—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Craft Beverage Brewery Winery Drinks ↔ relates to ↔ Nuclear Clean Energy

18 Wikipedia bridge articles confirmed in both vertical ledgers. 283 deterministic cross-vertical edges. 7,684 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
283 Cross Edges
7,684 External Sources
321 Wikipedia Articles
20 🌲 Evergreen
200 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Craft Beverage Brewery Winery Drinks
× Nuclear Clean Energy
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
283
External Sources Harvested
7,684
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (18)
Boise State UniversityTreasure ValleyIrrigationUniversity of IdahoSnake RiverPayette RiverApprenticeshipIdaho Department of Environmental QualityWater rightBoise RiverBoise, IdahoAda County, IdahoNampa, IdahoCaldwell, IdahoMeridian, IdahoSnake River PlainCanyon County, IdahoKuna, Idaho
Shared Semantics (20 tokens)
idahoboiserivermetropolitanpopulationeastagriculturalsnakeoregonvalleywesterncanyonmajornorthwestadaamongcollegedivisionpublicuniversity
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:15:43 UTC
Content Hash
ff227d7ac0c3298e
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Boise State University
EXACT TITLE 1.150
QID OVERLAP: Q891082 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (21): "activity", "among", "boise", "business", "college", "division", "economics", "education", "engineering", "health", "idaho", "independent", "institution", "master", "program", "programs", "public", "reported", "research", "total".... | URL->A (1): https://boisestate.edu/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise State University". | EXACT TITLE in nuclear_clean_energy: "Boise State University".
activityamongboisebusinesscollegedivisioneconomicseducationengineeringhealthidahoindependentinstitutionmasterprogramprogramspublicreportedresearchtotaluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (16): "agricultural", "boise", "idaho", "land", "local", "metropolitan", "oregon", "payette", "region", "resources", "river", "rural", "snake", "treasure", "valley", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Treasure Valley". | EXACT TITLE in nuclear_clean_energy: "Treasure Valley".
agriculturalboiseidaholandlocalmetropolitanoregonpayetteregionresourcesriverruralsnaketreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Irrigation
Q11453 EXACT TITLE 1.000
QID OVERLAP: Q11453 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (46): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "directly", "discharge", "distributed", "distribution", "downstream", "effects", "environmental", "fields", "form".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Irrigation". | EXACT TITLE in nuclear_clean_energy: "Irrigation".
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddirectlydischargedistributeddistributiondownstreameffectsenvironmentalfieldsformgrowthirrigationlandmaintainmanagementnetworkoperationoperationsoutsideplant+16
Surface irrigation, also known as gravity irrigation, is the oldest form of irrigation and has been in use for thousands of years. In surface (furrow, flood, or level basin) irrigation systems, water moves across the surface of agricultural lands to wet it and infiltrate into the soil. Water moves by following gravity or the slope of the land. Surface irrigation can be subdivided into furrow, border strip, or basin irrigation. It is often called flood irrigation when irrigation results in flooding or near-flooding of the cultivated land. Historically, surface irrigation has been the most common method for irrigating agricultural land in most parts of the world. The water application efficiency of surface irrigation is typically lower than that of other irrigation methods, due in part to limited control over applied depths. Surface irrigation involves significantly lower capital costs and energy requirements than pressurized irrigation systems. Hence, it is often the irrigation choice for developing nations, for low-value crops, and for large fields. Where water levels from the irrigation source permit, they are controlled by dikes (levees), usually plugged with soil. This is often seen in terraced rice fields (rice paddies), where the method is used to flood or control water levels in each distinct field.
Field Water Efficiency (%) = (Water Transpired by Crop ÷ Water Applied to Field) x 100 Increased irrigation efficiency has several positive outcomes for the farmer, the community, and the wider environment. Low application efficiency indicates that the amount of water applied to the field exceeds the crop or field requirements. Increasing the application efficiency means that the amount of crop produced per unit of water increases. Improved efficiency may be achieved by applying less water to an existing field or by using water more wisely, thereby achieving higher yields in the same area of land. In some parts of the world, farmers are charged for irrigation water; hence, over-application has a direct financial cost to the farmer. Irrigation often requires pumping energy (electricity or fossil fuels) to deliver water to the field or to supply the required operating pressure. Hence, increased efficiency will reduce both water and energy costs per unit of agricultural production. A reduction in water use on one field may allow the farmer to irrigate a larger area of land, increasing total agricultural production. Low efficiency usually means that excess water is lost through seepage or runoff, both of which can result in loss of crop nutrients or pesticides with potential adverse impacts on the surrounding environment. Improving the efficiency of irrigation is usually achieved in one of two ways: either by improving the system design or by optimizing the irrigation management. Improving system design includes converting from one form of irrigation to another (e.g., from furrow to drip irrigation) and making small changes to the current system (e.g., adjusting flow rates and operating pressures).
Archaeological investigations have found evidence of irrigation in areas lacking sufficient natural rainfall to support rainfed agriculture. Some of the earliest known use of the technology dates to the 6th millennium BCE in Khuzistan in the south-west of Iran. The site of Choga Mami, in present-day Iraq on the border with Iran, is believed to be the earliest to show the first canal irrigation in operation at about 6000 BCE. Irrigation was used to manipulate water in the alluvial plains of the Indus Valley Civilization, with its application estimated to have begun around 4500 BCE and to have drastically increased the size and prosperity of their agricultural settlements. The Indus Valley Civilization developed sophisticated irrigation and water-storage systems, including artificial reservoirs at Girnar dated to 3000 BCE, and an early canal irrigation system from c. 2600 BCE. Large-scale agriculture was practiced, with an extensive network of canals used for irrigation. Farmers in the Mesopotamian plain used irrigation from at least the third millennium BCE. They developed perennial irrigation, regularly watering crops throughout the growing season by coaxing water through a matrix of small channels formed in the field. Ancient Egyptians practiced basin irrigation using the flooding of the Nile to inundate land plots which had been surrounded by dikes. The flood water remained until the fertile sediment had settled before the engineers returned the surplus to the watercourse. There is evidence of the ancient Egyptian pharaoh Amenemhet III in the twelfth dynasty (about 1800 BCE) using the natural lake of the Faiyum Oasis as a reservoir to store surpluses of water for use during dry seasons.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (19): "among", "approximately", "boise", "campus", "division", "established", "idaho", "later", "operates", "production", "professional", "public", "research", "rural", "spending", "statewide", "students", "uidaho", "university". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "University of Idaho". | EXACT TITLE in nuclear_clean_energy: "University of Idaho".
amongapproximatelyboisecampusdivisionestablishedidaholateroperatesproductionprofessionalpublicresearchruralspendingstatewidestudentsuidahouniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (41): "activities", "american", "canyon", "central", "commercial", "control", "created", "developed", "downstream", "east", "features", "habitat", "history", "idaho", "irrigation", "large", "limited", "major", "national", "near".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Snake River". | EXACT TITLE in nuclear_clean_energy: "Snake River".
activitiesamericancanyoncentralcommercialcontrolcreateddevelopeddownstreameastfeatureshabitathistoryidahoirrigationlargelimitedmajornationalnearnorthnorthwestoregonpacificprivateproductprogramsprojectsproposedpublic+11
and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
River is a major river in the interior Pacific Northwest region of the United States. About 1,080 miles (1,740 km) long, it is the largest tributary of the Columbia River, which is the largest North American river that empties into the Pacific Ocean. Beginning in Yellowstone National Park, western Wyoming, it flows across the arid Snake River Plain of southern Idaho, the rugged Hells Canyon on the borders of Idaho, Oregon and Washington, and finally the rolling Palouse Hills of southeast Washington. It joins the Columbia River just downstream from the Tri-Cities, Washington, in the southern Columbia Basin. The river's watershed, which drains parts of six U.S. states, is situated between the Rocky Mountains to the north and east, the Great Basin to the south, and the Blue Mountains and Oregon high desert to the west. The region has a long history of volcanism; millions of years ago, Columbia River basalts covered vast areas of the western Snake River watershed, while the Snake River Plain was a product of the Yellowstone volcanic hotspot. The river was further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
as further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
Payette River
Q3373254 EXACT TITLE 0.980
QID OVERLAP: Q3373254 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (14): "agricultural", "division", "east", "idaho", "larger", "major", "national", "near", "north", "payette", "recreation", "river", "snake", "valley". | EXACT TITLE in nuclear_clean_energy: "Payette River".
agriculturaldivisioneastidaholargermajornationalnearnorthpayetterecreationriversnakevalley
to the head of the North Fork Payette River being 180 miles (290 km), while to the head of the South Fork the cumulative length is nearly 163 miles (262 km). The combined Payette River flows into an agricultural valley and empties into the Snake River near the city of Payette at an elevation of 2,125 feet (648 m). The Payette River's drainage basin comprises about 3,240 square miles (8,400 km2). It is a physiographic section of the Columbia Plateau province, which in turn is part of the larger Intermontane Plateaus physiographic division.
The river's watershed was originally settled by the Shoshone, Nez Perce, Paiute and Bannock Native American groups. Before contact with Europeans, many of the indigenous peoples had no permanent villages or settlements. During the fall and winter, they camped in the semi-arid lower valley of the main stem Payette River. In spring and summer, they temporarily moved to the lush area of lakes and wetlands along the North Fork now known as Long Valley, where they hunted and gathered in preparation for the coming winter. Camas bulbs, widespread in this area, was a staple of their diet. In order to maintain the naturally occurring fields of camas, they would set controlled burns whenever they moved to the next camp. The seasonal burning also cleared unwanted vegetation and protected their campsites from overgrowth. In the early 19th century, Europeans began exploring western Idaho. Francois Payette, for whom the river is named, was a French-Canadian fur trapper who worked for the North West Company and was one of the first people of European descent to explore the Payette River basin. Payette ventured east from Fort Astoria in 1818. From 1835 to 1844, he headed the Hudson's Bay Company's Fort Boise trading post near Parma, on the Snake River some distance south of the Payette River. In 1844, Payette retired to Montreal, still over twenty years before settlers began to arrive in great numbers from the eastern United States. One of the first pioneer settlements was on Clear Creek, a tributary of the South Fork Payette River. Many of the Native Americans were unhappy with the new settlers for taking and causing damage to their lands, especially due to mining, logging, and grazing. Armed conflicts resulted, including the Nez Perce War of 1877, when the US Army was dispatched to western Idaho. Due to the abundant timber in the Payette River basin, one of the first new industries in the 19th century was logging, but did not reach large scale until the early 20th century. Demand for wooden railroad ties for the Oregon Short Line (OSL) in the 1880s increased logging operations in the area. One of the main centers of logging was in the southern part of Long Valley downstream from what is now the town of Cascade. A splash dam was built in 1902 by the Minnesota-based Payette Lumber and Manufacturing Company on the North Fork in order to help the transportation of logs downstream. Settlers began to move into the upper Payette basin, and in 1911, the Idaho Northern Railroad was constructed between Emmett along the Payette River, through Black Canyon and the North Fork, and ending just below Long Valley at Smith's Ferry on the river, named for a settler who bought the operation in 1891. The railroad transported timber, livestock and crops between Long Valley and the Treasure Valley. Starting around 1874, there was heavy agricultural development in the valley of the lower Payette River. Irrigation systems were necessary due to the semi-arid climate of this area. The Last Chance Canal and Nobel Canal were among the first private ditches constructed to divert water from the Payette River. The U.S. Bureau of Reclamation (USBR) constructed Black Canyon Diversion Dam in 1924 to direct water from the Payette River into the Emmett and Black Canyon Canals, which run at higher elevations than the older ditches and vastly increased the potential for irrigation. In order to store water for irrigation in the dry season, the USBR constructed Deadwood Dam in 1929 on the Deadwood River tributary of the South Fork. Cascade Dam was constructed in 1948, flooding a large area of Long Valley.
drainage basin comprises about 3,240 square miles (8,400 km2). It is a physiographic section of the Columbia Plateau province, which in turn is part of the larger Intermontane Plateaus physiographic division. The South Fork of the Payette has its headwaters in the Sawtooth Wilderness, which is part of the Sawtooth National Recreation Area. Geography The principal tributaries of the Payette River are the North and South Forks. The North Fork drains about 950 square miles (2,500 km2), beginning north of McCall and flowing into Payette Lake. The North Fork exits at the southwest end of Payette Lake at 4,990 feet (1,520 m) and flows south in the "Long Valley" of Valley County toward Cascade. It then flows into the Cascade Reservoir, then continues south, accompanied by Highway 55. The South Fork Payette River drains about 1,200 square miles (3,100 km2), originating on the west side of the Sawtooth Wilderness beneath the 10,211-foot (3,112 m) Mount Payette. It flows past Grandjean and down to Lowman, along Highway 21. The shorter Middle Fork Payette River parallels the lower North Fork 10 miles (16 km) to the east, flowing south and joining the South Fork just southwest of Crouch. Further east, the Deadwood River parallels the Middle Fork and empties into the South Fork just west of Lowman. The main stem of the Payette River is shown on USGS topographic maps as beginning at the confluence of the South and Middle forks. The North Fork joins the Payette at the village of Banks, at an elevation of 2,790 feet (850 m). The main stem flows south from Banks for 15 miles (24 km) to Horseshoe Bend, then west into Black Canyon Reservoir. Below the reservoir's dam, the river flows past Emmett and Payette, then empties into the Snake River at the Oregon border.
Apprenticeship
Q20773771 EXACT TITLE 0.980
QID OVERLAP: Q20773771 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (14): "apprenticeship", "cases", "certification", "complete", "employer", "labor", "license", "master", "outside", "professional", "regulated", "study", "system", "training". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Apprenticeship". | EXACT TITLE in nuclear_clean_energy: "Apprenticeship".
apprenticeshipcasescertificationcompleteemployerlaborlicensemasteroutsideprofessionalregulatedstudysystemtraining
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Idaho Department of Environmental Quality
Q5987351 EXACT TITLE 0.880
QID OVERLAP: Q5987351 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (9): "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "responsible". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho Department of Environmental Quality". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Environmental Quality".
boisedepartmentenvironmentalfederalgovernmentidahoqualityregionalresponsible
tment of Environmental Quality is the department of the Idaho state government responsible for administering state and federal environmental laws and regulations. The department's main offices are in Boise, and six regional offices are also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act.
also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act. Before 2000, DEQ in Idaho was a division of the Department of Health and Welfare. Structure and functions It is organized into five divisions: Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
W
Q7973730 EXACT TITLE 0.880
QID OVERLAP: Q7973730 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (9): "different", "irrigation", "law", "legal", "physical", "river", "source", "systems", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Water right". | EXACT TITLE in nuclear_clean_energy: "Water right".
differentirrigationlawlegalphysicalriversourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
Boise River
Q891080 EXACT TITLE 0.880
QID OVERLAP: Q891080 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (9): "agricultural", "approximately", "boise", "highly", "idaho", "river", "snake", "urban", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise River".
agriculturalapproximatelyboisehighlyidahoriversnakeurbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (20): "ada", "annual", "boise", "capital", "counties", "downtown", "east", "estimated", "idaho", "locally", "major", "manufacturing", "metropolitan", "north", "oregon", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntowneastestimatedidaholocallymajormanufacturingmetropolitannorthoregonpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (17): "ada", "boise", "capital", "district", "east", "estimated", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private", "roads", "second", "washington".
adaboisecapitaldistricteastestimatedidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivateroadssecondwashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "second", "university", "western".
boisecanyoncollegeidahomeridianmetropolitannampanorthwestpopulationprincipalseconduniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "oregon", "population".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanoregonpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Snake River Plain
Q1396049 QID OVERLAP 0.680
QID OVERLAP: Q1396049 in craft_beverage_brewery_winery_drinks (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (9): "agricultural", "cities", "east", "idaho", "land", "major", "northwest", "river", "snake".
agriculturalcitieseastidaholandmajornorthwestriversnake
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in craft_beverage_brewery_winery_drinks (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
265 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP265 edges
🌲 EVERGREEN2 edges
0.650
acresadaamericanboisecanyoncommissioncountiesdepartmentestablishedidaholaborleastnationoregonpayetteproductionriversnaketaxvalley
SHARED TOKENS (21): "acres", "ada", "american", "boise", "canyon", "commission", "counties", "department", "established", "idaho", "labor", "least", "nation", "oregon", "payette", "production", "river", "snake", "tax", "valley".... | URL->A (2): https://idahowines.org/idaho-wines/idaho-wine-history/, https://www.stechapelle.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Snake River Valley AVA".
0.650
academicadaboisecampuscanyoncollegecommunitycountiescwidevelopmenteducationgovernedidaholargenampanorthpopulationprogramspublicreported
SHARED TOKENS (30): "academic", "ada", "boise", "campus", "canyon", "college", "community", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "north", "population", "programs", "public", "reported".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "College of Western Idaho". | EXACT TITLE in nuclear_clean_energy: "College of Western Idaho".
🌿 BRANCH200 edges
0.570
activityamongcampusidahomeridianpercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (11): "activity", "among", "campus", "idaho", "meridian", "percent", "programs", "public", "research", "students", "university". | URL->B (1): http://www.isu.edu/. | EXACT TITLE in nuclear_clean_energy: "Idaho State University".
0.570
actchaptercodecontrolcreateddepartmentfederalgovernmentstatutorytaxtitle
SHARED TOKENS (11): "act", "chapter", "code", "control", "created", "department", "federal", "government", "statutory", "tax", "title". | URL->A (1): https://uscode.house.gov/view.xhtml?path=/prelim@title27/chapter8&edition=prelim. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Federal Alcohol Administration".
0.550
alliancecommunitydifferenteducationidahoorganizationpowerpromoteriversnake
SHARED TOKENS (10): "alliance", "community", "different", "education", "idaho", "organization", "power", "promote", "river", "snake". | URL->B (1): http://snakeriveralliance.org/. | EXACT TITLE in nuclear_clean_energy: "Snake River Alliance".
0.510
Untappd ↗ EXACT TITLE
allowedapplicationplatformrateratingreviewshareuses
SHARED TOKENS (8): "allowed", "application", "platform", "rate", "rating", "review", "share", "uses". | URL->A (1): https://untappd.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Untappd".
0.500
developmentdistributeddistributioneconomiceconomyhistoryhouseholdindustrialpowerprocesspumpsresourcesruralsourcestoragesystemstechnologytransitiontransport
SHARED TOKENS (19): "development", "distributed", "distribution", "economic", "economy", "history", "household", "industrial", "power", "process", "pumps", "resources", "rural", "source", "storage", "systems", "technology", "transition", "transport". | EXACT TITLE in nuclear_clean_energy: "Electrification".
0.500
Idaho ↗ EXACT TITLE
agriculturalagricultureapproximatelyaroundassociatedboisecapitalcontainscropdistincteasteconomyidahoisolatedlaboratorylandmanufacturingnationalnorthnorthwest
SHARED TOKENS (37): "agricultural", "agriculture", "approximately", "around", "associated", "boise", "capital", "contains", "crop", "distinct", "east", "economy", "idaho", "isolated", "laboratory", "land", "manufacturing", "national", "north", "northwest".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho". | EXACT TITLE in nuclear_clean_energy: "Idaho".
0.500
Frost ↗ Q4590598 EXACT TITLE
affectcoldconditionscontainscoolingcoveringdependsdevelopmentdirectlyevenformformationformsgrowinggrowthlargelargerlayernearplant
SHARED TOKENS (28): "affect", "cold", "conditions", "contains", "cooling", "covering", "depends", "development", "directly", "even", "form", "formation", "forms", "growing", "growth", "large", "larger", "layer", "near", "plant".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Frost".
0.500
Inventory ↗ Q815410 EXACT TITLE
americanbusinessbusinessesdifferentfacilityinformationinventorymanagementmanufacturingmaterialsnetworkplannedprocessproductionprojectsquantityrequiredshapesupplysystem
SHARED TOKENS (22): "american", "business", "businesses", "different", "facility", "information", "inventory", "management", "manufacturing", "materials", "network", "planned", "process", "production", "projects", "quantity", "required", "shape", "supply", "system".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Inventory". | EXACT TITLE in nuclear_clean_energy: "Inventory".
0.500
conditionscontrolcurrentlydepartmentfacilityidahointerestlaboratorymaterialsnationaloperationoriginalplannedplantsprogramstructuralsystemstesting
SHARED TOKENS (18): "conditions", "control", "currently", "department", "facility", "idaho", "interest", "laboratory", "materials", "national", "operation", "original", "planned", "plants", "program", "structural", "systems", "testing". | EXACT TITLE in nuclear_clean_energy: "Transient Reactor Test Facility".
0.500
adaaddsanchoredboisecanyoncitiescountiescurrentlyidaholargermeridianmetropolitannampanorthwestoregonpacificpayettepercentpopulationtotal
SHARED TOKENS (22): "ada", "adds", "anchored", "boise", "canyon", "cities", "counties", "currently", "idaho", "larger", "meridian", "metropolitan", "nampa", "northwest", "oregon", "pacific", "payette", "percent", "population", "total".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise metropolitan area".
0.500
Food safety ↗ Q909821 EXACT TITLE
casescertificationchainconsumercreatesdeliverydescribingdevelopedestimatedfoodgrowthhealthinvolvedmanagementmarketorganizationpersonsphysicalpracticesrelated
SHARED TOKENS (26): "cases", "certification", "chain", "consumer", "creates", "delivery", "describing", "developed", "estimated", "food", "growth", "health", "involved", "management", "market", "organization", "persons", "physical", "practices", "related".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food safety".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundbuildingconcretecriticaldevelopeddownstreamengineeringfarmingfunctionsgenerategoverninghealthhouseholdindustrialirrigationlandlargemaintenance
SHARED TOKENS (40): "additional", "application", "around", "building", "concrete", "critical", "developed", "downstream", "engineering", "farming", "functions", "generate", "governing", "health", "household", "industrial", "irrigation", "land", "large", "maintenance".... | EXACT TITLE in nuclear_clean_energy: "Dam".
0.500
accessactivitiesactivitycitiescreateddegreedemanddogenvironmentfacilitiesgeneraloutsidephysicalpopulationratherrecreationrivertraining
SHARED TOKENS (18): "access", "activities", "activity", "cities", "created", "degree", "demand", "dog", "environment", "facilities", "general", "outside", "physical", "population", "rather", "recreation", "river", "training". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Outdoor recreation".
0.500
applicationapproximatelybehaviorcurrentdepartmenteastengineeringenvironmentalfacilitiesfacilityhistoryidahoinvolvedknowledgelaboratorynationalorganizationsplantpowerresearch
SHARED TOKENS (22): "application", "approximately", "behavior", "current", "department", "east", "engineering", "environmental", "facilities", "facility", "history", "idaho", "involved", "knowledge", "laboratory", "national", "organizations", "plant", "power", "research".... | EXACT TITLE in nuclear_clean_energy: "Idaho National Laboratory".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralcommercialconnectedconsumercontrolcustomerdifferentdistributionelectricalfunctionsindustrialinfrastructurelargelargerplantplantspowerreceivingremote
SHARED TOKENS (22): "approximately", "central", "commercial", "connected", "consumer", "control", "customer", "different", "distribution", "electrical", "functions", "industrial", "infrastructure", "large", "larger", "plant", "plants", "power", "receiving", "remote".... | EXACT TITLE in nuclear_clean_energy: "Substation".
0.500
accountallowedbeyondboiseconcreteconnectseagleeastidahopermitresidentialriverroutesspecialsystemtotaltransportationurban
SHARED TOKENS (18): "account", "allowed", "beyond", "boise", "concrete", "connects", "eagle", "east", "idaho", "permit", "residential", "river", "routes", "special", "system", "total", "transportation", "urban". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise River Greenbelt".
0.500
boisebroaderculturaleastestablishedhistoricalhistoryidaholimitedmerelymetropolitannorthnorthwestofficialoregonpacificratherregionterritorythough
SHARED TOKENS (22): "boise", "broader", "cultural", "east", "established", "historical", "history", "idaho", "limited", "merely", "metropolitan", "north", "northwest", "official", "oregon", "pacific", "rather", "region", "territory", "though".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Pacific Northwest". | EXACT TITLE in nuclear_clean_energy: "Pacific Northwest".
0.500
Beer ↗ Q44 EXACT TITLE
actactivitiesaroundassociatedbusinesscodecommercialcontainsdistributeddistributionformformshealthmodernproducedproducesproductionregionalwater
SHARED TOKENS (19): "act", "activities", "around", "associated", "business", "code", "commercial", "contains", "distributed", "distribution", "form", "forms", "health", "modern", "produced", "produces", "production", "regional", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer".
0.500
Chemistry ↗ Q2329 EXACT TITLE
applicationsbehaviorcentralchangescreateeconomicenvironmentalexplainsfieldsformationgrowthphysicalplantsciencescopestructurestudysubjectwork
SHARED TOKENS (19): "applications", "behavior", "central", "changes", "create", "economic", "environmental", "explains", "fields", "formation", "growth", "physical", "plant", "science", "scope", "structure", "study", "subject", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Chemistry". | EXACT TITLE in nuclear_clean_energy: "Chemistry".
0.500
americanbecomecertificationcertifiedconsumerelectricalfieldsjobsknowledgelicensemaintenancemissionnorthorganizationpartnerspersonnelpowerpreferredprocessprofessional
SHARED TOKENS (37): "american", "become", "certification", "certified", "consumer", "electrical", "fields", "jobs", "knowledge", "license", "maintenance", "mission", "north", "organization", "partners", "personnel", "power", "preferred", "process", "professional".... | EXACT TITLE in nuclear_clean_energy: "North American Board of Certified Energy Practitioners".
0.500
affectingamongcreatingdemanddirectelectricalenvironmentalinvolvedlandlargelimitsmakingplantspopulationpowerproducedproducesprovideregionremains
SHARED TOKENS (27): "affecting", "among", "creating", "demand", "direct", "electrical", "environmental", "involved", "land", "large", "limits", "making", "plants", "population", "power", "produced", "produces", "provide", "region", "remains".... | EXACT TITLE in nuclear_clean_energy: "Hydroelectricity".
0.500
Food truck ↗ Q3303463 EXACT TITLE
amongbecomecommercialculturalcustomersdevelopedeconomicestimatedfoodgrowinghistoricalincreasinglylargemajoroperationregionalservespecialtythoughtransport
SHARED TOKENS (23): "among", "become", "commercial", "cultural", "customers", "developed", "economic", "estimated", "food", "growing", "historical", "increasingly", "large", "major", "operation", "regional", "serve", "specialty", "though", "transport".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food truck".
0.500
amongcentercommercialconventionalcustomersdatadeliverdemandelectricalexternalfeaturesinterestlargemodelsmodernoperateoperationoperatorsphysicalplant
SHARED TOKENS (30): "among", "center", "commercial", "conventional", "customers", "data", "deliver", "demand", "electrical", "external", "features", "interest", "large", "models", "modern", "operate", "operation", "operators", "physical", "plant".... | EXACT TITLE in nuclear_clean_energy: "Small modular reactor".
0.500
Cold War ↗ Q8683 EXACT TITLE
allianceanothercoldconventionaldirectdivisioneconomicexpandedinfluencemajornorthpoliticalregionalsecondspacesupportedthoughwestern
SHARED TOKENS (18): "alliance", "another", "cold", "conventional", "direct", "division", "economic", "expanded", "influence", "major", "north", "political", "regional", "second", "space", "supported", "though", "western". | EXACT TITLE in nuclear_clean_energy: "Cold War".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessactivitiesapplicablechaincommunitiesconditionscurrentlydevelopmenteconomyenvironmentenvironmentalgeneralgrowthhealthladderlimitedmaintainingmovesoperatingpublic
SHARED TOKENS (37): "access", "activities", "applicable", "chain", "communities", "conditions", "currently", "development", "economy", "environment", "environmental", "general", "growth", "health", "ladder", "limited", "maintaining", "moves", "operating", "public".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sanitation".
0.500
conventionalcoolingcurrentlydemandelectricalfoodformformslargelateroperatepowerprocessproducedproductionprovidereducescalestorage
SHARED TOKENS (19): "conventional", "cooling", "currently", "demand", "electrical", "food", "form", "forms", "large", "later", "operate", "power", "process", "produced", "production", "provide", "reduce", "scale", "storage". | EXACT TITLE in nuclear_clean_energy: "Energy storage".
0.500
Yeast ↗ Q45422 EXACT TITLE
carbonclusterconditionsconnectedconvertscurrentlydescribeddivisionenvironmentformformsfunctionsgenerategrowthleastmodelmodernprocessproductionrecognized
SHARED TOKENS (23): "carbon", "cluster", "conditions", "connected", "converts", "currently", "described", "division", "environment", "form", "forms", "functions", "generate", "growth", "least", "model", "modern", "process", "production", "recognized".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Yeast".
0.500
applicationsclimatecommercialconcentratedconversioncostcurrentcurrentlydevelopeddirectlyeffectlargeneededplantspowerproducesproductionregulationremotesecurity
SHARED TOKENS (27): "applications", "climate", "commercial", "concentrated", "conversion", "cost", "current", "currently", "developed", "directly", "effect", "large", "needed", "plants", "power", "produces", "production", "regulation", "remote", "security".... | EXACT TITLE in nuclear_clean_energy: "Solar power".
0.500
agricultureanotherapplicationsaveragebuildingchaincitiesclimatecoldconditionsconsumerconsumptioncontrolledcoolingdatesdevelopeddevelopmentdistributionexpandedfarms
SHARED TOKENS (51): "agriculture", "another", "applications", "average", "building", "chain", "cities", "climate", "cold", "conditions", "consumer", "consumption", "controlled", "cooling", "dates", "developed", "development", "distribution", "expanded", "farms".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Refrigeration".
0.500
activityapplicationsapproximatelyconditionscoolingdifferenteastenvironmentidahoindustrialisolatedlaboratorymaterialsnationaloperateoperatesphysicalplantspowerproduced
SHARED TOKENS (28): "activity", "applications", "approximately", "conditions", "cooling", "different", "east", "environment", "idaho", "industrial", "isolated", "laboratory", "materials", "national", "operate", "operates", "physical", "plants", "power", "produced".... | EXACT TITLE in nuclear_clean_energy: "Advanced Test Reactor".
0.500
activitiesagriculturalapproximatelyclimateearthhouseholdindustrialirrigationnorthpotentiallyproducedremainingresourceresourcesriverservesmallsourcesupplywastewater
SHARED TOKENS (21): "activities", "agricultural", "approximately", "climate", "earth", "household", "industrial", "irrigation", "north", "potentially", "produced", "remaining", "resource", "resources", "river", "serve", "small", "source", "supply", "wastewater".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Water resources".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialfoodmanagementmodelplacespracticesprivateprovidesafetyservedservesservingspecialspecific
SHARED TOKENS (15): "business", "commercial", "food", "management", "model", "places", "practices", "private", "provide", "safety", "served", "serves", "serving", "special", "specific". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Catering".
0.500
Soil ↗ Q36133 EXACT TITLE
accountassociatedbroaderclassificationclimatedevelopmentdistinguishearthengineeringenvironmentformformationfunctionsgrowthhabitatinfluenceliesmaterialsoriginalphysical
SHARED TOKENS (34): "account", "associated", "broader", "classification", "climate", "development", "distinguish", "earth", "engineering", "environment", "form", "formation", "functions", "growth", "habitat", "influence", "lies", "materials", "original", "physical".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Soil". | EXACT TITLE in nuclear_clean_energy: "Soil".
0.500
Ice wine ↗ Q828135 EXACT TITLE
casescoldconcentratedcropdegreegiveshourslargeleastlimitedmakingminoritynoticeproducedproducingproductionrequiresshapesmallwater
SHARED TOKENS (20): "cases", "cold", "concentrated", "crop", "degree", "gives", "hours", "large", "least", "limited", "making", "minority", "notice", "produced", "producing", "production", "requires", "shape", "small", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Ice wine".
0.500
applicationsbecomecarbonclimatecommercialcoolingdenserearthfeaturesfirefoodformsgrowthlandmaterialsplantplantsprocessproducedproduces
SHARED TOKENS (25): "applications", "become", "carbon", "climate", "commercial", "cooling", "denser", "earth", "features", "fire", "food", "forms", "growth", "land", "materials", "plant", "plants", "process", "produced", "produces".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Carbon dioxide".
0.500
aroundbecomecarboncentralinvolvedlargelawlegallylocalmakingprocessproducedproductionqualityregion
SHARED TOKENS (15): "around", "become", "carbon", "central", "involved", "large", "law", "legally", "local", "making", "process", "produced", "production", "quality", "region". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sparkling wine".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybenefitsbeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomiceffectsenvironmentenvironmentalestimatedgrowinggrowthhourslimitedlocalmarketsorganization
SHARED TOKENS (30): "activity", "benefits", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "effects", "environment", "environmental", "estimated", "growing", "growth", "hours", "limited", "local", "markets", "organization".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
americanannualapproximatelybecomebusinessbusinessescomcurrentlydecemberdirectoryexpandedexternalheadquarteredhouseholdinformationlateronlineoperatespracticespromote
SHARED TOKENS (30): "american", "annual", "approximately", "become", "business", "businesses", "com", "currently", "december", "directory", "expanded", "external", "headquartered", "household", "information", "later", "online", "operates", "practices", "promote".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Yelp".
0.500
Drought ↗ Q43059 EXACT TITLE
activityaffectingagricultureannualbecomeclimateconditionsdirectlyeconomiceconomyeffectsenvironmentalfarmingfoodhealthhistorylargelargerlocalpower
SHARED TOKENS (28): "activity", "affecting", "agriculture", "annual", "become", "climate", "conditions", "directly", "economic", "economy", "effects", "environmental", "farming", "food", "health", "history", "large", "larger", "local", "power".... | EXACT TITLE in nuclear_clean_energy: "Drought".
0.500
Brewery ↗ Q131734 EXACT TITLE
businesscommercialcommerciallydistinctequipmentfarmslargerleastplantprocessproducedproductionprotectionscaleworkers
SHARED TOKENS (15): "business", "commercial", "commercially", "distinct", "equipment", "farms", "larger", "least", "plant", "process", "produced", "production", "protection", "scale", "workers". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Brewery".
0.500
Pollination ↗ Q134624 EXACT TITLE
addressedagricultureclosedcriticaldirectlydivisioneconomicsevenfieldsinsidelaterplantplantsprocessproductionreachesresearchscalestudysystem
SHARED TOKENS (24): "addressed", "agriculture", "closed", "critical", "directly", "division", "economics", "even", "fields", "inside", "later", "plant", "plants", "process", "production", "reaches", "research", "scale", "study", "system".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Pollination".
0.500
chainconsumercreatingcustomersdirectdirectlydistributionfacilitiesindependentinvolvedmanagementmaterialsnetworkproductstructuresupplierssupplysystemsystemstier
SHARED TOKENS (21): "chain", "consumer", "creating", "customers", "direct", "directly", "distribution", "facilities", "independent", "involved", "management", "materials", "network", "product", "structure", "suppliers", "supply", "system", "systems", "tier".... | EXACT TITLE in nuclear_clean_energy: "Supply chain".
0.500
Fermentation ↗ Q41760 EXACT TITLE
associatedbenefitsconditionsdemanddifferentdiscoveryfoodformhealthindustrialmakingprocessproducingproductionrelatedsupply
SHARED TOKENS (16): "associated", "benefits", "conditions", "demand", "different", "discovery", "food", "form", "health", "industrial", "making", "process", "producing", "production", "related", "supply". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Fermentation".
0.500
applicationsassociatedaveragecarboncommerciallycontrolledenvironmentestimatedexpandedgeneratehoursnearplannedplantplantspowerproducedproducingpublicregulation
SHARED TOKENS (24): "applications", "associated", "average", "carbon", "commercially", "controlled", "environment", "estimated", "expanded", "generate", "hours", "near", "planned", "plant", "plants", "power", "produced", "producing", "public", "regulation".... | EXACT TITLE in nuclear_clean_energy: "Nuclear power".
0.500
Logistics ↗ Q177777 EXACT TITLE
addressedanotherchainconsumptioncustomersequipmentfacilityfieldsfoodinformationlinesmaintainingmanagementmaterialsmodeloperationalphysicalplanningplantsproduction
SHARED TOKENS (29): "addressed", "another", "chain", "consumption", "customers", "equipment", "facility", "fields", "food", "information", "lines", "maintaining", "management", "materials", "model", "operational", "physical", "planning", "plants", "production".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Logistics".
0.500
Packaging ↗ Q207822 EXACT TITLE
americanassociatedbusinesscontainsdescribeddistributiongoverninggovernmentindustrialinstitutionalintegratedpackageprocessproducingprotectionscienceseparatestoragesystemtechnology
SHARED TOKENS (21): "american", "associated", "business", "contains", "described", "distribution", "governing", "government", "industrial", "institutional", "integrated", "package", "process", "producing", "protection", "science", "separate", "storage", "system", "technology".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Packaging".
0.500
businesseschangesconsumptioncostcustomercustomersdemanddirectdirectlyeconomicgeneralimplicationlargelimitsmanagementoperateperiodsplannedplantspower
SHARED TOKENS (33): "businesses", "changes", "consumption", "cost", "customer", "customers", "demand", "direct", "directly", "economic", "general", "implication", "large", "limits", "management", "operate", "periods", "planned", "plants", "power".... | EXACT TITLE in nuclear_clean_energy: "Demand response".
0.500
Nitrogen ↗ Q627 EXACT TITLE
actapplicationscarboncommercialcommerciallycontainscontroldescribesearthestimatedfoodformformsindustrialisolatedlargemajormakingproducedsecond
SHARED TOKENS (27): "act", "applications", "carbon", "commercial", "commercially", "contains", "control", "describes", "earth", "estimated", "food", "form", "forms", "industrial", "isolated", "large", "major", "making", "produced", "second".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Nitrogen".
0.500
actactivitiesapplicantsapproximatelycertificationcommissiondecisionsdefinesdepartmentdifferentenvironmentalfacilitiesfacilityformguidancehighlyindependentinventorylicenselicensed
SHARED TOKENS (45): "act", "activities", "applicants", "approximately", "certification", "commission", "decisions", "defines", "department", "different", "environmental", "facilities", "facility", "form", "guidance", "highly", "independent", "inventory", "license", "licensed".... | EXACT TITLE in nuclear_clean_energy: "Nuclear material".
0.500
applicationdegreedemonstratesdependseducationenvironmentenvironmentalfacilitiesgovernmenthealthknowledgemakingpowerproducedprofessionalprotectionrelatedrequireresearchscience
SHARED TOKENS (23): "application", "degree", "demonstrates", "depends", "education", "environment", "environmental", "facilities", "government", "health", "knowledge", "making", "power", "produced", "professional", "protection", "related", "require", "research", "science".... | EXACT TITLE in nuclear_clean_energy: "Health physics".
0.500
climatedeliverydemanddirectlydistributionelectricalfieldsformsgrowthplantplantspowerprocessproducedproductionproposedreportedrequiredstoragesupply
SHARED TOKENS (23): "climate", "delivery", "demand", "directly", "distribution", "electrical", "fields", "forms", "growth", "plant", "plants", "power", "process", "produced", "production", "proposed", "reported", "required", "storage", "supply".... | EXACT TITLE in nuclear_clean_energy: "Electricity generation".
0.500
activitiesagriculturalamongapplicationbenefitsdevelopmentenvironmentalformationhealthhistoryinvolvinglegalmaterialsnationalownershipplanningregulationremainsresearchserve
SHARED TOKENS (23): "activities", "agricultural", "among", "application", "benefits", "development", "environmental", "formation", "health", "history", "involving", "legal", "materials", "national", "ownership", "planning", "regulation", "remains", "research", "serve".... | EXACT TITLE in nuclear_clean_energy: "Cloud seeding".
0.500
actcommissionestablishedfacilitiesfunctionsgovernmenthealthjanuarylicensingmaterialsoperationspublicregulationregulatoryrelatedsafetysecuritystorage
SHARED TOKENS (18): "act", "commission", "established", "facilities", "functions", "government", "health", "january", "licensing", "materials", "operations", "public", "regulation", "regulatory", "related", "safety", "security", "storage". | EXACT TITLE in nuclear_clean_energy: "Nuclear Regulatory Commission".
0.500
annualcarbonconversioncreatedcurrentcurrentlygrowthindustriallargemarketprocessproducedproducingproductproductionratestoragesupplyuseswater
SHARED TOKENS (20): "annual", "carbon", "conversion", "created", "current", "currently", "growth", "industrial", "large", "market", "process", "produced", "producing", "product", "production", "rate", "storage", "supply", "uses", "water". | EXACT TITLE in nuclear_clean_energy: "Hydrogen production".
0.500
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiescommunityconnectioncreatingculturalfoodintegratedlocalnationalprovideresourceseekservesourcespecific
SHARED TOKENS (18): "agriculture", "among", "associated", "communities", "community", "connection", "creating", "cultural", "food", "integrated", "local", "national", "provide", "resource", "seek", "serve", "source", "specific". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Festival".
0.500
ServSafe ↗ Q7455532 EXACT TITLE
administeredamericancertificationcredentialfoodmanagementmanagersnationalprocessprogramprotectionrequiredsafetytrainingwork
SHARED TOKENS (15): "administered", "american", "certification", "credential", "food", "management", "managers", "national", "process", "program", "protection", "required", "safety", "training", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "ServSafe".
0.500
Liquor ↗ Q56139 EXACT TITLE
alonealreadyaroundconsumptiondistinguisheffectsevenformhealthlargenorthpracticesprocessproducedproductionrapidratherserved
SHARED TOKENS (18): "alone", "already", "around", "consumption", "distinguish", "effects", "even", "form", "health", "large", "north", "practices", "process", "produced", "production", "rapid", "rather", "served". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Liquor".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualclassificationclimatecommunitiesconditionsdifferenteffectformationphysicalplantprovideremoteresourcestudywater
SHARED TOKENS (16): "agriculture", "annual", "classification", "climate", "communities", "conditions", "different", "effect", "formation", "physical", "plant", "provide", "remote", "resource", "study", "water". | EXACT TITLE in nuclear_clean_energy: "Snowpack".
0.500
Horticulture ↗ Q48803 EXACT TITLE
agricultureamericanaroundassociatedcommercialcontrolledconventionaldistinctevengrowinghighlyincreasinglyindustrialknowledgelimitedmaintenanceorganizationsplantplantspractices
SHARED TOKENS (30): "agriculture", "american", "around", "associated", "commercial", "controlled", "conventional", "distinct", "even", "growing", "highly", "increasingly", "industrial", "knowledge", "limited", "maintenance", "organizations", "plant", "plants", "practices".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Horticulture".
0.500
controlcontrolsdefinesdescriptionsentitiesinvolvedknowledgemaintainmajormanagementpersonnelphysicalplacesprocessproductproductionqualificationsqualityrecordsrelationships
SHARED TOKENS (23): "control", "controls", "defines", "descriptions", "entities", "involved", "knowledge", "maintain", "major", "management", "personnel", "physical", "places", "process", "product", "production", "qualifications", "quality", "records", "relationships".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Quality control". | EXACT TITLE in nuclear_clean_energy: "Quality control".
0.500
Wholesaling ↗ Q220695 EXACT TITLE
businessbusinessescommercialconsumerdirectlygeneralindustrialinstitutionalmarketmarketsorganizationpriceprofessionalpurchasingrateratherrelatedsourcetransactionwholesale
SHARED TOKENS (20): "business", "businesses", "commercial", "consumer", "directly", "general", "industrial", "institutional", "market", "markets", "organization", "price", "professional", "purchasing", "rate", "rather", "related", "source", "transaction", "wholesale". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wholesaling".
0.500
criticaldescribesdistincteconomygovernmentimportanceinfrastructurenationalprivateprotectionscopesectorsecurityspecialstrategic
SHARED TOKENS (15): "critical", "describes", "distinct", "economy", "government", "importance", "infrastructure", "national", "private", "protection", "scope", "sector", "security", "special", "strategic". | EXACT TITLE in nuclear_clean_energy: "Critical infrastructure".
0.500
actassociatedauthoritycontrolcurrentdepartmentdirectlyfederalfoodhealthhouseholdlaboratorypublicregulatedrelatedreportsresponsiblesafetyuseswork
SHARED TOKENS (20): "act", "associated", "authority", "control", "current", "department", "directly", "federal", "food", "health", "household", "laboratory", "public", "regulated", "related", "reports", "responsible", "safety", "uses", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food and Drug Administration".
0.500
Data center ↗ Q671224 EXACT TITLE
academicactalonearoundassociatedbuildingcenterconditionsconnectionconsumptioncontainscontroldatadefinesdemanddifferentedgeelectricalenvironmentalequipment
SHARED TOKENS (65): "academic", "act", "alone", "around", "associated", "building", "center", "conditions", "connection", "consumption", "contains", "control", "data", "defines", "demand", "different", "edge", "electrical", "environmental", "equipment".... | EXACT TITLE in nuclear_clean_energy: "Data center".
0.500
adoptedamendedauthoritycasescodecomplianceelectricalequipmentevenfederalfiregoverningjurisdictionlawlineslocalnationalpowerpracticesprivate
SHARED TOKENS (24): "adopted", "amended", "authority", "cases", "code", "compliance", "electrical", "equipment", "even", "federal", "fire", "governing", "jurisdiction", "law", "lines", "local", "national", "power", "practices", "private".... | EXACT TITLE in nuclear_clean_energy: "National Electrical Code".
0.490
americancustomersleastofficialregionseekspecific
SHARED TOKENS (7): "american", "customers", "least", "official", "region", "seek", "specific". | URL->A (1): https://www.ttb.gov/regulated-commodities/beverage-alcohol/wine/established-avas. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "American Viticultural Area".
0.480
Barrel ↗ Q10289 EXACT TITLE
americancenterdifferentgallonslargemodernoregonquantitysmallspacestoragestrongeruseswater
SHARED TOKENS (14): "american", "center", "different", "gallons", "large", "modern", "oregon", "quantity", "small", "space", "storage", "stronger", "uses", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barrel".
0.480
americanamongdifferenteducationfinalhistoryproductionprofessionalqualityrateratingscaletrustuses
SHARED TOKENS (14): "american", "among", "different", "education", "final", "history", "production", "professional", "quality", "rate", "rating", "scale", "trust", "uses". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer tasting".
0.480
certificationchainevaluationinformationinvolvedprocessprogramratingratingssourcestudysystemsystemsthough
SHARED TOKENS (14): "certification", "chain", "evaluation", "information", "involved", "process", "program", "rating", "ratings", "source", "study", "system", "systems", "though". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer rating".
0.480
aroundbusinessdistributionelectricalidahooperatesoregonplantspowerregulatedriversnakesoldwind
SHARED TOKENS (14): "around", "business", "distribution", "electrical", "idaho", "operates", "oregon", "plants", "power", "regulated", "river", "snake", "sold", "wind". | EXACT TITLE in nuclear_clean_energy: "Idaho Power".
0.480
americanboiseconsumercreateddatademandidahomajormarketproducedservedstoragetechnologytogether
SHARED TOKENS (14): "american", "boise", "consumer", "created", "data", "demand", "idaho", "major", "market", "produced", "served", "storage", "technology", "together". | EXACT TITLE in nuclear_clean_energy: "Micron Technology".
0.480
Wine ↗ Q282 EXACT TITLE
aroundbenefitsdifferentestablishedfoodgeneralgrowingproducedproductionqualityremainsrolesecondwestern
SHARED TOKENS (14): "around", "benefits", "different", "established", "food", "general", "growing", "produced", "production", "quality", "remains", "role", "second", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine".
0.480
Hops ↗ Q3214940 EXACT TITLE
aroundbenefitscommercialcommerciallydifferentdocumentseffectlaterplantplantsproductionseparatesourcethough
SHARED TOKENS (14): "around", "benefits", "commercial", "commercially", "different", "documents", "effect", "later", "plant", "plants", "production", "separate", "source", "though". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Hops".
0.460
becomeestablishedevaluationgeneralidentifyinginvolvingmodernpriceprocessproductionprofessionalregionspecialized
SHARED TOKENS (13): "become", "established", "evaluation", "general", "identifying", "involving", "modern", "price", "process", "production", "professional", "region", "specialized". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine tasting".
0.460
Viticulture ↗ Q253140 EXACT TITLE
datesdevelopmenthistoryinvolvedirrigationleastmanagementmodernprovidesciencesiteterritorywestern
SHARED TOKENS (13): "dates", "development", "history", "involved", "irrigation", "least", "management", "modern", "provide", "science", "site", "territory", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Viticulture".
0.460
currentdepartmentdevelopmentenvironmentalgovernmentnationalofficepowerregulatoryresearchresourcesecuritytechnical
SHARED TOKENS (13): "current", "department", "development", "environmental", "government", "national", "office", "power", "regulatory", "research", "resource", "security", "technical". | EXACT TITLE in nuclear_clean_energy: "Office of Nuclear Energy".
0.460
analysisdegreedemandfunctiongrowingneededplantsratherreceivingspecificvaluewastewaterwater
SHARED TOKENS (13): "analysis", "degree", "demand", "function", "growing", "needed", "plants", "rather", "receiving", "specific", "value", "wastewater", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Biochemical oxygen demand".
0.460
Kombucha ↗ Q657032 EXACT TITLE
approximatelybenefitscommercialcommerciallycontainsdistinguisheffectsgrowthhealthmarketproducedsmallsold
SHARED TOKENS (13): "approximately", "benefits", "commercial", "commercially", "contains", "distinguish", "effects", "growth", "health", "market", "produced", "small", "sold". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Kombucha".
0.440
Brewing ↗ Q869095 EXACT TITLE
additionalaroundclosedcommercialcostprocessproductionreducesourcewarmwaterwestern
SHARED TOKENS (12): "additional", "around", "closed", "commercial", "cost", "process", "production", "reduce", "source", "warm", "water", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Brewing".
0.440
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommunityindustrialmunicipalproducedsewerwastewaterwater
SHARED TOKENS (12): "activities", "agricultural", "another", "applications", "commercial", "community", "industrial", "municipal", "produced", "sewer", "wastewater", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wastewater". | EXACT TITLE in nuclear_clean_energy: "Wastewater".
0.440
Malt ↗ Q152024 EXACT TITLE
alreadycontainsconversionformformsprocessproductrequiredsinglesmallthoughwater
SHARED TOKENS (12): "already", "contains", "conversion", "form", "forms", "process", "product", "required", "single", "small", "though", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Malt".
0.440
Winery ↗ Q156362 EXACT TITLE
buildingbusinessequipmentfarmsinvolvedlargelargerlinesmakingproducesproductionproperty
SHARED TOKENS (12): "building", "business", "equipment", "farms", "involved", "large", "larger", "lines", "making", "produces", "production", "property". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Winery".
0.440
aprilcommercialcompleteconventionalcreatecurrentlydevelopedeconomyinterestmaterialsoperatingreduced
SHARED TOKENS (12): "april", "commercial", "complete", "conventional", "create", "currently", "developed", "economy", "interest", "materials", "operating", "reduced". | EXACT TITLE in nuclear_clean_energy: "Breeder reactor".
0.440
businesscurrentlycustomersdirectlymodelmodernonlineoperatephysicalplatformretailsales
SHARED TOKENS (12): "business", "currently", "customers", "directly", "model", "modern", "online", "operate", "physical", "platform", "retail", "sales". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Direct-to-consumer".
0.440
conservationconsumptionconversioneconomyelectricalpowerprocessproducespurposesourcetransportationwork
SHARED TOKENS (12): "conservation", "consumption", "conversion", "economy", "electrical", "power", "process", "produces", "purpose", "source", "transportation", "work". | EXACT TITLE in nuclear_clean_energy: "Energy efficiency".
0.440
americanfacilitiesindexjanuarynorthoperatesplantspowerproductionsharesuppliestechnology
SHARED TOKENS (12): "american", "facilities", "index", "january", "north", "operates", "plants", "power", "production", "share", "supplies", "technology". | EXACT TITLE in nuclear_clean_energy: "Ormat Technologies".
0.420
connectioncustomerequipmentfacilitieslawmarketsnetworkphysicalregulatoryrequirementstraffic
SHARED TOKENS (11): "connection", "customer", "equipment", "facilities", "law", "markets", "network", "physical", "regulatory", "requirements", "traffic". | EXACT TITLE in nuclear_clean_energy: "Interconnection".
0.420
codecoveringdepartmentestatefederallawresponsiblerevenuestatutorytaxtitle
SHARED TOKENS (11): "code", "covering", "department", "estate", "federal", "law", "responsible", "revenue", "statutory", "tax", "title". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Internal Revenue Code".
0.420
controlconventionaldegreeengineeringformphysicalprocessproductionsafetyscaletogether
SHARED TOKENS (11): "control", "conventional", "degree", "engineering", "form", "physical", "process", "production", "safety", "scale", "together". | EXACT TITLE in nuclear_clean_energy: "Microreactor".
0.410
Vivino ↗ Q17088880 EXACT TITLE
differentdownloadonline
SHARED TOKENS (3): "different", "download", "online". | URL->A (1): http://www.vivino.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Vivino".
0.400
buildingdecemberidaholabornationalplantspowerproducedresearchsufficient
SHARED TOKENS (10): "building", "december", "idaho", "labor", "national", "plants", "power", "produced", "research", "sufficient". | EXACT TITLE in nuclear_clean_energy: "Experimental Breeder Reactor I".
0.400
anotherapplicationcarbonengineeringgallonsgeneratepercentsciencesystemstogether
SHARED TOKENS (10): "another", "application", "carbon", "engineering", "gallons", "generate", "percent", "science", "systems", "together". | EXACT TITLE in nuclear_clean_energy: "Nuclear engineering".
0.400
benefitsdepartmentdevelopmenteconomicidahoinsurancelaborresponsibletechnologyworkforce
SHARED TOKENS (10): "benefits", "department", "development", "economic", "idaho", "insurance", "labor", "responsible", "technology", "workforce". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho Department of Labor". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Labor".
0.400
demandeducationfieldsheadquarteredofficeorganizationpacificprovidersresponsetrust
SHARED TOKENS (10): "demand", "education", "fields", "headquartered", "office", "organization", "pacific", "providers", "response", "trust". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine & Spirit Education Trust".
0.400
Rum ↗ Q83376 EXACT TITLE
americancreatedculturaleconomichistorymajorproducedregionroleserved
SHARED TOKENS (10): "american", "created", "cultural", "economic", "history", "major", "produced", "region", "role", "served". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Rum". | EXACT TITLE in nuclear_clean_energy: "Rum".
0.400
businessconsumptionestablishmentfoodretailserveservedservesservingwater
SHARED TOKENS (10): "business", "consumption", "establishment", "food", "retail", "serve", "served", "serves", "serving", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Bar (establishment)". | EXACT TITLE in nuclear_clean_energy: "Bar (establishment)".
0.380
Barley ↗ Q11577 EXACT TITLE
amongaroundmajormakingproducedproductionquantityrolesource
SHARED TOKENS (9): "among", "around", "major", "making", "produced", "production", "quantity", "role", "source". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barley".
0.380
americanapproximatelycomfeaturesheadquarteredonlineoperatespercentreviews
SHARED TOKENS (9): "american", "approximately", "com", "features", "headquartered", "online", "operates", "percent", "reviews". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Tripadvisor".
0.380
createdcreatingdepartmentidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (9): "created", "creating", "department", "idaho", "law", "municipal", "organization", "public", "statewide". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho State Police".
0.380
Restaurant ↗ Q11707 EXACT TITLE
businesscustomersdeliveryestablishmentfoodmodelsservedservessingle
SHARED TOKENS (9): "business", "customers", "delivery", "establishment", "food", "models", "served", "serves", "single". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Restaurant".
0.360
Gin ↗ Q959362 EXACT TITLE
basedevelopmentdistinctmodernnationalproducedprovidewater
SHARED TOKENS (8): "base", "development", "distinct", "modern", "national", "produced", "provide", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Gin". | EXACT TITLE in nuclear_clean_energy: "Gin".
0.360
commissioncustomersidahopowerprovidepublicregulateswater
SHARED TOKENS (8): "commission", "customers", "idaho", "power", "provide", "public", "regulates", "water". | EXACT TITLE in nuclear_clean_energy: "Idaho Public Utilities Commission".
0.360
Grape ↗ Q10978 EXACT TITLE
approximatelyculturalfoodformgrowinghistoryplantrole
SHARED TOKENS (8): "approximately", "cultural", "food", "form", "growing", "history", "plant", "role". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Grape".
0.340
Reservoir ↗ Q131681 EXACT TITLE
buildingcreatedformpowerspacestoragewater
SHARED TOKENS (7): "building", "created", "form", "power", "space", "storage", "water". | EXACT TITLE in nuclear_clean_energy: "Reservoir".
0.340
growinggrowthmarketretailsoldthoughtransport
SHARED TOKENS (7): "growing", "growth", "market", "retail", "sold", "though", "transport". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Growler (jug)".
0.340
activitiesconsumptionformsnearpurposesourcewhose
SHARED TOKENS (7): "activities", "consumption", "forms", "near", "purpose", "source", "whose". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine tourism".
0.340
Wine club ↗ Q8024922 EXACT TITLE
customersindependentmembershipmodernprogramprovidespecialty
SHARED TOKENS (7): "customers", "independent", "membership", "modern", "program", "provide", "specialty". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine club".
0.340
applicationconcreteformindustrialprocessprocessingprovide
SHARED TOKENS (7): "application", "concrete", "form", "industrial", "process", "processing", "provide". | EXACT TITLE in nuclear_clean_energy: "Process heat".
0.320
carboncontainsgeneratepowerproducessingle
SHARED TOKENS (6): "carbon", "contains", "generate", "power", "produces", "single". | EXACT TITLE in nuclear_clean_energy: "Nuclear fuel".
0.320
Keg ↗ Q947211 EXACT TITLE
carboninsidemaintainservesmalltransport
SHARED TOKENS (6): "carbon", "inside", "maintain", "serve", "small", "transport". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Keg".
0.320
Mead ↗ Q184442 EXACT TITLE
containsdistinctproducedproductrolewater
SHARED TOKENS (6): "contains", "distinct", "produced", "product", "role", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Mead".
0.320
establishedfoodmasterorganizationprofessionalstotal
SHARED TOKENS (6): "established", "food", "master", "organization", "professionals", "total". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Court of Master Sommeliers".
0.320
changesfoodprocessprocessingstudywater
SHARED TOKENS (6): "changes", "food", "process", "processing", "study", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food chemistry".
0.320
businesscontrollimitedlocalregionretail
SHARED TOKENS (6): "business", "control", "limited", "local", "region", "retail". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Liquor store".
0.300
businessescommunitiesconservationfarmshabitatmaintainingmissionorganizationpartnerspracticesprivateprogramspromotequalityspacestewardshipwashingtonwater
SHARED TOKENS (18): "businesses", "communities", "conservation", "farms", "habitat", "maintaining", "mission", "organization", "partners", "practices", "private", "programs", "promote", "quality", "space", "stewardship", "washington", "water".
0.300
accessassociatedconditionsdefinesdifferentenvironmentexternalfacilitiesinvolvingmaterialsoperatingplantspowerproposedprotectionpublicresearchresponsesafetysecurity
SHARED TOKENS (26): "access", "associated", "conditions", "defines", "different", "environment", "external", "facilities", "involving", "materials", "operating", "plants", "power", "proposed", "protection", "public", "research", "response", "safety", "security"....
0.300
amongapproximatelybehaviorclosureconcerningcontainscontrolconversioncostevaluationformationformshealthhighlyidentifiedmaintenancemanagementmaterialsmodelsnational
SHARED TOKENS (37): "among", "approximately", "behavior", "closure", "concerning", "contains", "control", "conversion", "cost", "evaluation", "formation", "forms", "health", "highly", "identified", "maintenance", "management", "materials", "models", "national"....
0.300
americanbuildingcommissioncontrolcostdevelopeddevelopmentdistrictdocumentsfacilitiesformationgeneralhighlyjanuarylaboratorylinesmajormaterialsnationalnetwork
SHARED TOKENS (39): "american", "building", "commission", "control", "cost", "developed", "development", "district", "documents", "facilities", "formation", "general", "highly", "january", "laboratory", "lines", "major", "materials", "national", "network"....
0.300
effectsevengrowingproducedremains
SHARED TOKENS (5): "effects", "even", "growing", "produced", "remains". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barrel-aged beer".
0.300
affectingaverageconditionsconstraintsdifferentelectricalhourslocalmaintenancemarketoperationoperationalplantpotentiallypowerproducingproductionreducedregulatoryrelevant
SHARED TOKENS (23): "affecting", "average", "conditions", "constraints", "different", "electrical", "hours", "local", "maintenance", "market", "operation", "operational", "plant", "potentially", "power", "producing", "production", "reduced", "regulatory", "relevant"....
0.300
departmentfacilitygovernmentidaholaboratorynationalnorthwestoperateoperatespersonnelplantspowerprocessingreceivingremainingstoragesupportedtestingtraining
SHARED TOKENS (19): "department", "facility", "government", "idaho", "laboratory", "national", "northwest", "operate", "operates", "personnel", "plants", "power", "processing", "receiving", "remaining", "storage", "supported", "testing", "training".
0.300
Nuclear reactor ↗ Q80877 KW CROSS HIGH
chaincommercialcontrolledcostcriticaldevelopeddiscoverydistricteffectselectricalindustriallaboratorymajoroperationoperatorplantpotentiallypowerproductionprograms
SHARED TOKENS (29): "chain", "commercial", "controlled", "cost", "critical", "developed", "discovery", "district", "effects", "electrical", "industrial", "laboratory", "major", "operation", "operator", "plant", "potentially", "power", "production", "programs"....
0.300
applicationschainconservationconsumptioncoolingcostdefinesdemanddistrictformgrowthinfluenceintegratedinterestlawplanningplantspowerprocessproduction
SHARED TOKENS (25): "applications", "chain", "conservation", "consumption", "cooling", "cost", "defines", "demand", "district", "form", "growth", "influence", "integrated", "interest", "law", "planning", "plants", "power", "process", "production"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
annualarrangementconnectioncurrentdecemberevenfeegeneratelatermechanismpowerprivaterequirerequiresretailsinglesmallsolelyspecialstorage
SHARED TOKENS (23): "annual", "arrangement", "connection", "current", "december", "even", "fee", "generate", "later", "mechanism", "power", "private", "require", "requires", "retail", "single", "small", "solely", "special", "storage"....
0.300
aprilaroundauthoritybasecapitalcostdemandhoursperiodsplacesplantplantspowerpricereducedreplacesecondstoragesupply
SHARED TOKENS (19): "april", "around", "authority", "base", "capital", "cost", "demand", "hours", "periods", "places", "plant", "plants", "power", "price", "reduced", "replace", "second", "storage", "supply".
0.300
applicationbuildingbusinesscorporatedevelopmentdifferentenvironmentidentifyinginterestinvolvedknowledgemanagementmarketorganizationspermitsplanningprocessproductionpublicrelationships
SHARED TOKENS (27): "application", "building", "business", "corporate", "development", "different", "environment", "identifying", "interest", "involved", "knowledge", "management", "market", "organizations", "permits", "planning", "process", "production", "public", "relationships"....
0.300
applicationsaveragecentralcontrolcreatecreatedenvironmentequipmentfacilitieshighlyindustrialinsideintegratedlargemaintainmanufacturingmaterialsmodernplantsprocess
SHARED TOKENS (30): "applications", "average", "central", "control", "create", "created", "environment", "equipment", "facilities", "highly", "industrial", "inside", "integrated", "large", "maintain", "manufacturing", "materials", "modern", "plants", "process"....
0.300
authoritybecomechangesenvironmentalevenfacilitieslargeleastnationportfoliopowerproducedprojectsrequiresresourceriversectorsourcespecificthough
SHARED TOKENS (24): "authority", "become", "changes", "environmental", "even", "facilities", "large", "least", "nation", "portfolio", "power", "produced", "projects", "requires", "resource", "river", "sector", "source", "specific", "though"....
0.300
approximatelyaroundcommercialconnectedcostdecemberdevelopeddevelopmententerfacilitiesleastmakingmodelsoperateoperationoperationalorganizationpotentiallypowerproduction
SHARED TOKENS (30): "approximately", "around", "commercial", "connected", "cost", "december", "developed", "development", "enter", "facilities", "least", "making", "models", "operate", "operation", "operational", "organization", "potentially", "power", "production"....
0.300
acresactbecomecurrentlydeliverydepartmentdevelopmentestablishedfederalgovernmentirrigationjunelawmanagementnationoperationpowerprogramprojectsprovisions
SHARED TOKENS (28): "acres", "act", "become", "currently", "delivery", "department", "development", "established", "federal", "government", "irrigation", "june", "law", "management", "nation", "operation", "power", "program", "projects", "provisions"....
0.300
anotherarrangementbecomechainconsolidationdescribeddifferentdirectlyeconomyfinalintegratedlargemakingmanagementmarketneededownershippoliticalportionsproduced
SHARED TOKENS (29): "another", "arrangement", "become", "chain", "consolidation", "described", "different", "directly", "economy", "final", "integrated", "large", "making", "management", "market", "needed", "ownership", "political", "portions", "produced"....
0.300
Terroir ↗ Q627003 KW CROSS HIGH
affectaffectingaroundcropenvironmentenvironmentalfarminggrowinggrowthhabitatlandmodelplantspracticesqualityregulationsinglesitespecificsystem
SHARED TOKENS (20): "affect", "affecting", "around", "crop", "environment", "environmental", "farming", "growing", "growth", "habitat", "land", "model", "plants", "practices", "quality", "regulation", "single", "site", "specific", "system".
0.300
actamericanappliesbasecommunitycomplianceconsumptioncurrentlydistributiondistrictdriverseffectfacilityfederalfinalgallonsgovernmenthourshouseholdjurisdiction
SHARED TOKENS (51): "act", "american", "applies", "base", "community", "compliance", "consumption", "currently", "distribution", "district", "drivers", "effect", "facility", "federal", "final", "gallons", "government", "hours", "household", "jurisdiction"....
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalallowedapplicationscarbonclimatecommerciallyconstraintsconversioncostcoveringcurrentdemanddirectdistributioneartheffectelectricalfixedgenerategovernment
SHARED TOKENS (50): "additional", "allowed", "applications", "carbon", "climate", "commercially", "constraints", "conversion", "cost", "covering", "current", "demand", "direct", "distribution", "earth", "effect", "electrical", "fixed", "generate", "government"....
0.300
actactivitiesadministrativecommissiondepartmentdevelopmentestablishedfacilitiesfederalfunctionslaborlaterlawmajormaterialsnoticepowerproductionregulationregulatory
SHARED TOKENS (27): "act", "activities", "administrative", "commission", "department", "development", "established", "facilities", "federal", "functions", "labor", "later", "law", "major", "materials", "notice", "power", "production", "regulation", "regulatory"....
0.300
additionalbuildingconservationcreatedcurrentdepartmentdevelopmentdirectlyfederalgovernmentnationalphysicalpowerproductionprogramreportsresearchscienceservedsystem
SHARED TOKENS (21): "additional", "building", "conservation", "created", "current", "department", "development", "directly", "federal", "government", "national", "physical", "power", "production", "program", "reports", "research", "science", "served", "system"....
0.300
americanconcretecontrolidahoirrigationitselfnearoriginalpowerrecreationresidentsriversecondsnakestructurewestern
SHARED TOKENS (16): "american", "concrete", "control", "idaho", "irrigation", "itself", "near", "original", "power", "recreation", "residents", "river", "second", "snake", "structure", "western".
0.300
Cogeneration ↗ Q221620 KW CROSS HIGH
buildingcentralcoolingcostdistributeddistrictelectricalgeneratelargeofficeoperationsplantspopulationpowerprocesssafetysmallspacesupplywater
SHARED TOKENS (20): "building", "central", "cooling", "cost", "distributed", "district", "electrical", "generate", "large", "office", "operations", "plants", "population", "power", "process", "safety", "small", "space", "supply", "water".
0.300
changescommercialcontrolledcurrentcurrentlydevelopeddifferentdirecteconomyformlinesmodernnetworkpowerrapidrequiresourcesystemsystemstechnology
SHARED TOKENS (22): "changes", "commercial", "controlled", "current", "currently", "developed", "different", "direct", "economy", "form", "lines", "modern", "network", "power", "rapid", "require", "source", "system", "systems", "technology"....
0.300
accessbecomecarryconnectedconnectingcurrentcustomersdeliverydistributionelectricalgrowinglargemarketsneedednetworkoperatepopulationpowerrequiredsecurity
SHARED TOKENS (23): "access", "become", "carry", "connected", "connecting", "current", "customers", "delivery", "distribution", "electrical", "growing", "large", "markets", "needed", "network", "operate", "population", "power", "required", "security"....
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcommissionconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentitiesfederalgoverned
SHARED TOKENS (43): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "commission", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entities", "federal", "governed"....
0.300
casescommunitiesconnectedcontrolcustomerdatafeesinfluencelinesmanagementmarketsonlineorganizationsproductrelatedreputationreviewspacesystems
SHARED TOKENS (19): "cases", "communities", "connected", "control", "customer", "data", "fees", "influence", "lines", "management", "markets", "online", "organizations", "product", "related", "reputation", "review", "space", "systems".
0.300
administrativeanotherclosurecompletecontrolenvironmentfacilitiesfacilityfinalgrowingindustriallicensematerialsoperatingownerplantprocessprotectionregulatoryremains
SHARED TOKENS (30): "administrative", "another", "closure", "complete", "control", "environment", "facilities", "facility", "final", "growing", "industrial", "license", "materials", "operating", "owner", "plant", "process", "protection", "regulatory", "remains"....
0.300
acresagriculturalagriculturedifferenteconomyfarmsfoodidaholandnationprocessingproducesproductionrolesalessecondsector
SHARED TOKENS (17): "acres", "agricultural", "agriculture", "different", "economy", "farms", "food", "idaho", "land", "nation", "processing", "produces", "production", "role", "sales", "second", "sector".
0.300
buildingcontainscontrolcontrolledcostcreatecriticaldeliverydischargeelectricalenvironmentequipmentevenfeaturesintegrateditselfmanufacturingmodelofficeoutside
SHARED TOKENS (31): "building", "contains", "control", "controlled", "cost", "create", "critical", "delivery", "discharge", "electrical", "environment", "equipment", "even", "features", "integrated", "itself", "manufacturing", "model", "office", "outside"....
0.300
Distillation ↗ Q101017 KW CROSS HIGH
applicationsapproximatelychangesconsumptionenvironmentalidentifiesindustriallargematerialsmechanismoperateoperatesoperationoperationsphysicalprocessproducesproducingreducerequires
SHARED TOKENS (23): "applications", "approximately", "changes", "consumption", "environmental", "identifies", "industrial", "large", "materials", "mechanism", "operate", "operates", "operation", "operations", "physical", "process", "produces", "producing", "reduce", "requires"....
0.300
Solar inverter ↗ Q129316 KW CROSS HIGH
commercialconvertscriticalcurrentdirectelectricalequipmentfunctionslocalnetworkordinarypowerprotectionspecialsystem
SHARED TOKENS (15): "commercial", "converts", "critical", "current", "direct", "electrical", "equipment", "functions", "local", "network", "ordinary", "power", "protection", "special", "system".
0.300
connectscurrentcustomersdeliverydirectdirectlydistinctdistributionelectricalevenformlineslocalmajormarketnetworknorthplantpowerreduced
SHARED TOKENS (25): "connects", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "electrical", "even", "form", "lines", "local", "major", "market", "network", "north", "plant", "power", "reduced"....
0.300
activitiesactivityanalysiscarrycasesengineeringenvironmentestablishedgeneralgovernmentlegallicenselicensedlocalmaintenanceprocessproductprofessionalprojectsproperty
SHARED TOKENS (31): "activities", "activity", "analysis", "carry", "cases", "engineering", "environment", "established", "general", "government", "legal", "license", "licensed", "local", "maintenance", "process", "product", "professional", "projects", "property"....
0.300
actadministeredchangesconservationcontroldirectlyenvironmentalfederalformgoverninginvolvinglawmaintainmaintainingmajormodernnationphysicalprotectionprovisions
SHARED TOKENS (25): "act", "administered", "changes", "conservation", "control", "directly", "environmental", "federal", "form", "governing", "involving", "law", "maintain", "maintaining", "major", "modern", "nation", "physical", "protection", "provisions"....
0.300
actconditionsdecemberdepartmenteducationeffectsemploymentestablishedfederalhealthlaborlawmissionratingsreduceregulatorysafetysalestraining
SHARED TOKENS (19): "act", "conditions", "december", "department", "education", "effects", "employment", "established", "federal", "health", "labor", "law", "mission", "ratings", "reduce", "regulatory", "safety", "sales", "training".
0.300
aroundconsumerconventionaldemandelectricalformmarketperiodsplantplantspowerprocesspumpsreportedrevenueriversmallstoragesystemsystems
SHARED TOKENS (23): "around", "consumer", "conventional", "demand", "electrical", "form", "market", "periods", "plant", "plants", "power", "process", "pumps", "reported", "revenue", "river", "small", "storage", "system", "systems"....
0.300
associatedbeyondcontrolledcostfacilitiesformhighlypersonnelpotentiallypowerprocessproducingproductprogramregulatedrequiresresearchsolelyspecializedsupply
SHARED TOKENS (21): "associated", "beyond", "controlled", "cost", "facilities", "form", "highly", "personnel", "potentially", "power", "process", "producing", "product", "program", "regulated", "requires", "research", "solely", "specialized", "supply"....
0.300
agreementassetsbuildingbusinessbusinessescommercialcontractcustomerdirectlydistributedfarmsfirmsfixedformgovernmentmaintainsmarketpowerpricequantity
SHARED TOKENS (27): "agreement", "assets", "building", "business", "businesses", "commercial", "contract", "customer", "directly", "distributed", "farms", "firms", "fixed", "form", "government", "maintains", "market", "power", "price", "quantity"....
0.300
academicanotherbecomebehaviorcurrentlydevelopeddevelopmentdiscoveryformsgatewayinformationinterestlargemaintenancemajornewsonlineoperateoperatorsplatform
SHARED TOKENS (31): "academic", "another", "become", "behavior", "currently", "developed", "development", "discovery", "forms", "gateway", "information", "interest", "large", "maintenance", "major", "news", "online", "operate", "operators", "platform"....
0.300
commissioncreateddepartmentfederalgovernmentindependentlicensingpipelinepoliticalprojectsregulatesregulatoryreviewsservingstoragetransportwholesale
SHARED TOKENS (17): "commission", "created", "department", "federal", "government", "independent", "licensing", "pipeline", "political", "projects", "regulates", "regulatory", "reviews", "serving", "storage", "transport", "wholesale".
0.300
activitiesalreadycategoriescontainscoolingcreatedcurrentcurrentlydependsdevelopedeartheconomicenvironmentgovernmenthealthhighlyinventorymanagementmaterialsplants
SHARED TOKENS (33): "activities", "already", "categories", "contains", "cooling", "created", "current", "currently", "depends", "developed", "earth", "economic", "environment", "government", "health", "highly", "inventory", "management", "materials", "plants"....
0.300
actcommissiondatadescribeddevelopmentfacilitiesfederalgovernmentinformationlawmaterialsprivateproductionprogramprovisionsregulationregulatorytechnicaluses
SHARED TOKENS (19): "act", "commission", "data", "described", "development", "facilities", "federal", "government", "information", "law", "materials", "private", "production", "program", "provisions", "regulation", "regulatory", "technical", "uses".
0.300
alongsideamongchangesconsumptioncreatedifferenteffectlawlegallegallylimitsplacesprivatepublicpurchasingreduceservedspecial
SHARED TOKENS (18): "alongside", "among", "changes", "consumption", "create", "different", "effect", "law", "legal", "legally", "limits", "places", "private", "public", "purchasing", "reduce", "served", "special".
0.300
aroundconnectioncontrolcoolingcostcustomerdeliverdemandelectricalevenextendingfacilityformgrowinghoursinsidelargeoperatingplantspower
SHARED TOKENS (34): "around", "connection", "control", "cooling", "cost", "customer", "deliver", "demand", "electrical", "even", "extending", "facility", "form", "growing", "hours", "inside", "large", "operating", "plants", "power"....
0.300
activitiesamongbuildingbusinessescapitalchainconsumptioncontrolcreatingcustomersdemanddepartmentdevelopeddistributionfunctionsinformationinfrastructureintegratedinventorymanagement
SHARED TOKENS (41): "activities", "among", "building", "businesses", "capital", "chain", "consumption", "control", "creating", "customers", "demand", "department", "developed", "distribution", "functions", "information", "infrastructure", "integrated", "inventory", "management"....
0.300
aloneapplicationsaroundcarboncostdemandmarketmodeloperatingpowerproductionsafetysharespecificvalue
SHARED TOKENS (15): "alone", "applications", "around", "carbon", "cost", "demand", "market", "model", "operating", "power", "production", "safety", "share", "specific", "value".
0.300
acresactamericanamongapproximatelyconservationcreateddepartmentdescribedestatefederalgeneralgovernmentheadquarteredhealthidaholandmanagementmissionnational
SHARED TOKENS (31): "acres", "act", "american", "among", "approximately", "conservation", "created", "department", "described", "estate", "federal", "general", "government", "headquartered", "health", "idaho", "land", "management", "mission", "national"....
0.300
aroundchangescustomersdemanddistributionelectricalintegratedlargemanagementmarketmarketsoperatepowerpublicpurchasingreduceregulatedsidesoldsupply
SHARED TOKENS (21): "around", "changes", "customers", "demand", "distribution", "electrical", "integrated", "large", "management", "market", "markets", "operate", "power", "public", "purchasing", "reduce", "regulated", "side", "sold", "supply"....
0.300
Vineyard ↗ Q22715 EXACT TITLE
itselfproductionsciencespecificstudy
SHARED TOKENS (5): "itself", "production", "science", "specific", "study". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Vineyard".
0.300
additionalagriculturalapplicationsconditionscostdepartmentdistrictearthestimatedformationindustrialnearplantplantspowerratereduceresourcessourcespace
SHARED TOKENS (22): "additional", "agricultural", "applications", "conditions", "cost", "department", "district", "earth", "estimated", "formation", "industrial", "near", "plant", "plants", "power", "rate", "reduce", "resources", "source", "space"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
agreementclimateconnectedcurrentlyelectricalenvironmentfarmsgenerateplantspowerproducedsharesourcestoragesupplywindwork
SHARED TOKENS (17): "agreement", "climate", "connected", "currently", "electrical", "environment", "farms", "generate", "plants", "power", "produced", "share", "source", "storage", "supply", "wind", "work".
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
codeconnectconsumptioncontrolcreatecurrentdeliverydemanddescribeddistributeddistributionelectricalevenfunctiongeneralhighlyhoursinformationinfrastructureintegrated
SHARED TOKENS (51): "code", "connect", "consumption", "control", "create", "current", "delivery", "demand", "described", "distributed", "distribution", "electrical", "even", "function", "general", "highly", "hours", "information", "infrastructure", "integrated"....
0.300
associatedbusinessescasesdeterminedistributioneconomiceconomicsemploymententryfirmsfunctionindustriallandlawmarketorganizationpowerproducesproductionproposed
SHARED TOKENS (33): "associated", "businesses", "cases", "determine", "distribution", "economic", "economics", "employment", "entry", "firms", "function", "industrial", "land", "law", "market", "organization", "power", "produces", "production", "proposed"....
0.300
acresactivityadaamericanapproximatelyboisecenterclimatecountieseagleestablishedgrowingidaholiesnationnorthnorthwestproposedregionriver
SHARED TOKENS (24): "acres", "activity", "ada", "american", "approximately", "boise", "center", "climate", "counties", "eagle", "established", "growing", "idaho", "lies", "nation", "north", "northwest", "proposed", "region", "river"....
0.300
analysisaroundbuildingcommercialdistributedelectricalenvironmentequipmentformindustriallargemanagementpowerresidentialscalesmallstoragestructurestudysystem
SHARED TOKENS (21): "analysis", "around", "building", "commercial", "distributed", "electrical", "environment", "equipment", "form", "industrial", "large", "management", "power", "residential", "scale", "small", "storage", "structure", "study", "system"....
0.300
apprenticeshipapproximatelycostdatadeliverelectricalfieldsgovernmentinsidelabornationalprogramspublicrelatedtrainingworkworkers
SHARED TOKENS (17): "apprenticeship", "approximately", "cost", "data", "deliver", "electrical", "fields", "government", "inside", "labor", "national", "programs", "public", "related", "training", "work", "workers".
0.300
actauthoritycostdocumentsfederalfoodguidancejanuarylawleastlegalmajorreportedreportsrequiressafetysalesstrategies
SHARED TOKENS (18): "act", "authority", "cost", "documents", "federal", "food", "guidance", "january", "law", "least", "legal", "major", "reported", "reports", "requires", "safety", "sales", "strategies".
0.300
amongcoldcoolingearthhvaclargeloopsnorthprovidepumpsrequirementsourcesystemsystemstransferwater
SHARED TOKENS (16): "among", "cold", "cooling", "earth", "hvac", "large", "loops", "north", "provide", "pumps", "requirement", "source", "system", "systems", "transfer", "water".
0.300
aroundcasesclassificationcodecurrentlydifferentdistinguishexpandedfitformindicatinglinessequencestarsystem
SHARED TOKENS (15): "around", "cases", "classification", "code", "currently", "different", "distinguish", "expanded", "fit", "form", "indicating", "lines", "sequence", "star", "system".
0.300
agriculturalagriculturealliancebusinesscertificationcertifiedchangesclimatecodecommunityconditionsconventionalconversioncreatecropdownstreameffectsenvironmentenvironmentalfarming
SHARED TOKENS (35): "agricultural", "agriculture", "alliance", "business", "certification", "certified", "changes", "climate", "code", "community", "conditions", "conventional", "conversion", "create", "crop", "downstream", "effects", "environment", "environmental", "farming"....
0.300
actapproximatelycoveragedescribedenvironmentalestablishesfacilitiesfederalgeneralgovernmentgovernslawpowerpriceprivateproductionpublicpurposestudysystem
SHARED TOKENS (20): "act", "approximately", "coverage", "described", "environmental", "establishes", "facilities", "federal", "general", "government", "governs", "law", "power", "price", "private", "production", "public", "purpose", "study", "system".
0.300
aroundconservationdecemberdepartmenteducationenvironmentalestablishingestablishmentfederalfederallygovernmentindependentinformationjanuarylegallocalmaintainingmattersnationaloperation
SHARED TOKENS (29): "around", "conservation", "december", "department", "education", "environmental", "establishing", "establishment", "federal", "federally", "government", "independent", "information", "january", "legal", "local", "maintaining", "matters", "national", "operation"....
0.300
Food science ↗ Q1637030 KW CROSS HIGH
agriculturalcentraldevelopmentdirectlyevaluationfoodmaterialsmodernpracticesprocessingproductionsafetysciencescopestudytechnologytesting
SHARED TOKENS (17): "agricultural", "central", "development", "directly", "evaluation", "food", "materials", "modern", "practices", "processing", "production", "safety", "science", "scope", "study", "technology", "testing".
0.300
americanaprilaveragecentercentralconditionscurrentlydecemberdevelopmentexpandedfarmsfederalgovernmentgrowthjanuarynationnorthpermittingportfoliopower
SHARED TOKENS (28): "american", "april", "average", "center", "central", "conditions", "currently", "december", "development", "expanded", "farms", "federal", "government", "growth", "january", "nation", "north", "permitting", "portfolio", "power"....
0.300
alongsideaveragecategorychaincommercialdeliverhighlyhistoricallaboratorymaintainnationaloperationalpowerproposedrequirerequiresresearchsourcesystemstotal
SHARED TOKENS (20): "alongside", "average", "category", "chain", "commercial", "deliver", "highly", "historical", "laboratory", "maintain", "national", "operational", "power", "proposed", "require", "requires", "research", "source", "systems", "total".
0.300
actactivitiesadministeredadministrativeamendedamongassociatedbenefitscarryclimatecontrolcreateenvironmentalfacilitiesfederalindustriallawlayerlocalmajor
SHARED TOKENS (33): "act", "activities", "administered", "administrative", "amended", "among", "associated", "benefits", "carry", "climate", "control", "create", "environmental", "facilities", "federal", "industrial", "law", "layer", "local", "major"....
0.300
distributionentitiesfacilitiesinfrastructurelocalmajormarketmarketsnationaloperatepowerproviderspublicregulatedregulation
SHARED TOKENS (15): "distribution", "entities", "facilities", "infrastructure", "local", "major", "market", "markets", "national", "operate", "power", "providers", "public", "regulated", "regulation".
0.300
accessboisecanyonconcretecontainsfinalidahoinformationnationoregonpowerriversnaketotalwestern
SHARED TOKENS (15): "access", "boise", "canyon", "concrete", "contains", "final", "idaho", "information", "nation", "oregon", "power", "river", "snake", "total", "western".
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactivitiesadditionaladministeredapproximatelyauthorizesbusinessconservationcontainscontrolscostcreatedculturaldepartmentdetermineenvironmentenvironmentalestablishedfederal
SHARED TOKENS (55): "acquisition", "act", "activities", "additional", "administered", "approximately", "authorizes", "business", "conservation", "contains", "controls", "cost", "created", "cultural", "department", "determine", "environment", "environmental", "established", "federal"....
0.300
actaroundauthoritycreateddecemberdecisionseffectsenvironmentenvironmentalestablishedfederalfinalgovernmentjanuarylawnationalpromoteproposedqualityrecognizes
SHARED TOKENS (25): "act", "around", "authority", "created", "december", "decisions", "effects", "environment", "environmental", "established", "federal", "final", "government", "january", "law", "national", "promote", "proposed", "quality", "recognizes"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesschaincommercialdatainventorymanagementonlineplatformsprocessingretailsegmentsupplysystemstransactiontransfer
SHARED TOKENS (16): "activities", "business", "chain", "commercial", "data", "inventory", "management", "online", "platforms", "processing", "retail", "segment", "supply", "systems", "transaction", "transfer".
0.300
activityannualapplicationapplicationsapproximatelyaroundcoldconsumptioncontainsconversiondirectearthevenformationneededoriginalsourcetotal
SHARED TOKENS (18): "activity", "annual", "application", "applications", "approximately", "around", "cold", "consumption", "contains", "conversion", "direct", "earth", "even", "formation", "needed", "original", "source", "total".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
adoptedauthoritybuildingcodecompliancecontroldepartmentsdistricteffectselectricalenvironmentalestatefacilitygeneralhealthinsurancejurisdictionlawlocalmanagers
SHARED TOKENS (35): "adopted", "authority", "building", "code", "compliance", "control", "departments", "district", "effects", "electrical", "environmental", "estate", "facility", "general", "health", "insurance", "jurisdiction", "law", "local", "managers"....
0.300
allowedapproximatelycolddevelopeddirectlyelectricalformgeneralinsidelaboratorynationalplantpowerriversecondsourcewater
SHARED TOKENS (17): "allowed", "approximately", "cold", "developed", "directly", "electrical", "form", "general", "inside", "laboratory", "national", "plant", "power", "river", "second", "source", "water".
0.300
authoritybecomeconditionscontroldirectlydistributionentitiesformgovernmentindependentinventoryitselflawoperatingprivateratherremainsrequirestructuresystem
SHARED TOKENS (23): "authority", "become", "conditions", "control", "directly", "distribution", "entities", "form", "government", "independent", "inventory", "itself", "law", "operating", "private", "rather", "remains", "require", "structure", "system"....
0.300
appliesdescribesdischargeenvironmentfacilitiesfoodgenerateindustrialmanufacturingmaterialsmunicipalplantspowerprocessproducedproductionreducesewerspecializedsystem
SHARED TOKENS (23): "applies", "describes", "discharge", "environment", "facilities", "food", "generate", "industrial", "manufacturing", "materials", "municipal", "plants", "power", "process", "produced", "production", "reduce", "sewer", "specialized", "system"....
0.300
Rosé ↗ Q12979 KW CROSS HIGH
allowedaroundconcentratedevenfinalgrowinghighlyhoursinvolvedlawmajormakingproducedproductratherreducedremainremainingseparately
SHARED TOKENS (19): "allowed", "around", "concentrated", "even", "final", "growing", "highly", "hours", "involved", "law", "major", "making", "produced", "product", "rather", "reduced", "remain", "remaining", "separately".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
agreementanotherarrangementbusinesscapitalchainconditionscorporatedirecteconomiceffectexpansionfeesgrowthhighlyindirectlargelegallicensingmarket
SHARED TOKENS (30): "agreement", "another", "arrangement", "business", "capital", "chain", "conditions", "corporate", "direct", "economic", "effect", "expansion", "fees", "growth", "highly", "indirect", "large", "legal", "licensing", "market"....
0.300
anotherbeyondconnectedcostdemandeconomiceconomicselectricalformformshourslargelatermakingmanagementneededplantspowerpriceproduced
SHARED TOKENS (28): "another", "beyond", "connected", "cost", "demand", "economic", "economics", "electrical", "form", "forms", "hours", "large", "later", "making", "management", "needed", "plants", "power", "price", "produced"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorychangescontroldescribeddevelopmentexpansionfirmsgenerallimitedmanagementoperationalownershipprivateproductprovidepublicratherrole
SHARED TOKENS (24): "business", "capital", "category", "changes", "control", "described", "development", "expansion", "firms", "general", "limited", "management", "operational", "ownership", "private", "product", "provide", "public", "rather", "role"....
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesagriculturalassociatedchaincoldconsumptiondistributeddistributionequipmentfoodmaintainmanagementproductionqualityrequiressafetysequencestoragesupplyuses
SHARED TOKENS (20): "activities", "agricultural", "associated", "chain", "cold", "consumption", "distributed", "distribution", "equipment", "food", "maintain", "management", "production", "quality", "requires", "safety", "sequence", "storage", "supply", "uses".
0.300
activitiesbehavioreartheconomicseconomyengineeringenvironmentexaminingfunctiongrowingindustrialintegratedinvolvingmodernnetworkresearchresourcessoldstudysupply
SHARED TOKENS (23): "activities", "behavior", "earth", "economics", "economy", "engineering", "environment", "examining", "function", "growing", "industrial", "integrated", "involving", "modern", "network", "research", "resources", "sold", "study", "supply"....
0.300
Vitis vinifera ↗ Q30046 KW CROSS HIGH
aroundcentralclassificationscommercialeastformformsmajornorthplantplantsproducedproductionregionrequiredseparatethough
SHARED TOKENS (17): "around", "central", "classifications", "commercial", "east", "form", "forms", "major", "north", "plant", "plants", "produced", "production", "region", "required", "separate", "though".
0.300
constraintsconvertscostcurrentdirectdirectlyelectricalequipmentlargermodernpowerproviderequiressuppliessupply
SHARED TOKENS (15): "constraints", "converts", "cost", "current", "direct", "directly", "electrical", "equipment", "larger", "modern", "power", "provide", "requires", "supplies", "supply".
🫐 BERRY63 edges
0.280
activityagricultureinvolvingoperation
SHARED TOKENS (4): "activity", "agriculture", "involving", "operation". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Agritourism".
0.280
Sommelier ↗ Q191493 EXACT TITLE
foodprofessionalrolespecialized
SHARED TOKENS (4): "food", "professional", "role", "specialized". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sommelier".
0.280
applicationsconventionalcurrentlydevelopmentoperatesoperatingoperationplantpotentiallypowerprocessproductionproposeduses
SHARED TOKENS (14): "applications", "conventional", "currently", "development", "operates", "operating", "operation", "plant", "potentially", "power", "process", "production", "proposed", "uses".
0.280
Oak (wine) ↗ Q808963 EXACT TITLE
formmakingperiodsprofile
SHARED TOKENS (4): "form", "making", "periods", "profile". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Oak (wine)".
0.260
agriculturalagriculturedepartmentfoodgovernmentidaholandlicensingmanagementprogramresponsiblesafetystate-level
SHARED TOKENS (13): "agricultural", "agriculture", "department", "food", "government", "idaho", "land", "licensing", "management", "program", "responsible", "safety", "state-level".
0.260
approximatelyboisedatadistrictevengovernmentidaholimitsnorthpopulationresidentssinglewashington
SHARED TOKENS (13): "approximately", "boise", "data", "district", "even", "government", "idaho", "limits", "north", "population", "residents", "single", "washington".
0.260
aroundassociatedcommercialconnectedinsidemaintainoperateoriginalplantpowersecondservewater
SHARED TOKENS (13): "around", "associated", "commercial", "connected", "inside", "maintain", "operate", "original", "plant", "power", "second", "serve", "water".
0.260
aroundoutsidewater
SHARED TOKENS (3): "around", "outside", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Hard seltzer".
0.260
actallowedamendedaprildistrictestablishedfederalhighlyjurisdictionlawleastnationalprogram
SHARED TOKENS (13): "act", "allowed", "amended", "april", "district", "established", "federal", "highly", "jurisdiction", "law", "least", "national", "program".
0.260
departmentregulatestax
SHARED TOKENS (3): "department", "regulates", "tax". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Alcohol and Tobacco Tax and Trade Bureau".
0.260
functionroutesystem
SHARED TOKENS (3): "function", "route", "system". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Distributor".
0.260
distributionfooduses
SHARED TOKENS (3): "distribution", "food", "uses". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Glass bottle".
0.260
americanconsumptiongallonslargermarketnorthproducedproducingrankedsalessecondsmalltotal
SHARED TOKENS (13): "american", "consumption", "gallons", "larger", "market", "north", "produced", "producing", "ranked", "sales", "second", "small", "total".
0.260
eastregionwestern
SHARED TOKENS (3): "east", "region", "western". | EXACT TITLE in nuclear_clean_energy: "Intermountain West".
0.240
Nuclear fusion ↗ Q13082 KW CROSS HIGH
amongapplicationsconditionsformlargelargerpowerprocessproducesproductproductionrequire
SHARED TOKENS (12): "among", "applications", "conditions", "form", "large", "larger", "power", "process", "produces", "product", "production", "require".
0.240
Pasteurization ↗ Q58148 KW CROSS HIGH
changesdirectfoodindirectprocessprocessingqualityresearchsafetysystemwaterwhose
SHARED TOKENS (12): "changes", "direct", "food", "indirect", "process", "processing", "quality", "research", "safety", "system", "water", "whose".
0.240
academicbusinesscollegedegreedepartmentmanagementmasterorganizationsrelevantstudysubjectuniversity
SHARED TOKENS (12): "academic", "business", "college", "degree", "department", "management", "master", "organizations", "relevant", "study", "subject", "university".
0.240
Cider mill ↗ Q5119518 KW CROSS HIGH
casesequipmentfixedlegalmakingnearportableproductionpropertystructuresubjectwater
SHARED TOKENS (12): "cases", "equipment", "fixed", "legal", "making", "near", "portable", "production", "property", "structure", "subject", "water".
0.240
facilitiesgenerateindependentindustrialoperatespowerprocesspublicruralsystemwaterwind
SHARED TOKENS (12): "facilities", "generate", "independent", "industrial", "operates", "power", "process", "public", "rural", "system", "water", "wind".
0.220
Solar tracker ↗ Q938237 KW CROSS HIGH
applicationsconcentrateddirectfixedmarketplacespowerproducedprojectssystemstherefore
SHARED TOKENS (11): "applications", "concentrated", "direct", "fixed", "market", "places", "power", "produced", "projects", "systems", "therefore".
0.220
associatedboisecentercontainsfederallyidahometropolitanpopulationrecognizedsidevalley
SHARED TOKENS (11): "associated", "boise", "center", "contains", "federally", "idaho", "metropolitan", "population", "recognized", "side", "valley".
0.220
categoriescommissiondataeffectsexternalhealthlimitedlimitsprotectionsafetysource
SHARED TOKENS (11): "categories", "commission", "data", "effects", "external", "health", "limited", "limits", "protection", "safety", "source".
0.220
becomeconditioncropdevelopmentformhealthlayersoilsstructuresupportswater
SHARED TOKENS (11): "become", "condition", "crop", "development", "form", "health", "layer", "soils", "structure", "supports", "water".
0.220
aroundevenfoodformhoursprovideratherreceivereceivingseparatewhose
SHARED TOKENS (11): "around", "even", "food", "form", "hours", "provide", "rather", "receive", "receiving", "separate", "whose".
0.220
consumerdirectlyfederalindirectlocalpriceproductratherremainseparatelytax
SHARED TOKENS (11): "consumer", "directly", "federal", "indirect", "local", "price", "product", "rather", "remain", "separately", "tax".
0.220
customercustomersdecisionsevaluationformonlineproductprofessionalpurchasingreviewreviews
SHARED TOKENS (11): "customer", "customers", "decisions", "evaluation", "form", "online", "product", "professional", "purchasing", "review", "reviews".
0.220
controldistinctgoverninglawownershippropertyqualityrelatedresourceresourceswater
SHARED TOKENS (11): "control", "distinct", "governing", "law", "ownership", "property", "quality", "related", "resource", "resources", "water".
0.220
Red wine ↗ Q1827 EXACT TITLE
processproduction
SHARED TOKENS (2): "process", "production". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Red wine".
0.220
December 20 ↗ Q2455 EXACT TITLE
decemberremain
SHARED TOKENS (2): "december", "remain". | EXACT TITLE in nuclear_clean_energy: "December 20".
0.220
becomedifferenthighlymajorordinaryplantpowersourcestorageunlesswater
SHARED TOKENS (11): "become", "different", "highly", "major", "ordinary", "plant", "power", "source", "storage", "unless", "water".
0.220
agriculturaleastidahoirrigationlargeriverseparatesnakesourcewaterwestern
SHARED TOKENS (11): "agricultural", "east", "idaho", "irrigation", "large", "river", "separate", "snake", "source", "water", "western".
0.220
Cocktail ↗ Q134768 EXACT TITLE
originalwater
SHARED TOKENS (2): "original", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Cocktail".
0.210
Cider ↗ Q167296 EXACT TITLE
second
SHARED TOKENS (1): "second". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Cider".
0.200
White wine ↗ Q10210 KW CROSS HIGH
amongcarboncompleteformshistoryinfluencelargeleastprocessproduced
SHARED TOKENS (10): "among", "carbon", "complete", "forms", "history", "influence", "large", "least", "process", "produced".
0.200
Wine label ↗ Q1420576 KW CROSS HIGH
codedegreeinformationnationalpurchasingqualityrequirementsresourcesitespecific
SHARED TOKENS (10): "code", "degree", "information", "national", "purchasing", "quality", "requirements", "resource", "site", "specific".
0.200
Beer style ↗ Q1998962 KW CROSS HIGH
degreedifferentdistinguishinghistoryleastlocalmodernproductionstudywork
SHARED TOKENS (10): "degree", "different", "distinguishing", "history", "least", "local", "modern", "production", "study", "work".
0.200
Wine cellar ↗ Q22995 KW CROSS HIGH
climatecontroldepartmenthouseholdlargereduceresponsiblesmallstoragesystem
SHARED TOKENS (10): "climate", "control", "department", "household", "large", "reduce", "responsible", "small", "storage", "system".
0.200
americandecemberequipmentgeneralinformationmajorpreferredprogramresearchtitle
SHARED TOKENS (10): "american", "december", "equipment", "general", "information", "major", "preferred", "program", "research", "title".
0.200
Tied house ↗ Q7800977 KW CROSS HIGH
describedgovernmentindustrialleastpublicrelationshipsreportrequiredspecificsystem
SHARED TOKENS (10): "described", "government", "industrial", "least", "public", "relationships", "report", "required", "specific", "system".
0.180
adaboisegovernmentidahometropolitanmunicipalpopulationsecondseparate
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "second", "separate".
0.180
Malting ↗ Q4395224 KW CROSS HIGH
amongchangesequipmentlargelayermakingmodernprocessrequired
SHARED TOKENS (9): "among", "changes", "equipment", "large", "layer", "making", "modern", "process", "required".
0.180
electricalidaholaboratorynationalpowersafetysupplytestingwater
SHARED TOKENS (9): "electrical", "idaho", "laboratory", "national", "power", "safety", "supply", "testing", "water".
0.180
activitiesalongsideamongclimatefoodimportancepurposestudysubject
SHARED TOKENS (9): "activities", "alongside", "among", "climate", "food", "importance", "purpose", "study", "subject".
0.180
Winemaking ↗ Q213376 KW CROSS HIGH
aroundcategoriesgeneralgrowinghistoryplantsproductionsciencewater
SHARED TOKENS (9): "around", "categories", "general", "growing", "history", "plants", "production", "science", "water".
0.160
Brownlee Dam ↗ Q4976595 KW CROSS HIGH
canyonearthidahooregonriversnakewashingtonwestern
SHARED TOKENS (8): "canyon", "earth", "idaho", "oregon", "river", "snake", "washington", "western".
0.160
analysisappliesconsumerdepartmentsevaluationlargerequirestesting
SHARED TOKENS (8): "analysis", "applies", "consumer", "departments", "evaluation", "large", "requires", "testing".
0.160
Culinary arts ↗ Q2111686 KW CROSS HIGH
foodformgenerallargemakingprincipalrequiresscience
SHARED TOKENS (8): "food", "form", "general", "large", "making", "principal", "requires", "science".
0.140
interestoperationplantpowerprojectsresearchtechnology
SHARED TOKENS (7): "interest", "operation", "plant", "power", "projects", "research", "technology".
0.140
basecostdemandplantplantspowerproducing
SHARED TOKENS (7): "base", "cost", "demand", "plant", "plants", "power", "producing".
0.140
amongassociatedconditioncropplantplantsreduced
SHARED TOKENS (7): "among", "associated", "condition", "crop", "plant", "plants", "reduced".
0.140
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboisedowntowneagleidahonorthwestpopulation
SHARED TOKENS (7): "ada", "boise", "downtown", "eagle", "idaho", "northwest", "population".
0.120
Liqueur ↗ Q178780 KW CROSS HIGH
additionalbeyondhistoricalproducedproductionserved
SHARED TOKENS (6): "additional", "beyond", "historical", "produced", "production", "served".
0.120
beyondclimategrowingplacesproducedrather
SHARED TOKENS (6): "beyond", "climate", "growing", "places", "produced", "rather".
0.120
commissioncommissionedpowerprogramsafetyspecial
SHARED TOKENS (6): "commission", "commissioned", "power", "program", "safety", "special".
0.120
actconservationfederalgoverninglawresource
SHARED TOKENS (6): "act", "conservation", "federal", "governing", "law", "resource".
0.120
categoryestatefieldsfoodplanningreal
SHARED TOKENS (6): "category", "estate", "fields", "food", "planning", "real".
0.120
americandevelopmentheadquarteredprivatesciencetechnology
SHARED TOKENS (6): "american", "development", "headquartered", "private", "science", "technology".
0.120
affectingcurrentlydiscoveryidentifiedownersvalue
SHARED TOKENS (6): "affecting", "currently", "discovery", "identified", "owners", "value".
0.120
carbonconversionconvertsprocessproducesproducing
SHARED TOKENS (6): "carbon", "conversion", "converts", "process", "produces", "producing".
0.120
chainclosedmanufacturingoperationprocessproduction
SHARED TOKENS (6): "chain", "closed", "manufacturing", "operation", "process", "production".
0.100
Erysiphaceae ↗ Q1755354 KW CROSS HIGH
aroundcommerciallycontainsformsplants
SHARED TOKENS (5): "around", "commercially", "contains", "forms", "plants".
0.100
Vodka ↗ Q374 KW CROSS HIGH
baseestablishedmodernservedwater
SHARED TOKENS (5): "base", "established", "modern", "served", "water".
0.100
Oxbow Dam ↗ Q7115136 KW CROSS HIGH
canyonoregonriversnakewestern
SHARED TOKENS (5): "canyon", "oregon", "river", "snake", "western".
◈ Frequently Asked Questions
Craft Beverage Brewery Winery Drinks × Nuclear Clean Energy — Treasure Valley
HAIKU · HIGH GATE
How do water rights in Ada County, Idaho affect both craft beverage production and nuclear clean energy development?
Water rights in Ada County directly determine allocation volumes for breweries and wineries along the Boise River and Snake River, while nuclear facilities in the Treasure Valley region require separate permitting through the Idaho Department of Environmental Quality. Both industries compete for Snake River and Payette River access, making coordinated water management essential for sustainable growth in Boise, Nampa, and Caldwell.
What role does Boise State University play in supporting both craft beverage apprenticeships and nuclear energy workforce development?
Boise State University administers apprenticeship programs that train workers for craft beverage production facilities across the Treasure Valley while simultaneously developing nuclear technology curricula for clean energy sectors. The University of Idaho extends this workforce development across the broader region, creating technical pathways that serve both agricultural-adjacent beverage industries and emerging nuclear infrastructure in Ada County and surrounding areas.
How does irrigation infrastructure in the Treasure Valley support craft beverage agriculture while enabling nuclear facility operations?
Irrigation systems drawing from the Boise River and Payette River supply water for hop and grape cultivation essential to breweries and wineries in Meridian, Nampa, and Caldwell, while also providing cooling and operational water for nuclear clean energy installations. The Idaho Department of Environmental Quality oversees permit compliance for both agricultural water use and nuclear facility water management, ensuring the Treasure Valley's agricultural heritage and clean energy future operate within the same hydrological framework.
Why do craft beverage operations in the Treasure Valley benefit from the same environmental compliance standards as nuclear clean energy projects?
The Idaho Department of Environmental Quality enforces water quality standards on the Snake River and Boise River that protect both craft beverage water sourcing and nuclear facility discharge operations across Ada County, Nampa, and Caldwell. Breweries and wineries in the Treasure Valley maintain operational continuity when nuclear energy replaces carbon-intensive power generation, reducing regional environmental liability and supporting long-term water availability for production facilities.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Craft Beverage Brewery Winery Drinks × Nuclear Clean Energy 18 QID bridges 283 edges 7,684 ext links 2026-07-17 20:15:43 UTC 294aef0a099823ff
Craft Beverage Brewery Winery Drinks corridor ↗ Nuclear Clean Energy corridor ↗ Nuclear Clean Energy × Craft Beverage Brewery Winery Drinks ↗ boisestandard.org/standard ↗
Parent Corridors
Craft Beverage Brewery Winery Drinks × All Other Verticals