additionaldetailsdiseaseemployeesemployersenvironmentgeneralgovernmentinjurylawlevelmedicinemillionoccupationalprogramspublicrelatedrisksafetyspecific
SHARED TOKENS (23): "additional", "details", "disease", "employees", "employers", "environment", "general", "government", "injury", "law", "level", "medicine", "million", "occupational", "programs", "public", "related", "risk", "safety", "specific".... | EXACT TITLE in dental: "Occupational safety and health".
0.500
adultadultsageannualconditionsdefinitionsdepartmenteducationfacilityhealthcareindividualinformationmedicationmillionmultiplenationalpatientsprimaryproceduresprofessionals
SHARED TOKENS (26): "adult", "adults", "age", "annual", "conditions", "definitions", "department", "education", "facility", "healthcare", "individual", "information", "medication", "million", "multiple", "national", "patients", "primary", "procedures", "professionals".... | EXACT TITLE in dental: "Health literacy".
0.500
associationclinicalcounselingdatademanddepartmentdiagnosisearlyestablishedfoundedgeneralhistorylocalmedicinephysicalplansprimaryprofessionalproviderspublic
SHARED TOKENS (31): "association", "clinical", "counseling", "data", "demand", "department", "diagnosis", "early", "established", "founded", "general", "history", "local", "medicine", "physical", "plans", "primary", "professional", "providers", "public".... | EXACT TITLE in healthcare: "Chiropractic".
0.500
behaviorbehavioralclinicalconditionsdetailintegrationpatientspracticepractitionerspublicreducedresearchstandardstudytherapytreatmentuniversaluniversitywashingtonwork
SHARED TOKENS (20): "behavior", "behavioral", "clinical", "conditions", "detail", "integration", "patients", "practice", "practitioners", "public", "reduced", "research", "standard", "study", "therapy", "treatment", "universal", "university", "washington", "work". | EXACT TITLE in healthcare: "Dialectical behavior therapy".
0.500
accesscentercenterscollegedepartmentemergencyequipmentestablishedhospitalhospitalsindividualinitialinjurylawlevelmaintainmajormedicineneedoral
SHARED TOKENS (31): "access", "center", "centers", "college", "department", "emergency", "equipment", "established", "hospital", "hospitals", "individual", "initial", "injury", "law", "level", "maintain", "major", "medicine", "need", "oral".... | EXACT TITLE in healthcare: "Trauma center".
0.500
accreditedalongsideassociationbehavioralboardclinicalcollegecomprehensivedentaldiagnosisdiseaseeducationfullhealthcareindependentlicensedlocalmaintainmajororal
SHARED TOKENS (40): "accredited", "alongside", "association", "behavioral", "board", "clinical", "college", "comprehensive", "dental", "diagnosis", "disease", "education", "full", "healthcare", "independent", "licensed", "local", "maintain", "major", "oral".... | EXACT TITLE in dental: "Dental hygienist".
0.500
adaassociationclinicalcollegeconditionsdentaldentistrydiagnosisfunctionoralpatientsrecognizedspecialtysurgeonsteethtreatment
SHARED TOKENS (16): "ada", "association", "clinical", "college", "conditions", "dental", "dentistry", "diagnosis", "function", "oral", "patients", "recognized", "specialty", "surgeons", "teeth", "treatment". | EXACT TITLE in dental: "Prosthodontics".
0.500
boisecampusdivisionestablishedhighidahoofficesoperatesprofessionalpublicresearchruralstatewidestudentsuniversity
SHARED TOKENS (15): "boise", "campus", "division", "established", "high", "idaho", "offices", "operates", "professional", "public", "research", "rural", "statewide", "students", "university". | EXACT TITLE in healthcare: "University of Idaho".
0.500
Radiology ↗ Q77604 EXACT TITLE
diagnosiseducationguidehealthcareimagingmedicinemonitoringpatientsperformancepracticeproceduresproducedprofessionalprofessionalsradiationspecialtytherapytreatment
SHARED TOKENS (18): "diagnosis", "education", "guide", "healthcare", "imaging", "medicine", "monitoring", "patients", "performance", "practice", "procedures", "produced", "professional", "professionals", "radiation", "specialty", "therapy", "treatment". | EXACT TITLE in healthcare: "Radiology".
0.500
adultadultsclinicaldiagnosisdiseasefamilyfocusedgeneralinternalmedicinenorthpatientspharmacypracticepractitionersqualifiedrecognizedrequireresearchspecialty
SHARED TOKENS (22): "adult", "adults", "clinical", "diagnosis", "disease", "family", "focused", "general", "internal", "medicine", "north", "patients", "pharmacy", "practice", "practitioners", "qualified", "recognized", "require", "research", "specialty".... | EXACT TITLE in healthcare: "Internal medicine".
0.500
clinicaldiseaseeducationfunctionhealthcarehelpsmanagementmedicationmedicinepatientphysicalpracticeprimaryprivateprovidingpublicresearchtherapiststherapy
SHARED TOKENS (19): "clinical", "disease", "education", "function", "healthcare", "helps", "management", "medication", "medicine", "patient", "physical", "practice", "primary", "private", "providing", "public", "research", "therapists", "therapy". | EXACT TITLE in healthcare: "Physical therapy".
0.500
associationbusinesscommunitycoveragecoveringdefinedemployergovernmentindividualinjuryinsuranceinsurermembernationalorganizationplanspolicyprivateproviderpublic
SHARED TOKENS (22): "association", "business", "community", "coverage", "covering", "defined", "employer", "government", "individual", "injury", "insurance", "insurer", "member", "national", "organization", "plans", "policy", "private", "provider", "public".... | EXACT TITLE in healthcare: "Health insurance".
0.500
agecommunityconditionsfocusedhomeindividualizedlevellong-termmultipleneedneededneedspatientspractitionersproviding
SHARED TOKENS (15): "age", "community", "conditions", "focused", "home", "individualized", "level", "long-term", "multiple", "need", "needed", "needs", "patients", "practitioners", "providing". | EXACT TITLE in healthcare: "Long-term care".
0.500
Cancer ↗ Q12078 EXACT TITLE
actagainstageannualaveragechildrendetectiondiagnosisdirectdirectlydiseaseearlygroupimagingmanagementmillionpatientradiationreducedrisk
SHARED TOKENS (26): "act", "against", "age", "annual", "average", "children", "detection", "diagnosis", "direct", "directly", "disease", "early", "group", "imaging", "management", "million", "patient", "radiation", "reduced", "risk".... | EXACT TITLE in healthcare: "Cancer".
0.500
alliedclinicalcommunitiescouncilearlyenvironmentequipmentexperiencefunctiongrouphealthcarehelpsinjurynationalneedneedsoccupationalphysicalprimaryschool
SHARED TOKENS (29): "allied", "clinical", "communities", "council", "early", "environment", "equipment", "experience", "function", "group", "healthcare", "helps", "injury", "national", "need", "needs", "occupational", "physical", "primary", "school".... | EXACT TITLE in healthcare: "Occupational therapy".
0.500
Hospice ↗ Q608152 EXACT TITLE
accessdefineddiseasefacilityfamiliesfocusedhomehospitalinsurancelong-termneedspatientpatientsprovidersprovidingsettingsupportsystemtreatment
SHARED TOKENS (19): "access", "defined", "disease", "facility", "families", "focused", "home", "hospital", "insurance", "long-term", "needs", "patient", "patients", "providers", "providing", "setting", "support", "system", "treatment". | EXACT TITLE in healthcare: "Hospice".
0.500
accessannouncedassociationcapacitycentersdepartmentdiseasefederalgovernmentinformationinjurylongermajormembernationaloccupationalorganizationprogramprogramspublic
SHARED TOKENS (23): "access", "announced", "association", "capacity", "centers", "department", "disease", "federal", "government", "information", "injury", "longer", "major", "member", "national", "occupational", "organization", "program", "programs", "public".... | EXACT TITLE in dental: "Centers for Disease Control and Prevention".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
clinicalcommunitydirectinformationlinksmedicationmonitoringofficepatientpatientspharmacypracticeprimaryproductsprofessionalprofessionalsprovidingrelatedsafetysetting
SHARED TOKENS (22): "clinical", "community", "direct", "information", "links", "medication", "monitoring", "office", "patient", "patients", "pharmacy", "practice", "primary", "products", "professional", "professionals", "providing", "related", "safety", "setting".... | EXACT TITLE in dental: "Pharmacy". | EXACT TITLE in healthcare: "Pharmacy".
0.500
accesscentercentersclinicclinicscommunitydentalexpandedfamilygeneralgrouphealthcareinternallocallow-incomemedicinenetworkpediatricpharmacypractice
SHARED TOKENS (25): "access", "center", "centers", "clinic", "clinics", "community", "dental", "expanded", "family", "general", "group", "healthcare", "internal", "local", "low-income", "medicine", "network", "pediatric", "pharmacy", "practice".... | EXACT TITLE in healthcare: "Community health center".
0.500
adultageagenciesbeyondcollegedivisioneducationgeneralgovernmentinitialintegratedpartnershipsprofessionalprogramsrecognizedschoolstaffstudentssupportuniversity
SHARED TOKENS (21): "adult", "age", "agencies", "beyond", "college", "division", "education", "general", "government", "initial", "integrated", "partnerships", "professional", "programs", "recognized", "school", "staff", "students", "support", "university".... | EXACT TITLE in dental: "Continuing education".
0.500
accessadultsagainstassociationchildrencommissioncompetitiondentaleducationfederalmemberoralpracticeprofessionalresearchteeththerapists
SHARED TOKENS (17): "access", "adults", "against", "association", "children", "commission", "competition", "dental", "education", "federal", "member", "oral", "practice", "professional", "research", "teeth", "therapists". | EXACT TITLE in dental: "Dental therapist".
0.500
additionalclinicalcollegecompetitivedirectoryeducationfeegeneralgovernmentgraduateshospitalsinternallevellicensedlicensinglocalmedicinemodelpointpractice
SHARED TOKENS (30): "additional", "clinical", "college", "competitive", "directory", "education", "fee", "general", "government", "graduates", "hospitals", "internal", "level", "licensed", "licensing", "local", "medicine", "model", "point", "practice".... | EXACT TITLE in healthcare: "Medical school".
0.500
accreditationassociationbloodboardcentercenterscertifiedcommissioncomprehensivedepartmentdiagnosisdirectlydivisionearlyemergencyfacilityhealthcarehistoryhospitallevel
SHARED TOKENS (40): "accreditation", "association", "blood", "board", "center", "centers", "certified", "commission", "comprehensive", "department", "diagnosis", "directly", "division", "early", "emergency", "facility", "healthcare", "history", "hospital", "level".... | EXACT TITLE in healthcare: "Stroke center".
0.500
Diabetes ↗ Q12206 EXACT TITLE
adultadultsbeyondbloodconditionsdeliverydiseaseearlygrouphealthcarehighincomemajormillionpopulationreducedreplacementspecificsystemtherapy
SHARED TOKENS (22): "adult", "adults", "beyond", "blood", "conditions", "delivery", "disease", "early", "group", "healthcare", "high", "income", "major", "million", "population", "reduced", "replacement", "specific", "system", "therapy".... | EXACT TITLE in dental: "Diabetes".
0.500
adultsagebloodclinicalconditionsdentaldiagnosisdiseaseearlyfamilyhighhistorymillionoralperiodontalpopulationprofessionalrisksurgeryteeth
SHARED TOKENS (21): "adults", "age", "blood", "clinical", "conditions", "dental", "diagnosis", "disease", "early", "family", "high", "history", "million", "oral", "periodontal", "population", "professional", "risk", "surgery", "teeth".... | EXACT TITLE in dental: "Periodontal disease". | EXACT TITLE in healthcare: "Periodontal disease".
0.500
agebeyondchangechildrenclinicaldatediagnosisdiseaseearlyfamilyhighhistorymillionorganizationphysicalradiationreplacementreviewrisksupply
SHARED TOKENS (23): "age", "beyond", "change", "children", "clinical", "date", "diagnosis", "disease", "early", "family", "high", "history", "million", "organization", "physical", "radiation", "replacement", "review", "risk", "supply".... | EXACT TITLE in healthcare: "Breast cancer".
0.500
Psychology ↗ Q9418 EXACT TITLE
behaviorbehavioralclinicalcounselingeducationfamilygroupgroupshospitalsindividualpracticingprofessionalrelatedrelationshipsresearchschoolsocialstudytherapeutictreatment
SHARED TOKENS (22): "behavior", "behavioral", "clinical", "counseling", "education", "family", "group", "groups", "hospitals", "individual", "practicing", "professional", "related", "relationships", "research", "school", "social", "study", "therapeutic", "treatment".... | EXACT TITLE in healthcare: "Psychology".
0.500
Urology ↗ Q105650 EXACT TITLE
additionalclinicalcompetitiveconditionsemploymentequipmentfocusedgeneralgraduatesinjurymajormanagementmedicinemultiplepediatricpractitionersproceduresprogramrelatedresidency
SHARED TOKENS (26): "additional", "clinical", "competitive", "conditions", "employment", "equipment", "focused", "general", "graduates", "injury", "major", "management", "medicine", "multiple", "pediatric", "practitioners", "procedures", "program", "related", "residency".... | EXACT TITLE in healthcare: "Urology".
0.500
Concussion ↗ Q326921 EXACT TITLE
adultsapproachesbehavioralbloodchildrenconcentrationconditionsdirectdiseasehistoryimaginginformationinjurylevelorganizedphysicalpracticeproviderqualifiedrecovery
SHARED TOKENS (34): "adults", "approaches", "behavioral", "blood", "children", "concentration", "conditions", "direct", "disease", "history", "imaging", "information", "injury", "level", "organized", "physical", "practice", "provider", "qualified", "recovery".... | EXACT TITLE in healthcare: "Concussion".
0.500
additionalageannualcentersdiseasefederalgovernmentgrouphealthcarehospitalinsurancelong-termmedicaidmillionpatientsplanplansprescriptionprivateprogram
SHARED TOKENS (24): "additional", "age", "annual", "centers", "disease", "federal", "government", "group", "healthcare", "hospital", "insurance", "long-term", "medicaid", "million", "patients", "plan", "plans", "prescription", "private", "program".... | EXACT TITLE in healthcare: "Medicare (United States)".
0.500
Pathology ↗ Q7208 EXACT TITLE
analysisclinicalconditionsdiagnosisdiseasegeneralmajororalphysicalpracticepracticingresearchsignificantspecialtystructuralstudysystemstreatment
SHARED TOKENS (18): "analysis", "clinical", "conditions", "diagnosis", "disease", "general", "major", "oral", "physical", "practice", "practicing", "research", "significant", "specialty", "structural", "study", "systems", "treatment". | EXACT TITLE in healthcare: "Pathology".
0.500
ageassociationemergencyfacilitygrouphomehospitalinjuryinsurancelong-termneedneedsoccupationalpatientsphysicalprivatepublicrequireresidentialresidents
SHARED TOKENS (24): "age", "association", "emergency", "facility", "group", "home", "hospital", "injury", "insurance", "long-term", "need", "needs", "occupational", "patients", "physical", "private", "public", "require", "residential", "residents".... | EXACT TITLE in healthcare: "Nursing home".
0.500
againstaveragechildrencurrentdentaldentistdigitalexperiencemodelpatientpatientspublishedreviewsystemsteethtreatment
SHARED TOKENS (16): "against", "average", "children", "current", "dental", "dentist", "digital", "experience", "model", "patient", "patients", "published", "review", "systems", "teeth", "treatment". | EXACT TITLE in dental: "Clear aligners".
0.500
appointmentcosmeticcoveringcrownsdentaldentistdentistryexpansioninsideneededpatientstechnologyteethtreatmentvisible
SHARED TOKENS (15): "appointment", "cosmetic", "covering", "crowns", "dental", "dentist", "dentistry", "expansion", "inside", "needed", "patients", "technology", "teeth", "treatment", "visible". | EXACT TITLE in dental: "Crown (dental restoration)". | EXACT TITLE in healthcare: "Crown (dental restoration)".
0.500
adaadultboardboisecampuscanyoncollegecommunitycomprehensivecountieseducationgovernedidahonampanorthpopulationprimaryprogramspublicreported
SHARED TOKENS (27): "ada", "adult", "board", "boise", "campus", "canyon", "college", "community", "comprehensive", "counties", "education", "governed", "idaho", "nampa", "north", "population", "primary", "programs", "public", "reported".... | EXACT TITLE in dental: "College of Western Idaho".
0.500
Hospital ↗ Q16917 EXACT TITLE
additionalalliedcampuscentercenterschildrenclinicdepartmentdirectemergencyequipmentestablishedfacilityfoundedfundinggeneralgovernmentgraduateshealthcarehome
SHARED TOKENS (58): "additional", "allied", "campus", "center", "centers", "children", "clinic", "department", "direct", "emergency", "equipment", "established", "facility", "founded", "funding", "general", "government", "graduates", "healthcare", "home".... | EXACT TITLE in dental: "Hospital". | EXACT TITLE in healthcare: "Hospital".
0.480
communitycomprehensivediseasefamilygeneralindividualmedicineorganizationpatientpracticeprimaryschoolspecialtyspecific
SHARED TOKENS (14): "community", "comprehensive", "disease", "family", "general", "individual", "medicine", "organization", "patient", "practice", "primary", "school", "specialty", "specific". | EXACT TITLE in healthcare: "Family medicine".
0.480
Oncology ↗ Q162555 EXACT TITLE
clinicaldiagnosisfocusedmedicinemonitoringpediatricprofessionalradiationresearchspecialtystudysurgerytherapytreatment
SHARED TOKENS (14): "clinical", "diagnosis", "focused", "medicine", "monitoring", "pediatric", "professional", "radiation", "research", "specialty", "study", "surgery", "therapy", "treatment". | EXACT TITLE in healthcare: "Oncology".
0.480
Zoning ↗ Q702232 EXACT TITLE
buildingdefinedexceptionsgovernmentguidelandlocalpolicyregulatoryresidentialrulesscalesystemsurban
SHARED TOKENS (14): "building", "defined", "exceptions", "government", "guide", "land", "local", "policy", "regulatory", "residential", "rules", "scale", "systems", "urban". | EXACT TITLE in dental: "Zoning".
0.480
additionaldiagnosishistorymedicineneededpointprimaryresearchresidencyschoolspecialtysurgerytherapytreatment
SHARED TOKENS (14): "additional", "diagnosis", "history", "medicine", "needed", "point", "primary", "research", "residency", "school", "specialty", "surgery", "therapy", "treatment". | EXACT TITLE in healthcare: "Ophthalmology".
0.480
additionaladultsageaveragebehavioraldiagnosisdirectdirectlyindividualmillionoperatingphysicalqualifiedrelated
SHARED TOKENS (14): "additional", "adults", "age", "average", "behavioral", "diagnosis", "direct", "directly", "individual", "million", "operating", "physical", "qualified", "related". | EXACT TITLE in healthcare: "Substance use disorder".
0.460
concentrationdeliverydentaldentisthighmarketproductsprofessionalreportedsaltsystemstherapywestern
SHARED TOKENS (13): "concentration", "delivery", "dental", "dentist", "high", "market", "products", "professional", "reported", "salt", "systems", "therapy", "western". | EXACT TITLE in dental: "Fluoride varnish".
0.460
boardcentersclinicsemergencyfederalfoundedhealthcarehospitalhospitalsoperatedsitessurgeryurgent
SHARED TOKENS (13): "board", "centers", "clinics", "emergency", "federal", "founded", "healthcare", "hospital", "hospitals", "operated", "sites", "surgery", "urgent". | EXACT TITLE in healthcare: "HCA Healthcare".
0.440
diagnosisdiseasegeneralimaginglocaloralproductsradiationregionalrisksurgerytherapy
SHARED TOKENS (12): "diagnosis", "disease", "general", "imaging", "local", "oral", "products", "radiation", "regional", "risk", "surgery", "therapy". | EXACT TITLE in healthcare: "Oral cancer".
0.440
appointmentchildrendefineddentaldentistrylevelpatientproceduresprofessionalsystemthroughouttreatment
SHARED TOKENS (12): "appointment", "children", "defined", "dental", "dentistry", "level", "patient", "procedures", "professional", "system", "throughout", "treatment". | EXACT TITLE in dental: "Sedation dentistry".
0.440
Cardiology ↗ Q10379 EXACT TITLE
diagnosisdiseasegeneralinternalmedicinepediatricspecialtystudysurgeonssurgerysystemtreatment
SHARED TOKENS (12): "diagnosis", "disease", "general", "internal", "medicine", "pediatric", "specialty", "study", "surgeons", "surgery", "system", "treatment". | EXACT TITLE in healthcare: "Cardiology".
0.440
associationcoveragedentalgroupsindependentinsurancemembermembersmillionnetworkoperatingplans
SHARED TOKENS (12): "association", "coverage", "dental", "groups", "independent", "insurance", "member", "members", "million", "network", "operating", "plans". | EXACT TITLE in dental: "Delta Dental".
0.440
alliedmedicinephysicalpractitionersprimaryrecognizedrelatedspecialistsspecialtystandardstreatmentwork
SHARED TOKENS (12): "allied", "medicine", "physical", "practitioners", "primary", "recognized", "related", "specialists", "specialty", "standards", "treatment", "work". | EXACT TITLE in healthcare: "Sports medicine".
0.440
agenciesbusinesschildrenhealthcareincomelegalorganizationpatientsproductsprovidersreducedscale
SHARED TOKENS (12): "agencies", "business", "children", "healthcare", "income", "legal", "organization", "patients", "products", "providers", "reduced", "scale". | EXACT TITLE in healthcare: "Sliding scale fees".
0.420
additionalbloodconditionsdiseaselevellong-termpatientreplacementsurgeonssurgerysystems
SHARED TOKENS (11): "additional", "blood", "conditions", "disease", "level", "long-term", "patient", "replacement", "surgeons", "surgery", "systems". | EXACT TITLE in healthcare: "Spinal fusion".
0.420
boisechamberdatagovernmentidaholegislaturemembersnorthpopulationresidentswashington
SHARED TOKENS (11): "boise", "chamber", "data", "government", "idaho", "legislature", "members", "north", "population", "residents", "washington". | EXACT TITLE in dental: "Idaho Legislature". | EXACT TITLE in healthcare: "Idaho Legislature".
0.420
analysisbuildingcreatingdigitalinformationmajorproductsresearchsoftwarespacesystems
SHARED TOKENS (11): "analysis", "building", "creating", "digital", "information", "major", "products", "research", "software", "space", "systems". | EXACT TITLE in dental: "Computer-aided design".
0.420
associationcosmeticdentaldentistryeducationexperiencepatientsspecialtyspecificteethwork
SHARED TOKENS (11): "association", "cosmetic", "dental", "dentistry", "education", "experience", "patients", "specialty", "specific", "teeth", "work". | EXACT TITLE in dental: "Cosmetic dentistry".
0.400
Dentist ↗ Q27349 EXACT TITLE
dentaldentistdentistryfocusedmedicineoralprofessionalprovidingteeththerapists
SHARED TOKENS (10): "dental", "dentist", "dentistry", "focused", "medicine", "oral", "professional", "providing", "teeth", "therapists". | EXACT TITLE in dental: "Dentist". | EXACT TITLE in healthcare: "Dentist".
0.400
counselingdiseaseeducationfamiliesfamilymanagementmedicineresourcesrisksupport
SHARED TOKENS (10): "counseling", "disease", "education", "families", "family", "management", "medicine", "resources", "risk", "support". | EXACT TITLE in healthcare: "Genetic counseling".
0.390
boisecenterclinicsemployeesfoundedhealthcarehospitalhospitalsidahoreceivedregionalsystem
SHARED TOKENS (12): "boise", "center", "clinics", "employees", "founded", "healthcare", "hospital", "hospitals", "idaho", "received", "regional", "system". | URL->B (1): https://www.stlukesonline.org/.
0.380
Radiography ↗ Q245341 EXACT TITLE
digitalimaginginformationinternalpointproducedradiationstructuraltherapeutic
SHARED TOKENS (9): "digital", "imaging", "information", "internal", "point", "produced", "radiation", "structural", "therapeutic". | EXACT TITLE in dental: "Radiography".
0.380
dentaldentistgroupsmemberspatientprovidingsupporttherapiststreatment
SHARED TOKENS (9): "dental", "dentist", "groups", "members", "patient", "providing", "support", "therapists", "treatment". | EXACT TITLE in dental: "Dental assistant".
0.380
adultadultsagechildrenhospitalhospitalsinternalmedicinepediatric
SHARED TOKENS (9): "adult", "adults", "age", "children", "hospital", "hospitals", "internal", "medicine", "pediatric". | EXACT TITLE in healthcare: "Children's hospital".
0.380
Massage ↗ Q179415 EXACT TITLE
clinicalindustryintegrationlong-termpointprofessionalstructuraltherapiststreatment
SHARED TOKENS (9): "clinical", "industry", "integration", "long-term", "point", "professional", "structural", "therapists", "treatment". | EXACT TITLE in healthcare: "Massage".
0.380
barriersdentaldentistryfinancialmanagementofficesorganizationprovidersupport
SHARED TOKENS (9): "barriers", "dental", "dentistry", "financial", "management", "offices", "organization", "provider", "support". | EXACT TITLE in dental: "Aspen Dental".
0.380
generallongermobilityphysicalrecoveryreplacementreturnrisksurgery
SHARED TOKENS (9): "general", "longer", "mobility", "physical", "recovery", "replacement", "return", "risk", "surgery". | EXACT TITLE in healthcare: "Knee replacement".
0.380
conditionsdiseasefocusedmedicinesmallspecialtystudysystemthroughout
SHARED TOKENS (9): "conditions", "disease", "focused", "medicine", "small", "specialty", "study", "system", "throughout". | EXACT TITLE in healthcare: "Gastroenterology".
0.380
Farmworker ↗ Q5060555 EXACT TITLE
conditionslaborlaworganizedrelatedtechnologyvalleyworkworking
SHARED TOKENS (9): "conditions", "labor", "law", "organized", "related", "technology", "valley", "work", "working". | EXACT TITLE in healthcare: "Farmworker".
0.380
clinicscombinedhealthcarehospitalsidahoorganizationsaltsystemwestern
SHARED TOKENS (9): "clinics", "combined", "healthcare", "hospitals", "idaho", "organization", "salt", "system", "western". | EXACT TITLE in healthcare: "Intermountain Health".
0.360
Naloxone ↗ Q282902 EXACT TITLE
competitivedatadiseasemedicationorganizationsafetysmallsystem
SHARED TOKENS (8): "competitive", "data", "disease", "medication", "organization", "safety", "small", "system". | EXACT TITLE in healthcare: "Naloxone".
0.360
accreditationassociationcommissionlicensuremedicaidnonprofitorganizationprograms
SHARED TOKENS (8): "accreditation", "association", "commission", "licensure", "medicaid", "nonprofit", "organization", "programs". | EXACT TITLE in healthcare: "Joint Commission".
0.360
dentaldiseaseenvironmentoralperiodontalproceduresspacesurgery
SHARED TOKENS (8): "dental", "disease", "environment", "oral", "periodontal", "procedures", "space", "surgery". | EXACT TITLE in dental: "Periodontal surgery".
0.360
Credit ↗ Q182076 EXACT TITLE
consumerdatefinancialgroupimmediatelyresourcesreturntrust
SHARED TOKENS (8): "consumer", "date", "financial", "group", "immediately", "resources", "return", "trust". | EXACT TITLE in dental: "Credit". | EXACT TITLE in healthcare: "Credit".
0.360
Aerosol ↗ Q104541 EXACT TITLE
behaviorconsumerenvironmenthighsignificantsmallsystemvisible
SHARED TOKENS (8): "behavior", "consumer", "environment", "high", "significant", "small", "system", "visible". | EXACT TITLE in dental: "Aerosol".
0.340
businessconsolidationdefinedentitiesfinancialgrouptreatment
SHARED TOKENS (7): "business", "consolidation", "defined", "entities", "financial", "group", "treatment". | EXACT TITLE in dental: "Consolidation (business)". | EXACT TITLE in healthcare: "Consolidation (business)".
0.340
diseaseneedspatientplanspracticeprovidertreatment
SHARED TOKENS (7): "disease", "needs", "patient", "plans", "practice", "provider", "treatment". | EXACT TITLE in healthcare: "Nurse practitioner".
0.340
adultchildrencreatingdentalriskteethtreatment
SHARED TOKENS (7): "adult", "children", "creating", "dental", "risk", "teeth", "treatment". | EXACT TITLE in dental: "Dental sealant".
0.340
datadigitaldirectlyimmediatelypatientradiationsystem
SHARED TOKENS (7): "data", "digital", "directly", "immediately", "patient", "radiation", "system". | EXACT TITLE in dental: "Digital radiography".
0.330
boisebuildinggrouphospitalidahonationalsmallstreetwashington
SHARED TOKENS (9): "boise", "building", "group", "hospital", "idaho", "national", "small", "street", "washington". | URL->B (1): https://www.saintalphonsus.org/.
0.320
conditionsmanagementspecialtysurgerysystemtreatment
SHARED TOKENS (6): "conditions", "management", "specialty", "surgery", "system", "treatment". | EXACT TITLE in healthcare: "Neurosurgery".
0.320
federallyidahoinsurancemarketplaceorganizationsmall
SHARED TOKENS (6): "federally", "idaho", "insurance", "marketplace", "organization", "small". | EXACT TITLE in healthcare: "Your Health Idaho".
0.320
departmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (6): "department", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in dental: "Idaho Department of Labor".
0.320
Dentures ↗ Q143567 EXACT TITLE
dentaldenturedenturesimplantsoralteeth
SHARED TOKENS (6): "dental", "denture", "dentures", "implants", "oral", "teeth". | EXACT TITLE in dental: "Dentures". | EXACT TITLE in healthcare: "Dentures".
0.300
againstassociationboardcodecodescurrentdataeducationestablishedfoundedgovernedgroupinsurancelicensingmanagementmedicinemembershiporganizationpracticeprofessional
SHARED TOKENS (30): "against", "association", "board", "code", "codes", "current", "data", "education", "established", "founded", "governed", "group", "insurance", "licensing", "management", "medicine", "membership", "organization", "practice", "professional"....
0.300
boardcommunitiesdentaldepartmentdivisioneducationgovernmentinsurancemembersnationalprimaryprofessionalsprogramprovidersprovidingrequirementresidencyresourcesschoolspecialty
SHARED TOKENS (25): "board", "communities", "dental", "department", "division", "education", "government", "insurance", "members", "national", "primary", "professionals", "program", "providers", "providing", "requirement", "residency", "resources", "school", "specialty"....
0.300
annualchildrendemanddentaldentistdentistrydiseaseearlyeducationgenerallocalneedsoralprogramprogramspublicreachresourcesschoolspecialty
SHARED TOKENS (21): "annual", "children", "demand", "dental", "dentist", "dentistry", "disease", "early", "education", "general", "local", "needs", "oral", "program", "programs", "public", "reach", "resources", "school", "specialty"....
0.300
actagenciesalliedbusinesscertifiedemployershealthcarehospitalsindependentneedpracticeprofessionalprofessionalsstaffsupportthroughoutwork
SHARED TOKENS (17): "act", "agencies", "allied", "business", "certified", "employers", "healthcare", "hospitals", "independent", "need", "practice", "professional", "professionals", "staff", "support", "throughout", "work".
0.300
againstageconsumerearlyfederalincomeindividualjanuaryneededpatientplanplansprescriptionqualifiedrequirementsettingstandardsystemtreatment
SHARED TOKENS (19): "against", "age", "consumer", "early", "federal", "income", "individual", "january", "needed", "patient", "plan", "plans", "prescription", "qualified", "requirement", "setting", "standard", "system", "treatment".
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actdeliveryearlygrouphealthcarehighinsurancemanagementorganizationpatientsprivateprogramsproviderprovidersprovidingspecificsurgerysystem
SHARED TOKENS (18): "act", "delivery", "early", "group", "healthcare", "high", "insurance", "management", "organization", "patients", "private", "programs", "provider", "providers", "providing", "specific", "surgery", "system".
0.300
Immunotherapy ↗ Q1427096 KW CROSS HIGH
activeagainstapproachesbeyondclinicalconditionsdiseaseguidelandscapelicensedmedicinepatientsreportedstudysystemtherapeutictherapytreatmentwork
SHARED TOKENS (19): "active", "against", "approaches", "beyond", "clinical", "conditions", "disease", "guide", "landscape", "licensed", "medicine", "patients", "reported", "study", "system", "therapeutic", "therapy", "treatment", "work".
0.300
adultblooddiagnosisequipmentfullfunctiongroupimagingindividualinjurylevellong-termmajoroccupationalphysicalrecoveryrequireresearchsafetysupport
SHARED TOKENS (23): "adult", "blood", "diagnosis", "equipment", "full", "function", "group", "imaging", "individual", "injury", "level", "long-term", "major", "occupational", "physical", "recovery", "require", "research", "safety", "support"....
0.300
accreditationaccreditedadultboardcommissiondentaldentistdentistryeligibilityexpandedfullgeneralhighinjectionmanagementmonitoringpatientpediatricproceduresprofile
SHARED TOKENS (33): "accreditation", "accredited", "adult", "board", "commission", "dental", "dentist", "dentistry", "eligibility", "expanded", "full", "general", "high", "injection", "management", "monitoring", "patient", "pediatric", "procedures", "profile"....
0.300
actageblooddatadetectiondiagnosisearlyfamilygroupshistoryimagingpopulationprovidingrisktreatmentuniversal
SHARED TOKENS (16): "act", "age", "blood", "data", "detection", "diagnosis", "early", "family", "groups", "history", "imaging", "population", "providing", "risk", "treatment", "universal".
0.300
additionalalongsideclinicaleducationgraduatesmedicineoperatingpracticepracticingprogramprogramsresidencyschoolstudentsstudysurgerysystem
SHARED TOKENS (17): "additional", "alongside", "clinical", "education", "graduates", "medicine", "operating", "practice", "practicing", "program", "programs", "residency", "school", "students", "study", "surgery", "system".
0.300
averageimplantspatientreplacementsurgery
SHARED TOKENS (5): "average", "implants", "patient", "replacement", "surgery". | EXACT TITLE in healthcare: "Hip replacement".
0.300
agenciescentersclinicaldepartmentdiagnosisfamiliesfundinggrantsinformationnationalnetworkpatientsprogramprogramsrelatedresearchtreatment
SHARED TOKENS (17): "agencies", "centers", "clinical", "department", "diagnosis", "families", "funding", "grants", "information", "national", "network", "patients", "program", "programs", "related", "research", "treatment".
0.300
actagainstchildrencoveragecoveringentireexpansionfederalfinancialgovernmenthelpsinsurancelong-termmajormedicaidmillionneedsplanspopulationprivate
SHARED TOKENS (34): "act", "against", "children", "coverage", "covering", "entire", "expansion", "federal", "financial", "government", "helps", "insurance", "long-term", "major", "medicaid", "million", "needs", "plans", "population", "private"....
0.300
accessagechildrencountiesdecemberdeliveryearlyestablishedexplicitlyfederalfederallyframeworkindividuallawlegalmedicationorganizationpatientproviderssupport
SHARED TOKENS (21): "access", "age", "children", "counties", "december", "delivery", "early", "established", "explicitly", "federal", "federally", "framework", "individual", "law", "legal", "medication", "organization", "patient", "providers", "support"....
0.300
conditionsdatademanddentaldentistrydetectiondiagnosisearlyidentifyimagingmanagementofficesoralpatientperformanceperiodontalpointpracticeregionresearch
SHARED TOKENS (25): "conditions", "data", "demand", "dental", "dentistry", "detection", "diagnosis", "early", "identify", "imaging", "management", "offices", "oral", "patient", "performance", "periodontal", "point", "practice", "region", "research"....
0.300
Lung cancer ↗ Q47912 KW CROSS HIGH
agealongsideaveragediagnosisdiseaseearlyexperiencefunctionimagingmillionnationalradiationremainingspecificsurgerytherapythroughouttreatment
SHARED TOKENS (18): "age", "alongside", "average", "diagnosis", "disease", "early", "experience", "function", "imaging", "million", "national", "radiation", "remaining", "specific", "surgery", "therapy", "throughout", "treatment".
0.300
actannualcertifiedemergencyemployeesemployeremployersentitiesfederallyfeegrouphealthcarehospitalsinsuranceoptionsorganizationpatientsplansprofessionalsprovider
SHARED TOKENS (21): "act", "annual", "certified", "emergency", "employees", "employer", "employers", "entities", "federally", "fee", "group", "healthcare", "hospitals", "insurance", "options", "organization", "patients", "plans", "professionals", "provider"....
0.300
accessconditionsdefineddiseaseemploymentfamilygroupslevelmajormillionorganizationphysicalpopulationrecordsrelatedrisksocialwestern
SHARED TOKENS (18): "access", "conditions", "defined", "disease", "employment", "family", "groups", "level", "major", "million", "organization", "physical", "population", "records", "related", "risk", "social", "western".
0.300
Psychotherapy ↗ Q183257 KW CROSS HIGH
adultsapproachesbehaviorchangechildrenclinicalconditionsfamiliesfamilygeneralgroupshighindividualindividualizedlicensedprofessionalprofessionalsrelationshipsresearchreview
SHARED TOKENS (29): "adults", "approaches", "behavior", "change", "children", "clinical", "conditions", "families", "family", "general", "groups", "high", "individual", "individualized", "licensed", "professional", "professionals", "relationships", "research", "review"....
0.300
Sleep medicine ↗ Q744029 KW CROSS HIGH
boardclinicsdefineddentaldiagnosisdirectlydivisionestablishedhospitalmedicinemembernationalorganizedpatientspracticingprogramsrecognizedrelatedresearchsafety
SHARED TOKENS (29): "board", "clinics", "defined", "dental", "diagnosis", "directly", "division", "established", "hospital", "medicine", "member", "national", "organized", "patients", "practicing", "programs", "recognized", "related", "research", "safety"....
0.300
actadditionalageconditionscoveragedeliverydemographiceducationeligibilityemployerexpandedexpansionfederalfundinghealthcareincomeindividualinsurancelawlegal
SHARED TOKENS (38): "act", "additional", "age", "conditions", "coverage", "delivery", "demographic", "education", "eligibility", "employer", "expanded", "expansion", "federal", "funding", "healthcare", "income", "individual", "insurance", "law", "legal"....
0.300
Roe v. Wade ↗ Q300950 KW CROSS HIGH
againstcommunitycompetingearlyfederalframeworkgovernmenthistoryjanuarylegallevellocalorganizationpointreviewstandard
SHARED TOKENS (16): "against", "community", "competing", "early", "federal", "framework", "government", "history", "january", "legal", "level", "local", "organization", "point", "review", "standard".
0.300
centercliniccurrentdirecteducationenvironmenthospitalhospitalsmedicinepracticeprofessionalsprogramprogramsprovidingqualifiedresidencysettingspecialtysuperviseduniversity
SHARED TOKENS (20): "center", "clinic", "current", "direct", "education", "environment", "hospital", "hospitals", "medicine", "practice", "professionals", "program", "programs", "providing", "qualified", "residency", "setting", "specialty", "supervised", "university".
0.300
activecapacitycapitalcurrentdatademanddirectfacilitygovernmentgraduateshealthcareincomelaborlevellicensedlocalmarketmedicinemillionneed
SHARED TOKENS (36): "active", "capacity", "capital", "current", "data", "demand", "direct", "facility", "government", "graduates", "healthcare", "income", "labor", "level", "licensed", "local", "market", "medicine", "million", "need"....
0.300
accessanalysisbehaviorclinicalcommunitiescomplianceconditionsdeliverydepartmentdetectionearlyemergencyhealthcarehomehospitalindividualindustryinformationmaintainmanagement
SHARED TOKENS (32): "access", "analysis", "behavior", "clinical", "communities", "compliance", "conditions", "delivery", "department", "detection", "early", "emergency", "healthcare", "home", "hospital", "individual", "industry", "information", "maintain", "management"....
0.300
adultsageapproachesconditionsdiseasegeneralgroupindexlong-termlongermanagementphysicalpointprimaryproceduresreceivedrelatedrisksignificantspecific
SHARED TOKENS (23): "adults", "age", "approaches", "conditions", "disease", "general", "group", "index", "long-term", "longer", "management", "physical", "point", "primary", "procedures", "received", "related", "risk", "significant", "specific"....
0.300
additionalapproachesbehavioralclinicalidentifyinjurylong-termmanagementmedicineoccupationalphysicalpracticepractitionersproceduresprofessionalsspecialistsspecialtyspecificsupporttherapists
SHARED TOKENS (22): "additional", "approaches", "behavioral", "clinical", "identify", "injury", "long-term", "management", "medicine", "occupational", "physical", "practice", "practitioners", "procedures", "professionals", "specialists", "specialty", "specific", "support", "therapists"....
0.300
Biomedical waste ↗ KW CROSS HIGH
bloodclinicalclinicsdiagnosisemergencyenvironmentgeneralhealthcarehomehospitalhospitalsinjuryofficesoperatingrequireresearchtreatmentuniversal
SHARED TOKENS (18): "blood", "clinical", "clinics", "diagnosis", "emergency", "environment", "general", "healthcare", "home", "hospital", "hospitals", "injury", "offices", "operating", "require", "research", "treatment", "universal".
0.300
Mammography ↗ Q324634 KW CROSS HIGH
additionalagechangecollegedetectiondiagnosisearlyequipmentimagingpatientspointradiationsignificantsmallsurgery
SHARED TOKENS (15): "additional", "age", "change", "college", "detection", "diagnosis", "early", "equipment", "imaging", "patients", "point", "radiation", "significant", "small", "surgery".
0.300
Stark Law ↗ Q7601961 KW CROSS HIGH
clinicalemploymentequipmentexceptionsfamilyfederalfinancialhomehospitalimaginginitiallawmedicaidmemberoccupationalofficepatientphysicalplanprescription
SHARED TOKENS (24): "clinical", "employment", "equipment", "exceptions", "family", "federal", "financial", "home", "hospital", "imaging", "initial", "law", "medicaid", "member", "occupational", "office", "patient", "physical", "plan", "prescription"....
0.300
againstcurrentmajorpatientstreatment
SHARED TOKENS (5): "against", "current", "major", "patients", "treatment". | EXACT TITLE in healthcare: "Transcranial magnetic stimulation".
0.300
accessagainstannouncedbloodchildrencommunitiesdepartmentexperiencefederalfinancialgovernmentintegratednorthofficesprimaryprofessionalsprogramprogramsprovidersresources
SHARED TOKENS (24): "access", "against", "announced", "blood", "children", "communities", "department", "experience", "federal", "financial", "government", "integrated", "north", "offices", "primary", "professionals", "program", "programs", "providers", "resources"....
0.300
bloodcentersclinicalclinicscomprehensivediagnosisdiseasehospitalsindependentinformationlong-termmanagementofficespatientresearchtreatment
SHARED TOKENS (16): "blood", "centers", "clinical", "clinics", "comprehensive", "diagnosis", "disease", "hospitals", "independent", "information", "long-term", "management", "offices", "patient", "research", "treatment".
0.300
Charity care ↗ Q5074539 KW CROSS HIGH
competitiondemandfederalfinancialfreegovernmenthospitalsinsurancelow-incomemaintainmedicaidpatientspracticeprimaryprogramsprovidersprovidingreducedsupportuninsured
SHARED TOKENS (20): "competition", "demand", "federal", "financial", "free", "government", "hospitals", "insurance", "low-income", "maintain", "medicaid", "patients", "practice", "primary", "programs", "providers", "providing", "reduced", "support", "uninsured".
0.300
actadministerscenterschildrenclinicaldepartmentfederalgovhealthcarehomeinsurancelong-termmedicaidpartnershipprogramprogramsstandardsstarsystemworks
SHARED TOKENS (20): "act", "administers", "centers", "children", "clinical", "department", "federal", "gov", "healthcare", "home", "insurance", "long-term", "medicaid", "partnership", "program", "programs", "standards", "star", "system", "works".
0.300
actadditionalcertifieddecemberemployeesenrollmentfederalinsurancejanuarylawmarketplacemedicaidmillionoperationalpatientplansprivatesmall
SHARED TOKENS (18): "act", "additional", "certified", "december", "employees", "enrollment", "federal", "insurance", "january", "law", "marketplace", "medicaid", "million", "operational", "patient", "plans", "private", "small".
0.300
businessentitiesgeneralgroupsidentifylawlegallicensedmultipleorganizedownerpartnershippracticeprofessionalprofessionalspublicstatutes
SHARED TOKENS (17): "business", "entities", "general", "groups", "identify", "law", "legal", "licensed", "multiple", "organized", "owner", "partnership", "practice", "professional", "professionals", "public", "statutes".
0.300
againstassociationfoundedfreegovernmentgrouphospitalhospitalsindustryinsurancelow-incomeofficesorganizationpatientsproviderspublicwashington
SHARED TOKENS (17): "against", "association", "founded", "free", "government", "group", "hospital", "hospitals", "industry", "insurance", "low-income", "offices", "organization", "patients", "providers", "public", "washington".
0.300
accessdatadentaldentistrydiagnosisdigitalimagingintegratedoralpatientradiationregionsoftwarestandardsurgerytechnologytherapytreatmentverification
SHARED TOKENS (19): "access", "data", "dental", "dentistry", "diagnosis", "digital", "imaging", "integrated", "oral", "patient", "radiation", "region", "software", "standard", "surgery", "technology", "therapy", "treatment", "verification".
0.300
additionalalliedcentersclinicalcollegecommunitiescommunitycomprehensiveconditionsconnectdeliverydetectiondiseaseearlyeducationemergencyentitiesexperiencefamiliesfamily
SHARED TOKENS (51): "additional", "allied", "centers", "clinical", "college", "communities", "community", "comprehensive", "conditions", "connect", "delivery", "detection", "disease", "early", "education", "emergency", "entities", "experience", "families", "family"....
0.300
Acupuncture ↗ Q121713 KW CROSS HIGH
approachesclaimsconditionsearlyhealthcareindustrylongermajormarketmedicinepractitionerspublishedreachreportedreviewreviewsrisksupportsystemsystems
SHARED TOKENS (22): "approaches", "claims", "conditions", "early", "healthcare", "industry", "longer", "major", "market", "medicine", "practitioners", "published", "reach", "reported", "review", "reviews", "risk", "support", "system", "systems"....
0.300
conditionsdiagnosisdiseaseearlygeneralimaginginsideinternallocalpatientpracticingprimaryproceduresprovidingradiationrelativeriskspecialtysurgerytherapeutic
SHARED TOKENS (23): "conditions", "diagnosis", "disease", "early", "general", "imaging", "inside", "internal", "local", "patient", "practicing", "primary", "procedures", "providing", "radiation", "relative", "risk", "specialty", "surgery", "therapeutic"....
0.300
additionalclinicalcomprehensivecrownsdentaldentistrydigitaldiseasefullimagingneedsoralpatientperiodontalradiationreachreceivedreducedrequiresmall
SHARED TOKENS (22): "additional", "clinical", "comprehensive", "crowns", "dental", "dentistry", "digital", "disease", "full", "imaging", "needs", "oral", "patient", "periodontal", "radiation", "reach", "received", "reduced", "require", "small"....
0.300
accessassociationcenterclaimscoverageemployeesfederalfoundedgovernmentindependentinsurancelicenseslocallymanagesmembersmillionnetworkoperatedoperatesoperating
SHARED TOKENS (26): "access", "association", "center", "claims", "coverage", "employees", "federal", "founded", "government", "independent", "insurance", "licenses", "locally", "manages", "members", "million", "network", "operated", "operates", "operating"....
0.300
actdirectlyeligibilityemployerestablishedexpansionfamiliesfederalgovernmenthighincomeinsurancelawlevelmedicaidmillionplanprivateprovisionsreceived
SHARED TOKENS (21): "act", "directly", "eligibility", "employer", "established", "expansion", "families", "federal", "government", "high", "income", "insurance", "law", "level", "medicaid", "million", "plan", "private", "provisions", "received"....
0.300
Immunization ↗ Q1415366 KW CROSS HIGH
activeadultsagainstchildrendirectdiseasefunctionhelpsindividualmajorprofessionalspublicrisksystemsystemstherapeuticthroughout
SHARED TOKENS (17): "active", "adults", "against", "children", "direct", "disease", "function", "helps", "individual", "major", "professionals", "public", "risk", "system", "systems", "therapeutic", "throughout".
0.300
actadultscentercomprehensivedefineddepartmenteducationfamiliesfamilyfederalgovernmenthighhousingincomemedicaidmillionnationalpolicypopulationprogram
SHARED TOKENS (29): "act", "adults", "center", "comprehensive", "defined", "department", "education", "families", "family", "federal", "government", "high", "housing", "income", "medicaid", "million", "national", "policy", "population", "program"....
0.300
clinicsdirectlyearlyemergencygeneralhospitalinternalmedicinemodelpatientspracticepractitionersprimaryprogramsprovidersprovidingqualifiedrecognizedresourcesspecialists
SHARED TOKENS (25): "clinics", "directly", "early", "emergency", "general", "hospital", "internal", "medicine", "model", "patients", "practice", "practitioners", "primary", "programs", "providers", "providing", "qualified", "recognized", "resources", "specialists"....
0.300
Toothache ↗ Q143925 KW CROSS HIGH
conditionsdemanddentaldiagnosisdiseaseemergencyhelpsmedicinemillionoralperiodontalspecialtysurgeryteethtreatment
SHARED TOKENS (15): "conditions", "demand", "dental", "diagnosis", "disease", "emergency", "helps", "medicine", "million", "oral", "periodontal", "specialty", "surgery", "teeth", "treatment".
0.300
ageclinicaldiseaseestablishedhealthcarehistoryindustryintegratedmedicinemultiplepatientspointpracticeprovidingresearchrisktreatmentworkworks
SHARED TOKENS (19): "age", "clinical", "disease", "established", "healthcare", "history", "industry", "integrated", "medicine", "multiple", "patients", "point", "practice", "providing", "research", "risk", "treatment", "work", "works".
0.300
accessappointmentcenterdepartmentemergencyfacilityhospitalhospitalsinitialmedicinepatientpatientsprimaryrequirestaffingtreatment
SHARED TOKENS (16): "access", "appointment", "center", "department", "emergency", "facility", "hospital", "hospitals", "initial", "medicine", "patient", "patients", "primary", "require", "staffing", "treatment".
0.300
agenciescommunitiesconsumerdentalexpandedgroupshighindividuallevelmillionnationalorganizedpolicypopulationpracticepractitionersprofessionalspublicreceivedresearch
SHARED TOKENS (26): "agencies", "communities", "consumer", "dental", "expanded", "groups", "high", "individual", "level", "million", "national", "organized", "policy", "population", "practice", "practitioners", "professionals", "public", "received", "research"....
0.300
actclinicaldepartmentindividualinformationmanagementnationalneednetworkpdfpopulationrecordsrecoveryreportedtechnologytitlewashington
SHARED TOKENS (17): "act", "clinical", "department", "individual", "information", "management", "national", "need", "network", "pdf", "population", "records", "recovery", "reported", "technology", "title", "washington".
0.300
Neonatology ↗ Q898674 KW CROSS HIGH
clinicalcliniciansconditionsdefineddeliveryfamiliesmedicinemonitoringneedresearchsupporttechnologytherapytreatmentworking
SHARED TOKENS (15): "clinical", "clinicians", "conditions", "defined", "delivery", "families", "medicine", "monitoring", "need", "research", "support", "technology", "therapy", "treatment", "working".
0.300
ageassociationbehavioralclinicianscurrentdiagnosisfamilygrouphistoryhomeindividualjanuarylong-termmedicationmillionphysicalprescriptionprofessionalprofessionalsprograms
SHARED TOKENS (29): "age", "association", "behavioral", "clinicians", "current", "diagnosis", "family", "group", "history", "home", "individual", "january", "long-term", "medication", "million", "physical", "prescription", "professional", "professionals", "programs"....
0.300
clinicalclinicsdirectdiseasehealthcarehospitalsinsidemedicationpatientpatientspharmacypracticepractitionersprofessionalsproviderwork
SHARED TOKENS (16): "clinical", "clinics", "direct", "disease", "healthcare", "hospitals", "inside", "medication", "patient", "patients", "pharmacy", "practice", "practitioners", "professionals", "provider", "work".
0.300
accessadditionalagainstblooddeliverydiagnosisdirectguideimaginginjectioninternalmedicineproceduresradiationreachrecoverysmallspecialtytherapeutictreatment
SHARED TOKENS (20): "access", "additional", "against", "blood", "delivery", "diagnosis", "direct", "guide", "imaging", "injection", "internal", "medicine", "procedures", "radiation", "reach", "recovery", "small", "specialty", "therapeutic", "treatment".
0.300
actactivecenterscombineddepartmentdirectlyemergencyfederalgovernmenthospitalhospitalslaborlawlegalmedicaidpatientpatientsprogramprovisionsstatute
SHARED TOKENS (21): "act", "active", "centers", "combined", "department", "directly", "emergency", "federal", "government", "hospital", "hospitals", "labor", "law", "legal", "medicaid", "patient", "patients", "program", "provisions", "statute"....
0.300
annualclinicclinicscombineddirectlyeducationexpansionfoundedfundinggovernmenthealthcarehistorymedicaidmembermillionnonprofitorganizationpartnerspatientsprovider
SHARED TOKENS (25): "annual", "clinic", "clinics", "combined", "directly", "education", "expansion", "founded", "funding", "government", "healthcare", "history", "medicaid", "member", "million", "nonprofit", "organization", "partners", "patients", "provider"....
0.300
activeagainstageannualearlygroupshistoryindividualinitiallow-incomemillionoralorganizationpracticesignificantsocialstudentsstudywestern
SHARED TOKENS (19): "active", "against", "age", "annual", "early", "groups", "history", "individual", "initial", "low-income", "million", "oral", "organization", "practice", "significant", "social", "students", "study", "western".
0.300
Sleep apnea ↗ Q213600 KW CROSS HIGH
additionalageanalysisbloodcomplianceconcentrationconditionsdiseaseexperiencefamilyfunctiongeneralhighhistoryindexindividuallevellong-termmembermillion
SHARED TOKENS (27): "additional", "age", "analysis", "blood", "compliance", "concentration", "conditions", "disease", "experience", "family", "function", "general", "high", "history", "index", "individual", "level", "long-term", "member", "million"....
0.300
Nephrology ↗ Q177635 KW CROSS HIGH
additionaladultcertifiedconditionsdiseasefunctioninternalmedicationmedicinepediatricreplacementspecialtystudytherapytreatment
SHARED TOKENS (15): "additional", "adult", "certified", "conditions", "disease", "function", "internal", "medication", "medicine", "pediatric", "replacement", "specialty", "study", "therapy", "treatment".
0.300
clinicclinicalenvironmentequipmentfacilityhealthcarehomehospitalhospitalsoperatingpatientproceduressettingstaffsurgerysystem
SHARED TOKENS (16): "clinic", "clinical", "environment", "equipment", "facility", "healthcare", "home", "hospital", "hospitals", "operating", "patient", "procedures", "setting", "staff", "surgery", "system".
0.300
analysiscenterscollectionconsumerdataentitiesexpandedgroupgroupshealthcareindustryinsurancelistedmedicinenationalorganizationpatientpatientspolicyprivate
SHARED TOKENS (26): "analysis", "centers", "collection", "consumer", "data", "entities", "expanded", "group", "groups", "healthcare", "industry", "insurance", "listed", "medicine", "national", "organization", "patient", "patients", "policy", "private"....
0.300
Palliative care ↗ Q29483 KW CROSS HIGH
ageclinicsdefinitionsearlyfamilieshealthcarehomehospitalsmodelneedsoccupationalorganizationpatientpatientsphysicalprogramssocialsupporttherapiststhroughout
SHARED TOKENS (22): "age", "clinics", "definitions", "early", "families", "healthcare", "home", "hospitals", "model", "needs", "occupational", "organization", "patient", "patients", "physical", "programs", "social", "support", "therapists", "throughout"....
0.300
analysisannualclinicalcreatingdatadigitaldiseaseequipmentfunctionidentifyimagingindustryintegratedinternalmillionpatientproceduresradiationtechnology
SHARED TOKENS (19): "analysis", "annual", "clinical", "creating", "data", "digital", "disease", "equipment", "function", "identify", "imaging", "industry", "integrated", "internal", "million", "patient", "procedures", "radiation", "technology".
0.300
boardclinicaldirecthealthcarehospitalintegratedmanagementnetworkoperatingpartnershippartnershipspatientsprofessionalresearchschoolsystem
SHARED TOKENS (16): "board", "clinical", "direct", "healthcare", "hospital", "integrated", "management", "network", "operating", "partnership", "partnerships", "patients", "professional", "research", "school", "system".
0.300
additionalagechildrendiagnosiseducationgeneralincomemanagementmedicinepatientspediatricpopulationsocialstandardsupporttreatment
SHARED TOKENS (16): "additional", "age", "children", "diagnosis", "education", "general", "income", "management", "medicine", "patients", "pediatric", "population", "social", "standard", "support", "treatment".
0.300
councileducationfreehealthcarelicensedlicensingmaintainpracticeprofessionalprogramrecognizedrequirerequirementschoolworkers
SHARED TOKENS (15): "council", "education", "free", "healthcare", "licensed", "licensing", "maintain", "practice", "professional", "program", "recognized", "require", "requirement", "school", "workers".
0.300
againstagebeyonddatedetectiondiagnosisearlyfamilyimagingnationalpartnersprogramspublicradiationreducedresearchrisksurgerysystemtherapy
SHARED TOKENS (21): "against", "age", "beyond", "date", "detection", "diagnosis", "early", "family", "imaging", "national", "partners", "programs", "public", "radiation", "reduced", "research", "risk", "surgery", "system", "therapy"....
0.300
accessageapproachesclinicalcommunityconditionsdiseasedistributioneducationenvironmentfoodsgovernmenthealthcarehighorganizationphysicalpolicypublicregionrelated
SHARED TOKENS (23): "access", "age", "approaches", "clinical", "community", "conditions", "disease", "distribution", "education", "environment", "foods", "government", "healthcare", "high", "organization", "physical", "policy", "public", "region", "related"....
0.300
activeagealongsideaveragebeyondblooddiagnosisdiseasefamilyhighhistoryimagingmillionmonitoringneedprimaryradiationrecognizedrisksites
SHARED TOKENS (24): "active", "age", "alongside", "average", "beyond", "blood", "diagnosis", "disease", "family", "high", "history", "imaging", "million", "monitoring", "need", "primary", "radiation", "recognized", "risk", "sites"....
0.300
actadditionalboardcentercenterschildrendepartmenteducationfederalfundinggovernmenthospitalhospitalsleadslicensuremedicaidmedicinepracticeprogramprograms
SHARED TOKENS (23): "act", "additional", "board", "center", "centers", "children", "department", "education", "federal", "funding", "government", "hospital", "hospitals", "leads", "licensure", "medicaid", "medicine", "practice", "program", "programs"....
0.300
adultboardcertifiedclinicalcliniciansclinicscollegeconditionsdiseaseemergencyequipmentfunctionhealthcarehomehospitalsmanagementmedicinenationalpatientpediatric
SHARED TOKENS (32): "adult", "board", "certified", "clinical", "clinicians", "clinics", "college", "conditions", "disease", "emergency", "equipment", "function", "healthcare", "home", "hospitals", "management", "medicine", "national", "patient", "pediatric"....
0.300
accessactassociationaveragebusinesscomprehensivecoverageearlyeducationemployersestablishedexpansionfederalfullfundinggovernmentgroupshealthcarehighhospital
SHARED TOKENS (39): "access", "act", "association", "average", "business", "comprehensive", "coverage", "early", "education", "employers", "established", "expansion", "federal", "full", "funding", "government", "groups", "healthcare", "high", "hospital"....
0.300
clinicalconditionsdiseasedistributionearlyemployershighinsurancemanagementmarketneednetworkoralpatientpatientspharmacyplansprovidersrelatedspecialty
SHARED TOKENS (21): "clinical", "conditions", "disease", "distribution", "early", "employers", "high", "insurance", "management", "market", "need", "network", "oral", "patient", "patients", "pharmacy", "plans", "providers", "related", "specialty"....
0.300
actadultsbusinesscoverageeligibilityemployerestablishedexpandedexpansionfamilyfederalfundinggovernmenthealthcarehighincomeindependentinsurancemedicaidmillion
SHARED TOKENS (31): "act", "adults", "business", "coverage", "eligibility", "employer", "established", "expanded", "expansion", "family", "federal", "funding", "government", "healthcare", "high", "income", "independent", "insurance", "medicaid", "million"....
0.300
analysisannualbuildingchildrencollectiondiseaseinsidemajormillionmonitoringorganizationphysicalprimaryreducedstudytreatment
SHARED TOKENS (16): "analysis", "annual", "building", "children", "collection", "disease", "inside", "major", "million", "monitoring", "organization", "physical", "primary", "reduced", "study", "treatment".
0.300
adultadultsagecenterdemandfacilitygeneralgroupguidehospitalinjurymeaningfulmodelneedneedsreturnsettingsocialtreatment
SHARED TOKENS (19): "adult", "adults", "age", "center", "demand", "facility", "general", "group", "guide", "hospital", "injury", "meaningful", "model", "need", "needs", "return", "setting", "social", "treatment".
0.300
accessactadditionaladultsannualcenterschildrencomprehensivecoveragedepartmenteligibilityemergencyemployersexpandedexpansionfamiliesfederalgrouphealthcarehigh
SHARED TOKENS (39): "access", "act", "additional", "adults", "annual", "centers", "children", "comprehensive", "coverage", "department", "eligibility", "emergency", "employers", "expanded", "expansion", "families", "federal", "group", "healthcare", "high"....
0.300
Alcoholism ↗ Q15326 KW CROSS HIGH
behavioralclinicaldefinitionsdiagnosisdirectlyenvironmentgroupgroupshighhistoricalindividualinformationlong-termmillionorganizationphysicalrecordsrequirereviewrisk
SHARED TOKENS (26): "behavioral", "clinical", "definitions", "diagnosis", "directly", "environment", "group", "groups", "high", "historical", "individual", "information", "long-term", "million", "organization", "physical", "records", "require", "review", "risk"....
0.300
connectsdeliverydepartmentexpandedhealthcarehospitallocalmonitoringorganizationpatientspracticepublicrelatedsafetysettingstaffsystemunit
SHARED TOKENS (18): "connects", "delivery", "department", "expanded", "healthcare", "hospital", "local", "monitoring", "organization", "patients", "practice", "public", "related", "safety", "setting", "staff", "system", "unit".
0.300
Sepsis ↗ Q183134 KW CROSS HIGH
accessagebloodchangechildrenconditionsdatadiagnosisdiseasefunctionguidehighimagingincomeinitialinjurylevelmaintainmajormillion
SHARED TOKENS (34): "access", "age", "blood", "change", "children", "conditions", "data", "diagnosis", "disease", "function", "guide", "high", "imaging", "income", "initial", "injury", "level", "maintain", "major", "million"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
buildingcodecodescompliancecouncilestatefacilitygeneralinsurancelawlevellocalmodelnationalprivateproductspublicpublishedrealrequire
SHARED TOKENS (27): "building", "code", "codes", "compliance", "council", "estate", "facility", "general", "insurance", "law", "level", "local", "model", "national", "private", "products", "public", "published", "real", "require"....
0.300
centercentersclinicdeliverydepartmentemergencyexpandedfacilityfocusedhospitalmedicinenationalnetworkrequiretreatmenturgent
SHARED TOKENS (16): "center", "centers", "clinic", "delivery", "department", "emergency", "expanded", "facility", "focused", "hospital", "medicine", "national", "network", "require", "treatment", "urgent".
0.300
activecomprehensivecounselingfacilityfamilygroupgroupshospitalindividualoperatespatientsprogramprogramsrequireresidentialscalesmallsupporttherapythroughout
SHARED TOKENS (22): "active", "comprehensive", "counseling", "facility", "family", "group", "groups", "hospital", "individual", "operates", "patients", "program", "programs", "require", "residential", "scale", "small", "support", "therapy", "throughout"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
businesscapitalconditionsdirectexpansionexplicitlyfinancialindividuallegallicenseslicensingmarketmodelpartnershippracticeproceduresproductsresearchreturnrisk
SHARED TOKENS (23): "business", "capital", "conditions", "direct", "expansion", "explicitly", "financial", "individual", "legal", "licenses", "licensing", "market", "model", "partnership", "practice", "procedures", "products", "research", "return", "risk"....
0.300
MHealth ↗ Q17069079 KW CROSS HIGH
accessannualcapacityclinicalcollectioncommunitydatadeliverydigitaldirecteducationexpandedhealthcareinformationlow-incomemarketmedicinemonitoringpatientpatients
SHARED TOKENS (29): "access", "annual", "capacity", "clinical", "collection", "community", "data", "delivery", "digital", "direct", "education", "expanded", "healthcare", "information", "low-income", "market", "medicine", "monitoring", "patient", "patients"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalexpansionfinancialgenerallong-termmanagementoperationalpartnershipsprivateproductspublicspecificworking
SHARED TOKENS (15): "active", "business", "capital", "expansion", "financial", "general", "long-term", "management", "operational", "partnerships", "private", "products", "public", "specific", "working".
0.300
Deductible ↗ Q132560103 KW CROSS HIGH
claimscompetitiveconsumercoveragecoveringgeneralhighhomehousinginsuranceinsurermultipleplanplanspolicyprogramsproviderrequirementsignificant
SHARED TOKENS (19): "claims", "competitive", "consumer", "coverage", "covering", "general", "high", "home", "housing", "insurance", "insurer", "multiple", "plan", "plans", "policy", "programs", "provider", "requirement", "significant".
0.300
additionalboardcliniccollegedentaldentistdentistrydirectlydiseaseeducationhistoryhomehospitalneedsoralpatientsphysicalpracticerequireresidential
SHARED TOKENS (25): "additional", "board", "clinic", "college", "dental", "dentist", "dentistry", "directly", "disease", "education", "history", "home", "hospital", "needs", "oral", "patients", "physical", "practice", "require", "residential"....
0.300
actbusinessclaimscommissionconcentrationconsolidationcoveringemployeeemployeesemployerfederalgeneralgovernmentgrouphealthcareinsideinsuranceintegratedmanagementmarket
SHARED TOKENS (31): "act", "business", "claims", "commission", "concentration", "consolidation", "covering", "employee", "employees", "employer", "federal", "general", "government", "group", "healthcare", "inside", "insurance", "integrated", "management", "market"....
0.300
actbloodcosmeticcurrentdepartmentdirectlyemployeesfederalfoodsofficesprescriptionprimaryproductspublicradiationrelatedsafetywork
SHARED TOKENS (18): "act", "blood", "cosmetic", "current", "department", "directly", "employees", "federal", "foods", "offices", "prescription", "primary", "products", "public", "radiation", "related", "safety", "work".
0.300
additionalalongsidecampuscapitaldatadirecthospitalmarketneededoperatingpatientprimaryproceduresreducedrequiresurgeonssurgerysystemsystemsvision
SHARED TOKENS (21): "additional", "alongside", "campus", "capital", "data", "direct", "hospital", "market", "needed", "operating", "patient", "primary", "procedures", "reduced", "require", "surgeons", "surgery", "system", "systems", "vision"....
0.300
boardcommunitiesemergencyfullgovernmenthealthcarehospitalsmanagementmedicinenationaloccupationalplanpolicypracticeprivateprofessionalprofessionalsprovidingpublicrecovery
SHARED TOKENS (25): "board", "communities", "emergency", "full", "government", "healthcare", "hospitals", "management", "medicine", "national", "occupational", "plan", "policy", "practice", "private", "professional", "professionals", "providing", "public", "recovery"....
0.300
alliedanalysisassociationclinicsconditionsdiagnosisemergencyhealthcareinjurylistedoperatingpracticeprofessionalprogramsrecognizedtherapeutictreatmentwork
SHARED TOKENS (18): "allied", "analysis", "association", "clinics", "conditions", "diagnosis", "emergency", "healthcare", "injury", "listed", "operating", "practice", "professional", "programs", "recognized", "therapeutic", "treatment", "work".
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
approachesassociationbehaviorclinicalcommunityconditionsdiagnosisemploymenthistoricalhistoryindividualindustryinitialmedicinenationaloccupationalorganizationphysicalprofessionalspublished
SHARED TOKENS (28): "approaches", "association", "behavior", "clinical", "community", "conditions", "diagnosis", "employment", "historical", "history", "individual", "industry", "initial", "medicine", "national", "occupational", "organization", "physical", "professionals", "published"....
🫐 BERRY99 edges
0.280
cliniciansdirecthealthcaremodelplanspracticeproviderprovidersqualifiedradiationsignificantsupporttreatmentwork
SHARED TOKENS (14): "clinicians", "direct", "healthcare", "model", "plans", "practice", "provider", "providers", "qualified", "radiation", "significant", "support", "treatment", "work".
0.280
agebeyondbloodchangediseaseimagingmanagementmillionphysicalradiationrisksmallsurgerytherapy
SHARED TOKENS (14): "age", "beyond", "blood", "change", "disease", "imaging", "management", "million", "physical", "radiation", "risk", "small", "surgery", "therapy".
0.280
additionalagenciesalongsidecertifiedemergencyemployeeshospitalspracticeprofessionalprofessionalspublicrequireruralwork
SHARED TOKENS (14): "additional", "agencies", "alongside", "certified", "emergency", "employees", "hospitals", "practice", "professional", "professionals", "public", "require", "rural", "work".
0.280
dentaldentistryimplantsteeth
SHARED TOKENS (4): "dental", "dentistry", "implants", "teeth". | EXACT TITLE in dental: "Bridge (dentistry)". | EXACT TITLE in healthcare: "Bridge (dentistry)".
0.280
actagenciescomprehensivedistributionenforcementfederalinitiallawnationalpolicysaltstatutetitletreatment
SHARED TOKENS (14): "act", "agencies", "comprehensive", "distribution", "enforcement", "federal", "initial", "law", "national", "policy", "salt", "statute", "title", "treatment".
0.280
Chemotherapy ↗ Q974135 KW CROSS HIGH
againstblooddivisionlocalmajormultipleradiationspecificstandardsurgerysystemtherapytreatmentwork
SHARED TOKENS (14): "against", "blood", "division", "local", "major", "multiple", "radiation", "specific", "standard", "surgery", "system", "therapy", "treatment", "work".
0.280
dentaldentistdenturedenturesdiseasehomemaintainoralpatientspracticeprofessionalprofessionalsteethtreatment
SHARED TOKENS (14): "dental", "dentist", "denture", "dentures", "disease", "home", "maintain", "oral", "patients", "practice", "professional", "professionals", "teeth", "treatment".
0.280
collegenetworkprivateuniversity
SHARED TOKENS (4): "college", "network", "private", "university". | EXACT TITLE in dental: "Carrington College".
0.280
behavioralconditionscounselingfinancialgeneralgroupslegalpatientprescriptionprofessionalsrecoverysocialstreettreatment
SHARED TOKENS (14): "behavioral", "conditions", "counseling", "financial", "general", "groups", "legal", "patient", "prescription", "professionals", "recovery", "social", "street", "treatment".
0.280
diagnosisgroupneedsprimary
SHARED TOKENS (4): "diagnosis", "group", "needs", "primary". | EXACT TITLE in healthcare: "Dual diagnosis".
0.280
clinicaldentaldentistrygeneralmedicineoralpracticeprogramprogramsrecognizedresidencyspecialtyspecificsurgery
SHARED TOKENS (14): "clinical", "dental", "dentistry", "general", "medicine", "oral", "practice", "program", "programs", "recognized", "residency", "specialty", "specific", "surgery".
0.280
Immunology ↗ Q101929 KW CROSS HIGH
activeagainstearlymaintainmedicinephysicalreceivedsmallspecificstudysystemsystemsthroughoutwork
SHARED TOKENS (14): "active", "against", "early", "maintain", "medicine", "physical", "received", "small", "specific", "study", "system", "systems", "throughout", "work".
0.280
actcomprehensiveentitiesfederalgovernmenthospitalslawmedicationpatientsprogramprovidingpublicreducedresources
SHARED TOKENS (14): "act", "comprehensive", "entities", "federal", "government", "hospitals", "law", "medication", "patients", "program", "providing", "public", "reduced", "resources".
0.280
Childbirth ↗ Q34581 KW CROSS HIGH
deliveryemergencyenvironmenthomehospitalsimmediatelyinternallong-termmajormillionpracticeproceduresrecoveryrisk
SHARED TOKENS (14): "delivery", "emergency", "environment", "home", "hospitals", "immediately", "internal", "long-term", "major", "million", "practice", "procedures", "recovery", "risk".
0.280
clinicaldiagnosisdiseasefunctionimaginginsidemajormedicineproceduresradiationrecordsspecialtytherapytreatment
SHARED TOKENS (14): "clinical", "diagnosis", "disease", "function", "imaging", "inside", "major", "medicine", "procedures", "radiation", "records", "specialty", "therapy", "treatment".
0.260
Neurology ↗ Q83042 KW CROSS HIGH
clinicalconditionsdiagnosisdiseaseinjurymedicinemultiplepracticeresearchspecialtystudysystemtreatment
SHARED TOKENS (13): "clinical", "conditions", "diagnosis", "disease", "injury", "medicine", "multiple", "practice", "research", "specialty", "study", "system", "treatment".
0.260
Paramedic ↗ Q330204 KW CROSS HIGH
additionalemergencyhealthcarehospitalhospitalsmedicinemodelpatientspracticeprimaryprofessionalworkworking
SHARED TOKENS (13): "additional", "emergency", "healthcare", "hospital", "hospitals", "medicine", "model", "patients", "practice", "primary", "professional", "work", "working".
0.260
replacementsurgerytreatment
SHARED TOKENS (3): "replacement", "surgery", "treatment". | EXACT TITLE in healthcare: "Joint replacement".
0.260
departmenteducationemergencyenforcementhealthcarelawlevellicensingnationalpracticepractitionersprofessionalsafety
SHARED TOKENS (13): "department", "education", "emergency", "enforcement", "healthcare", "law", "level", "licensing", "national", "practice", "practitioners", "professional", "safety".
0.260
centercentersdepartmentearlyfacilityhospitalhospitalspatientsreducedrequiresafetysurgeryunit
SHARED TOKENS (13): "center", "centers", "department", "early", "facility", "hospital", "hospitals", "patients", "reduced", "require", "safety", "surgery", "unit".
0.260
Dermatology ↗ Q171171 KW CROSS HIGH
beyondconditionscosmeticmanagesmedicinephysicalpopulationradiationrelatedschoolspecialtysurgerytherapy
SHARED TOKENS (13): "beyond", "conditions", "cosmetic", "manages", "medicine", "physical", "population", "radiation", "related", "school", "specialty", "surgery", "therapy".
0.260
insurancemanagementmedication
SHARED TOKENS (3): "insurance", "management", "medication". | EXACT TITLE in dental: "Prior authorization".
0.260
agenciescentersconditionscosmeticdentalhealthcarehomemajormedicinepracticeregionrelatedtreatment
SHARED TOKENS (13): "agencies", "centers", "conditions", "cosmetic", "dental", "healthcare", "home", "major", "medicine", "practice", "region", "related", "treatment".
0.260
Medical device ↗ KW CROSS HIGH
actcosmeticestablishedfederalgeneralmajormarketpatientrisksafetysignificantstandardsstudy
SHARED TOKENS (13): "act", "cosmetic", "established", "federal", "general", "major", "market", "patient", "risk", "safety", "significant", "standards", "study".
0.260
Obstetrics ↗ Q5284418 EXACT TITLE
combinedspecialtystudy
SHARED TOKENS (3): "combined", "specialty", "study". | EXACT TITLE in healthcare: "Obstetrics".
0.260
emergencyhomehospitalinjurylong-termmultiplepatientqualifiedrequireresourcesriskstreettreatment
SHARED TOKENS (13): "emergency", "home", "hospital", "injury", "long-term", "multiple", "patient", "qualified", "require", "resources", "risk", "street", "treatment".
0.240
Vaccine ↗ Q134808 KW CROSS HIGH
activeagainstdiseasefulllicensedorganizationpracticeproducedsafetysystemtherapeutictitle
SHARED TOKENS (12): "active", "against", "disease", "full", "licensed", "organization", "practice", "produced", "safety", "system", "therapeutic", "title".
0.240
additionalbeyondblooddiseaseexpandedinsidemajormultiplepatientpatientsradiationsystem
SHARED TOKENS (12): "additional", "beyond", "blood", "disease", "expanded", "inside", "major", "multiple", "patient", "patients", "radiation", "system".
0.240
Buprenorphine ↗ KW CROSS HIGH
bloodfullhistoryinjectionmedicationmedicinemillionorganizationpointreportedrisktreatment
SHARED TOKENS (12): "blood", "full", "history", "injection", "medication", "medicine", "million", "organization", "point", "reported", "risk", "treatment".
0.240
blooddiagnosisgenerallongermanagementnearproceduresspecialtysurgeonssurgerysystemtherapy
SHARED TOKENS (12): "blood", "diagnosis", "general", "longer", "management", "near", "procedures", "specialty", "surgeons", "surgery", "system", "therapy".
0.240
activeconcentrationdentaldentistfreemarketproductsprofessionalssmallteethtreatmentwhitening
SHARED TOKENS (12): "active", "concentration", "dental", "dentist", "free", "market", "products", "professionals", "small", "teeth", "treatment", "whitening".
0.240
dentaldentistrydirectdirectlyfunctionimplantsinsideproceduresstructuralsupportteeththerapy
SHARED TOKENS (12): "dental", "dentistry", "direct", "directly", "function", "implants", "inside", "procedures", "structural", "support", "teeth", "therapy".
0.240
centersdeliveryinformationmanagementprovidersrecordssafetysitessmallsystemsystemstechnology
SHARED TOKENS (12): "centers", "delivery", "information", "management", "providers", "records", "safety", "sites", "small", "system", "systems", "technology".
0.220
highspecific
SHARED TOKENS (2): "high", "specific". | EXACT TITLE in dental: "Sterilization (microbiology)".
0.220
accessactcertifiedemergencyfacilityhospitalhospitalsprogramprogramsruralsmall
SHARED TOKENS (11): "access", "act", "certified", "emergency", "facility", "hospital", "hospitals", "program", "programs", "rural", "small".
0.220
additionalcoverageemployergovernmenthealthcareinsuranceoptionsplanplansrequirementworkers
SHARED TOKENS (11): "additional", "coverage", "employer", "government", "healthcare", "insurance", "options", "plan", "plans", "requirement", "workers".
0.220
bloodchamberentitiesphysicalprimaryproceduressmallsurgeryteeththerapytreatment
SHARED TOKENS (11): "blood", "chamber", "entities", "physical", "primary", "procedures", "small", "surgery", "teeth", "therapy", "treatment".
0.220
actadaagainstbusinesscouncilemployeesemployersjanuarylawnationalpublic
SHARED TOKENS (11): "act", "ada", "against", "business", "council", "employees", "employers", "january", "law", "national", "public".
0.220
Caregiver ↗ Q553079 KW CROSS HIGH
agecentersfamilyhealthcarehomehospitalslong-termprofessionalsproviderssupportworkers
SHARED TOKENS (11): "age", "centers", "family", "healthcare", "home", "hospitals", "long-term", "professionals", "providers", "support", "workers".
0.220
Midwifery ↗ Q20862341 KW CROSS HIGH
directeducationgeneralindependentlaborlongerprofessionalreviewriskspecialtythroughout
SHARED TOKENS (11): "direct", "education", "general", "independent", "labor", "longer", "professional", "review", "risk", "specialty", "throughout".
0.220
comprehensiveconditionscosmeticestablishedfunctionoralphysicalrequirespecialtysurgerytreatment
SHARED TOKENS (11): "comprehensive", "conditions", "cosmetic", "established", "function", "oral", "physical", "require", "specialty", "surgery", "treatment".
0.220
Pulmonology ↗ Q203337 KW CROSS HIGH
conditionsinternalmedicineneedpatientsrelatedspecialtystudysupportsurgerywork
SHARED TOKENS (11): "conditions", "internal", "medicine", "need", "patients", "related", "specialty", "study", "support", "surgery", "work".
0.220
communityfederalhealthcarehospitalhospitalslegalneedneedsplanregulatorystudy
SHARED TOKENS (11): "community", "federal", "healthcare", "hospital", "hospitals", "legal", "need", "needs", "plan", "regulatory", "study".
0.220
analysisexperiencefocusedframeworkhealthcaremedicineorganizationpatientpatientsresearchsafety
SHARED TOKENS (11): "analysis", "experience", "focused", "framework", "healthcare", "medicine", "organization", "patient", "patients", "research", "safety".
0.220
crownsdentaldentistdenturesimplantsmajormemberpatientprescriptiontechnologyworking
SHARED TOKENS (11): "crowns", "dental", "dentist", "dentures", "implants", "major", "member", "patient", "prescription", "technology", "working".
0.200
actagainstclaimsfederalgovernmentlawmedicaidorganizationprimaryprograms
SHARED TOKENS (10): "act", "against", "claims", "federal", "government", "law", "medicaid", "organization", "primary", "programs".
0.200
Fluoride ↗ Q44793182 EXACT TITLE
basechemicalsfluorideoccurpartiallyparticularlyproductionsizetermswaterwhosewritten
EXACT TITLE in dental: "Fluoride".
0.200
Methadone ↗ Q179996 KW CROSS HIGH
functioninjectionlong-termlongermanagementmedicineorganizationpatienttherapytreatment
SHARED TOKENS (10): "function", "injection", "long-term", "longer", "management", "medicine", "organization", "patient", "therapy", "treatment".
0.200
Home care ↗ Q1642542 KW CROSS HIGH
communitygovernmenthomeindividuallocalmarketnationalpatientprofessionalsocial
SHARED TOKENS (10): "community", "government", "home", "individual", "local", "market", "national", "patient", "professional", "social".
0.200
Gynaecology ↗ Q1221899 KW CROSS HIGH
combinedcommunityconditionsfamilygroupsincomemedicinerequiresurgerysystem
SHARED TOKENS (10): "combined", "community", "conditions", "family", "groups", "income", "medicine", "require", "surgery", "system".
0.200
boardcertifiedgeneralidentifymedicinepracticeresidencystudysurgeonssurgery
SHARED TOKENS (10): "board", "certified", "general", "identify", "medicine", "practice", "residency", "study", "surgeons", "surgery".
0.200
departmentemergencygeneraloperatingpatientpatientspointproceduressystemunit
SHARED TOKENS (10): "department", "emergency", "general", "operating", "patient", "patients", "point", "procedures", "system", "unit".
0.180
behaviorblooddirectlydiseasemedicinepracticeprimarystandardworkers
SHARED TOKENS (9): "behavior", "blood", "directly", "disease", "medicine", "practice", "primary", "standard", "workers".
0.180
Disinfectant ↗ Q73984 KW CROSS HIGH
buildingdefineddentalhospitalsphysicalradiationsimultaneouslytreatmentwork
SHARED TOKENS (9): "building", "defined", "dental", "hospitals", "physical", "radiation", "simultaneously", "treatment", "work".
0.180
annualdirectfeemedicinemembershippatientpracticepracticingprimary
SHARED TOKENS (9): "annual", "direct", "fee", "medicine", "membership", "patient", "practice", "practicing", "primary".
0.180
Medical error ↗ Q460433 KW CROSS HIGH
behaviordiagnosisdiseasehealthcareinjuryorganizationpatientsettingtreatment
SHARED TOKENS (9): "behavior", "diagnosis", "disease", "healthcare", "injury", "organization", "patient", "setting", "treatment".
0.180
Blood bank ↗ Q763244 KW CROSS HIGH
agenciesbloodcenterclinicalcollectiondepartmenthospitalhospitalsrelated
SHARED TOKENS (9): "agencies", "blood", "center", "clinical", "collection", "department", "hospital", "hospitals", "related".
0.180
centersgrouphealthcaremedicaidorganizationpatientspractitionersprogramprovider
SHARED TOKENS (9): "centers", "group", "healthcare", "medicaid", "organization", "patients", "practitioners", "program", "provider".
0.180
annualcapacityfacilitygroupidahoincomelandmajorproducts
SHARED TOKENS (9): "annual", "capacity", "facility", "group", "idaho", "income", "land", "major", "products".
0.180
conditionsmanagementmedicinepatientsspecialtysurgeonssurgerysystemtreatment
SHARED TOKENS (9): "conditions", "management", "medicine", "patients", "specialty", "surgeons", "surgery", "system", "treatment".
0.160
experienceindividualmedicationpatientsprogramssocialtherapytreatment
SHARED TOKENS (8): "experience", "individual", "medication", "patients", "programs", "social", "therapy", "treatment".
0.160
Endocrinology ↗ Q162606 KW CROSS HIGH
behavioralblooddirectlyfunctionintegrationmedicinespecificsystem
SHARED TOKENS (8): "behavioral", "blood", "directly", "function", "integration", "medicine", "specific", "system".
0.160
entirefunctiongenerallocalmedicationprovidingspecificsurgery
SHARED TOKENS (8): "entire", "function", "general", "local", "medication", "providing", "specific", "surgery".
0.160
dentaldentistrydiagnosisoralregionrelatedspecialtystudy
SHARED TOKENS (8): "dental", "dentistry", "diagnosis", "oral", "region", "related", "specialty", "study".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahomiddletonpopulationschoolstar
SHARED TOKENS (8): "ada", "boise", "canyon", "idaho", "middleton", "population", "school", "star".
0.160
Wisdom tooth ↗ Q202517 KW CROSS HIGH
adultsageearlynationaloralspaceteethtreatment
SHARED TOKENS (8): "adults", "age", "early", "national", "oral", "space", "teeth", "treatment".
0.160
additionalhospitalmonitoringpractitionersrequirespecialiststherapistsunit
SHARED TOKENS (8): "additional", "hospital", "monitoring", "practitioners", "require", "specialists", "therapists", "unit".
0.160
bloodenforcementhealthcareinjurylawoccupationalriskworkers
SHARED TOKENS (8): "blood", "enforcement", "healthcare", "injury", "law", "occupational", "risk", "workers".
0.160
Naturopathy ↗ Q213403 KW CROSS HIGH
accreditationlegalmedicinepatientspracticepractitionersprofessionalssurgery
SHARED TOKENS (8): "accreditation", "legal", "medicine", "patients", "practice", "practitioners", "professionals", "surgery".
0.160
alongsidemanagementmodelprimarysimultaneouslysoftwaresystemwork
SHARED TOKENS (8): "alongside", "management", "model", "primary", "simultaneously", "software", "system", "work".
0.160
alliedassociationhealthcarelicensingprofessionalsocialtherapytreatment
SHARED TOKENS (8): "allied", "association", "healthcare", "licensing", "professional", "social", "therapy", "treatment".
0.160
Nitrous oxide ↗ Q905750 KW CROSS HIGH
changeconcentrationdentistryhighmajororganizationsignificantsurgery
SHARED TOKENS (8): "change", "concentration", "dentistry", "high", "major", "organization", "significant", "surgery".
0.140
associationcollegefoundedmembersmembershipprofessionalsurgeons
SHARED TOKENS (7): "association", "college", "founded", "members", "membership", "professional", "surgeons".
0.140
childrendiagnosisfamiliesmedicationpediatricpopulationtreatment
SHARED TOKENS (7): "children", "diagnosis", "families", "medication", "pediatric", "population", "treatment".
0.140
establishedhospitalhospitalsnetworksnorthpublishedstudy
SHARED TOKENS (7): "established", "hospital", "hospitals", "networks", "north", "published", "study".
0.140
clinicalmedicinenorthprofessionalresearchstandardsurgery
SHARED TOKENS (7): "clinical", "medicine", "north", "professional", "research", "standard", "surgery".
0.140
Hematology ↗ Q103824 KW CROSS HIGH
analysisbloodmedicinemultiplerelatedstudytreatment
SHARED TOKENS (7): "analysis", "blood", "medicine", "multiple", "related", "study", "treatment".
0.140
Rheumatology ↗ Q327657 KW CROSS HIGH
currentdiagnosisinternalmanagementmedicinesignificantsystem
SHARED TOKENS (7): "current", "diagnosis", "internal", "management", "medicine", "significant", "system".
0.140
3D printing ↗ Q229367 KW CROSS HIGH
creatingdigitalinternallayermodelpointtechnology
SHARED TOKENS (7): "creating", "digital", "internal", "layer", "model", "point", "technology".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahokunapopulation
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "kuna", "population".
0.120
claimslong-termmedicinepractitionerstherapytrust
SHARED TOKENS (6): "claims", "long-term", "medicine", "practitioners", "therapy", "trust".
0.120
fundinghospitalhospitalsorganizationpatientpublic
SHARED TOKENS (6): "funding", "hospital", "hospitals", "organization", "patient", "public".
0.120
boisecanyonidahomiddletonnampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "middleton", "nampa", "population".
0.120
homemillionorganizationregionworkworkers
SHARED TOKENS (6): "home", "million", "organization", "region", "work", "workers".
0.120
combinedcoveringmanagementprogramsspecialtysystem
SHARED TOKENS (6): "combined", "covering", "management", "programs", "specialty", "system".
0.120
dentaldiseasehelpsperiodontalteeththerapy
SHARED TOKENS (6): "dental", "disease", "helps", "periodontal", "teeth", "therapy".
0.120
datadentaldigitalmodeloralsoftware
SHARED TOKENS (6): "data", "dental", "digital", "model", "oral", "software".
0.120
Dental braces ↗ Q143977 KW CROSS HIGH
cosmeticdentalneedneedsstructuralteeth
SHARED TOKENS (6): "cosmetic", "dental", "need", "needs", "structural", "teeth".
0.120
diagnosisdiseasepracticeresearchspecialtytreatment
SHARED TOKENS (6): "diagnosis", "disease", "practice", "research", "specialty", "treatment".
0.120
Régence ↗ Q1362712 KW CROSS HIGH
councilgovernedgovernmenthistorylawsystem
SHARED TOKENS (6): "council", "governed", "government", "history", "law", "system".
0.120
Dialysis ↗ Q47537646 KW CROSS HIGH
bloodfamilyfunctionprimarysalttreatment
SHARED TOKENS (6): "blood", "family", "function", "primary", "salt", "treatment".
0.120
actmedicineprimaryresidencyspecialistswork
SHARED TOKENS (6): "act", "medicine", "primary", "residency", "specialists", "work".
0.100
actfederalhospitalhospitalslaw
SHARED TOKENS (5): "act", "federal", "hospital", "hospitals", "law".
0.100
generalhealthcarehospitalruralsmall
SHARED TOKENS (5): "general", "healthcare", "hospital", "rural", "small".
0.100
Gingivitis ↗ Q673083 KW CROSS HIGH
diseaseoralperiodontalteethtreatment
SHARED TOKENS (5): "disease", "oral", "periodontal", "teeth", "treatment".
0.100
dentaldiseaseperiodontalspaceteeth
SHARED TOKENS (5): "dental", "disease", "periodontal", "space", "teeth".
0.100
Dental trauma ↗ Q2346266 KW CROSS HIGH
dentalinjuryperiodontalstudyteeth
SHARED TOKENS (5): "dental", "injury", "periodontal", "study", "teeth".
0.100
boisecommunityhomedaleidahopopulation
SHARED TOKENS (5): "boise", "community", "homedale", "idaho", "population".
0.100
Malocclusion ↗ Q1320428 KW CROSS HIGH
dentalpatientpopulationteethtreatment
SHARED TOKENS (5): "dental", "patient", "population", "teeth", "treatment".
◈ Frequently Asked Questions
Dental × Healthcare — Treasure Valley
HAIKU · HIGH GATE
How do Federally Qualified Health Centers in the Treasure Valley integrate dental care into primary care services?
Federally Qualified Health Centers across the Boise area coordinate dental screening and referrals within their electronic health record systems to support patients receiving primary care treatment. This integration allows providers in Boise to identify oral disease markers that affect overall patient health and connect residents to pediatric dentistry, orthodontics, and general dental services through a unified patient record.
What role does Medicaid play in covering dental treatment for Treasure Valley patients?
Idaho Medicaid provides coverage for emergency dental services and pediatric dentistry for qualifying patients throughout the Treasure Valley, including Boise-area residents. Public health initiatives in Idaho coordinate Medicaid benefits with Federally Qualified Health Centers to ensure low-income patients access preventive dental treatment before disease complications require emergency medical services.
How does telehealth expand dental healthcare access in rural areas of Idaho's Treasure Valley?
Telehealth platforms enable rural health clinics in Idaho to connect patients with dental specialists in Boise for primary care consultations and treatment planning without requiring travel. Boise State University researchers have documented how remote consultations improve patient outcomes in rural regions where dental implant specialists and pediatric dentistry resources remain geographically limited.
Why do emergency medical services in the Treasure Valley coordinate with dental providers?
Emergency medical services personnel in Boise and surrounding areas receive training to recognize acute dental disease and oral trauma requiring immediate treatment at emergency departments or dental clinics. Idaho's public health framework requires EMS and healthcare facilities to maintain communication channels so patients with severe dental infections or injuries access appropriate care through the healthcare system rather than preventable hospital visits.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Dental × Healthcare 34 QID bridges 325 edges 9,334 ext links 2026-07-17 20:23:03 UTC a85e5f3d696b589f
Dental corridor ↗ Healthcare corridor ↗ Healthcare × Dental ↗ boisestandard.org/standard ↗
Parent Corridors
Dental × All Other Verticals