—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Craft Beverage Brewery Winery Drinks ↔ relates to ↔ Food

24 Wikipedia bridge articles confirmed in both vertical ledgers. 230 deterministic cross-vertical edges. 6,175 external source links harvested. Every edge provenance-stamped. Every claim auditable.

24 QID Bridge Articles
230 Cross Edges
6,175 External Sources
277 Wikipedia Articles
26 🌲 Evergreen
136 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Craft Beverage Brewery Winery Drinks
× Food
QID Bridge Articles
24
confirmed Wikipedia overlap
Total Cross Edges
230
External Sources Harvested
6,175
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Snake River Valley AVA
score: 1.1500  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (20)
Snake River Valley AVAAmerican Viticultural AreaFood safetyEagle Foothills AVAYelpFermentationFood truckBoise, IdahoThree-tier system (alcohol distribution)Treasure ValleyViticultureTripadvisorCraft beerCaldwell, IdahoRestaurantBarrel-aged beerEagle, IdahoAgriculture in IdahoDistillationNampa, Idaho
Shared Semantics (20 tokens)
idahoboisewinepopulationmilesamericanfoodsecondalcoholcanyonoregonproductionrivervalleymillionnorthwestproductsacresavagrapes
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:13:37 UTC
Content Hash
979787fd09e29a3d
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
24 BRIDGES
Snake River Valley AVA
Q2295723 EXACT TITLE 1.150
QID OVERLAP: Q2295723 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (25): "acres", "alcohol", "american", "ava", "boise", "bureau", "canyon", "commission", "department", "grapes", "idaho", "miles", "oregon", "payette", "producers", "production", "river", "snake", "square", "trade".... | URL->A (2): https://idahowines.org/idaho-wines/idaho-wine-history/, https://www.stechapelle.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Snake River Valley AVA". | EXACT TITLE in food: "Snake River Valley AVA".
acresalcoholamericanavaboisebureaucanyoncommissiondepartmentgrapesidahomilesoregonpayetteproducersproductionriversnakesquaretradevalleyvineyardswinewinerieswines
iver Valley, the Idaho Grape Growers and Wine Producers Commission, and the Idaho Department of Commerce and Labor, collectively acting as "petitioner" to establish the 8,263 square miles (5,288,320 acres) viticultural area named "Snake River Valley." For wines to bear the "Snake River Valley" label, at least 85% of the grapes used for production must be grown in the designated area, which includes the southwestern Idaho counties of Ada, Adams, Boise, Canyon, Elmore, Gem, Gooding, Jerome, Owyhee, Payette, Twin Falls, and Washington, and the Eastern Oregon counties of Malheur and Baker.
alls, and Washington, and the Eastern Oregon counties of Malheur and Baker. At the outset, the vast 5.29-million-acre (8,263 sq mi) appellation was resident to 15 wineries and 46 vineyards with 1,800 acres (728 ha) under vine. History Idaho was resident to the first wineries in the Pacific Northwest in the 1800s. Vitis vinifera were first planted in the state by French immigrants Louis Desol and Robert Schleicher, and Jacob Schaefer from Germany before grapes were ever planted in Washington and Oregon. Idaho viticulture flourished after the passage of the Homestead Act of 1862, granting tracts of land to farmers in sparsely populated western territories. As a result, Idaho wines received awards and gained national recognition before Prohibition crippled the industry and shutdown production. In fact, Idaho issued a state prohibition in 1916 before the 18th Amendment was enacted in 1920 and repealed in 1933.
American Viticultural Area (AVA) located in southwestern Idaho and two counties in eastern Oregon. It was established as the nation's 187th and the state's initial appellation on March 9, 2007 by the Alcohol and Tobacco Tax and Trade Bureau (TTB), Treasury after reviewing the petition submitted by Idahoan vintners of the Snake River Valley, the Idaho Grape Growers and Wine Producers Commission, and the Idaho Department of Commerce and Labor, collectively acting as "petitioner" to establish the 8,263 square miles (5,288,320 acres) viticultural area named "Snake River Valley." For wines to bear the "Snake River Valley" label, at least 85% of the grapes used for production must be grown in the designated area, which includes the southwestern Idaho counties of Ada, Adams, Boise, Canyon, Elmore, Gem, Gooding, Jerome, Owyhee, Payette, Twin Falls, and Washington, and the Eastern Oregon counties of Malheur and Baker.
American Viticultural Area
Q166247 EXACT TITLE 1.070
QID OVERLAP: Q166247 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:branch). | SHARED TOKENS (11): "american", "ava", "avas", "customers", "grapes", "region", "specific", "wine", "winemakers", "wineries", "wines". | URL->A (1): https://www.ttb.gov/regulated-commodities/beverage-alcohol/wine/established-avas. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "American Viticultural Area".
americanavaavascustomersgrapesregionspecificwinewinemakerswinerieswines
An American Viticultural Area (AVA) is a designated wine grape-growing region in the United States, providing an official appellation for the mutual benefit of wineries and consumers. Winemakers frequently want their consumers to know about the geographic pedigree of their wines, as wines from a particular area can possess distinctive characteristics. Consumers often seek out wines from specific AVAs, and certain wines of particular pedigrees can claim premium prices and loyal customers.
AVAs vary widely in size, ranging from the Upper Mississippi River Valley AVA, at more than 19 million acres (29,900 square miles (77,000 km2)) across four states (Illinois, Iowa, Minnesota, and Wisconsin), to the Cole Ranch AVA in Mendocino County, California, at only 60 acres (24 ha). The Augusta AVA, which occupies the area around the town of Augusta, Missouri, was the first recognized AVA, gaining the status on June 20, 1980. There are currently 279 AVAs spread across 34 states, with over half (154) in California. An AVA may be located within one or more larger AVAs. For example, the Santa Clara Valley AVA and Livermore Valley AVA are located within the boundaries of the San Francisco Bay AVA, which is itself located within the Central Coast AVA. In such cases, the wine may be labeled with any of the relevant AVAs, but winemakers generally label wines with the most specific AVA allowed for each wine. Smaller AVAs are often perceived to be associated with smaller production and higher quality wines, though this is not always the case. See map on the right showing the outline of the Paso Robles AVA, California's largest in total area, and the eleven distinct AVAs contained within it. In 2018, the second session of the 115th Congress recognized the contribution of American Viticultural Areas to the economy. The Blunt-Merkley Resolution passed unanimously. It noted that an AVA allows vintners to describe more accurately the origin of their wine, while helping vintners to build and enhance the reputation and value of the wines produced. AVAs also allow consumers to attribute a given quality, reputation, or other characteristic to a wine made from grapes grown in an AVA.
In 2018, the second session of the 115th Congress recognized the contribution of American Viticultural Areas to the economy. The Blunt-Merkley Resolution passed unanimously. It noted that an AVA allows vintners to describe more accurately the origin of their wine, while helping vintners to build and enhance the reputation and value of the wines produced. AVAs also allow consumers to attribute a given quality, reputation, or other characteristic to a wine made from grapes grown in an AVA.
Food safety
Q909821 EXACT TITLE 1.000
QID OVERLAP: Q909821 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (18): "certification", "chain", "consumer", "death", "delivery", "eat", "food", "health", "industry", "labeling", "main", "market", "million", "organization", "person", "related", "safety", "supply". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food safety". | EXACT TITLE in food: "Food safety".
certificationchainconsumerdeathdeliveryeatfoodhealthindustrylabelingmainmarketmillionorganizationpersonrelatedsafetysupply
to food labeling, food hygiene, food additives and pesticide residues; as well as policies on biotechnology and food and guidelines for the management of governmental import and export inspection and certification systems for foods. In considering market-to-consumer practices, the usual thought is that food ought to be safe in the market and the concern is safe delivery and preparation of the food for the consumer. Food safety, nutrition and food security are closely related. Unhealthy food creates a cycle of disease and malnutrition that affects infants and adults as well. Food can transmit pathogens, which can result in the illness or death of the person or other animals. The main types of pathogens are bacteria, viruses, parasites, and fungus. The World Health Organization estimated that foodborne pathogens cause 600 million cases of diseases and 420,000 deaths per year. Food can also serve as a growth and reproductive medium for pathogens. In developed countries, there are intricate standards for food preparation, whereas in lesser developed countries there are fewer standards and less enforcement of those standards.
Pakistan The Pure Food Ordinance 1960 consolidates and amends the law in relation to the preparation and the sale of foods. Its aim is to ensure purity of food being supplied to people in the market and, therefore, provides for preventing adulteration. Pakistan Hotels and Restaurant Act, 1976 applies to all hotels and restaurants in Pakistan and seeks to control and regulate the standard of service(s) by hotels and restaurants. In addition to other provisions, under section 22(2), the sale of food or beverages that are contaminated, not prepared hygienically or served in utensils that are not hygienic or clean is an offense. South Korea Ministry of Food and Drug Safety The Ministry of Food and Drug Safety has been working for food safety since 1945. It is part of the Government of South Korea. IOAS-Organic Certification Bodies Registered in KFDA: "Organic" or related claims can be labelled on food products when organic certificates are considered as valid by KFDA. KFDA admits organic certificates which can be issued by 1) IFOAM (International Federation of Organic Agriculture Movement) accredited certification bodies 2) Government accredited certification bodies – 328 bodies in 29 countries have been registered in KFDA. Food Import Report: According to Food Import Report, it is supposed to report or register what you import.
Ministry of Food and Drug Safety The Ministry of Food and Drug Safety has been working for food safety since 1945. It is part of the Government of South Korea. IOAS-Organic Certification Bodies Registered in KFDA: "Organic" or related claims can be labelled on food products when organic certificates are considered as valid by KFDA. KFDA admits organic certificates which can be issued by 1) IFOAM (International Federation of Organic Agriculture Movement) accredited certification bodies 2) Government accredited certification bodies – 328 bodies in 29 countries have been registered in KFDA. Food Import Report: According to Food Import Report, it is supposed to report or register what you import.
Eagle Foothills AVA
Q107451820 EXACT TITLE 1.000
QID OVERLAP: Q107451820 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (25): "acres", "activity", "alcohol", "american", "ava", "boise", "bureau", "center", "eagle", "entirely", "foothills", "growing", "idaho", "miles", "north", "northwest", "ranch", "region", "river", "second".... | EXACT TITLE in food: "Eagle Foothills AVA".
acresactivityalcoholamericanavaboisebureaucentereagleentirelyfoothillsgrowingidahomilesnorthnorthwestranchregionriversecondsnaketradevalleyvineyardswine
verlap with any existing or proposed AVA. Eagle Foothills lies at the north bank of Ancient Lake Idaho with its elevations ranging from 2,490 to 3,412 feet (759–1,040 m). The area encompasses 49,815 acres (77.8 sq mi) with nearly 70 acres (28 ha) under vine with plans to add 472 acres (191 ha) and seven vineyards. Vineyard elevations are below 3,000 feet (914 m). The majority of viticulture activity is at 3 Horse Ranch Vineyards with its 46 acres (19 ha) in center of the appellation.
ed AVA. Eagle Foothills lies at the north bank of Ancient Lake Idaho with its elevations ranging from 2,490 to 3,412 feet (759–1,040 m). The area encompasses 49,815 acres (77.8 sq mi) with nearly 70 acres (28 ha) under vine with plans to add 472 acres (191 ha) and seven vineyards. Vineyard elevations are below 3,000 feet (914 m). The majority of viticulture activity is at 3 Horse Ranch Vineyards with its 46 acres (19 ha) in center of the appellation.
under vine with plans to add 472 acres (191 ha) and seven vineyards. Vineyard elevations are below 3,000 feet (914 m). The majority of viticulture activity is at 3 Horse Ranch Vineyards with its 46 acres (19 ha) in center of the appellation. The cool climate and relatively short growing season are suitable for growing early to mid-season varietals such as Chardonnay, Pinot Gris and Riesling. History The establishment of the multi-state Snake River Valley appellation in 2007 was a watershed moment for the Idaho viticulture. The petition for the Eagle Foothills viticultural area was submitted by Martha and Gary Cunningham, owner of 3 Horse Ranch Vineyards, on behalf of the local grape growers and vintners. Recognition for Eagle Foothills began in 2012 when the Cunninghams evaluated their area as a special microclimate. With the assistance of climate and viticulture specialists, they quantified their region's climate, soil and terrain noting its unique terroir within the vast Snake River Valley appellation and from other potential Idahoan viticulture areas. The appellation petition was submitted in February 2015 originally proposing an AVA named "Willow Creek Idaho." However, TTB determined that the petition did not sufficiently demonstrate that the region is known by that name. According to TTB regulations, AVA names are required to reflect the area's history or geology.
Yelp
Q2299611 EXACT TITLE 1.000
QID OVERLAP: Q2299611 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (26): "advertising", "american", "annual", "app", "become", "business", "businesses", "com", "directory", "expanded", "external", "following", "former", "founded", "headquartered", "million", "mobile", "operates", "public", "purchase".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Yelp". | EXACT TITLE in food: "Yelp".
advertisingamericanannualappbecomebusinessbusinessescomdirectoryexpandedexternalfollowingformerfoundedheadquarteredmillionmobileoperatespublicpurchaserevenuesalessitesystemtablevisitors
een accused of using unfair practices to raise revenue from the businesses that are reviewed on its site – e.g., by presenting more negative review information for companies that do not purchase its advertising services or by prominently featuring advertisements of the competitors of such non-paying companies or conversely by excluding negative reviews from companies' overall rating on the basis that the reviews "are not currently recommended". There have also been complaints of aggressive and misleading tactics by some of its advertising sales representatives.
ding negative reviews from companies' overall rating on the basis that the reviews "are not currently recommended". There have also been complaints of aggressive and misleading tactics by some of its advertising sales representatives.
Yelp's website, Yelp.com, is a crowd-sourced local business review and social networking site. The site has pages devoted to individual locations, such as restaurants or schools, where Yelp users can submit a review of their products or services using a one to five stars rating scale. Businesses can update contact information, hours, and other basic listing information or add special deals. In addition to writing reviews, users can react to reviews, plan events, or discuss their personal lives. 80% of businesses listed on the site had a rating of three stars or better, but some negative reviews were very personal or extreme. Some of the reviews are written entertainingly or creatively. As of 2014, users could give a "thumbs-up" to reviews they liked, which caused these reviews to be featured more prominently in the system. As of 2008, each day a "Review of the Day" was determined based on a vote by users. The Yelp iPhone mobile app was introduced in December 2008. In August 2009, Yelp released an update to the iPhone app with a hidden Easter Egg augmented reality feature called Monocle, which allowed users looking through their iPhone camera to see Yelp data on businesses seen through the camera. Check-in features were added in 2010. Yelp users can make restaurant reservations in Yelp through Yelp Reservations, a feature initially added in June 2010; in 2021 the service was consolidated with others into "Yelp Guest Manager". Yelp's reservation features have been done through SeatMe, which was acquired by Yelp in 2013. Prior to that, Yelp had offered reservation services through OpenTable. In 2013, features to have food ordered and delivered were added to Yelp as well as the ability to view hygiene inspection scores and make appointments at spas. Yelp's content was integrated into Apple Inc.'s Siri "virtual assistant" and the mapping and directions app of Apple's September 2012 release of the iOS 6 computer operating system. In March 2014, Yelp added features for ordering and scheduling manicures, flower deliveries, golf games, and legal consultations, among other things. In October 2014, the company, working in collaboration with hotel search site Hipmunk, added features to book hotels through Yelp. Yelp started a 7–10% cash-back program at some US restaurants in 2016 through a partnership with Empyr, which links credit card purchases to online advertising. On February 14, 2017, Yelp launched Yelp Questions and Answers, a feature for users to ask venue-specific questions about businesses. In June 2020, Yelp launched a COVID-19 section that enables businesses to update their health and safety measures as well as their service offering changes. Starting January 2021, users can provide detailed feedback regarding what health and safety measures the business has implemented through editing in the COVID-19 section on Yelp business pages. In April 2023, Yelp introduced Yelp Guaranteed, which provides a refund of up to $2,500 if something goes wrong with a project. It also improved its search features with AI and added the option to add video to reviews. In April 2024, Yelp released Yelp Assistant, an AI chatbot that helps users find a professional for a project. It also updated an API with natural language search to answer conversational queries. In December 2024, Yelp introduced AI-powered “Review Insights” filters for restaurant, food, and nightlife businesses on its iOS app. The feature uses AI to surface positive, neutral, and critical sentiment from user reviews so people can quickly scan what customers are saying about categories like food, service, and atmosphere.
Fermentation
Q41760 EXACT TITLE 1.000
QID OVERLAP: Q41760 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:branch). | SHARED TOKENS (16): "beers", "different", "food", "form", "health", "industrial", "organic", "produce", "producing", "production", "products", "profiles", "related", "spirits", "supply", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Fermentation".
beersdifferentfoodformhealthindustrialorganicproduceproducingproductionproductsprofilesrelatedspiritssupplywine
nergy. Perhaps the most commonly known use for fermentation is at an industrial level to produce commodity chemicals, such as ethanol and lactate. Ethanol is used in a variety of alcoholic beverages (beers, wine, and spirits) while lactate can be neutralized to lactic acid and be used for food preservation, as a curing agent, or as a flavoring agent. This complex metabolism utilizes a wide variety of substrates and can form nearly 300 different combinations of end products. Fermentation occurs in both prokaryotes and eukaryotes.
Substrates and products of fermentation Like many biochemical reactions, fermentation is an enzyme catalyzed reaction with the goal of either changing the initial substrate or forming a useful byproduct. When naturally occurring fermentation is carried out by microbes, the goal is usually to obtain useful metabolic products such as ATP, pyruvate, or lactic acid. The substrates used in this type of fermentation are often simple sugars (carbohydrates) that serve as a carbon source and this type of fermentation can be carried out by microbes and humans. Food as a substrate for fermentation is the most common and oldest anthropogenic use of fermentation as it was a method to preserve food. This includes cereal, dairy products, rice, honey, bread, and beers. This type of naturally occurring fermentation continues to be harnessed by humans for preservative effects, flavor profiles, and texture profiles.
can be neutralized to lactic acid and be used for food preservation, as a curing agent, or as a flavoring agent. This complex metabolism utilizes a wide variety of substrates and can form nearly 300 different combinations of end products. Fermentation occurs in both prokaryotes and eukaryotes.
Food truck
Q3303463 EXACT TITLE 1.000
QID OVERLAP: Q3303463 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (27): "become", "chicken", "commercial", "cultural", "customers", "daily", "food", "french", "growing", "ice", "industry", "kitchen", "large", "major", "mobile", "operation", "regional", "restaurant", "specialty", "store".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food truck". | EXACT TITLE in food: "Food truck".
becomechickencommercialculturalcustomersdailyfoodfrenchgrowingiceindustrykitchenlargemajormobileoperationregionalrestaurantspecialtystorestreetthoughtransporttrucktruckswaterworkers
ustry led to a considerable rise in popularity among customers and food truck operation as a career. Though food trucks primarily developed in the United States, United Kingdom, and France, they have become increasingly popular and more available in other parts of Europe and the Americas, as well as Asia and Oceania. Food trucks, along with food booths and food carts, are major components of the street food industry that serve an estimated 2.5 billion people daily.
In 2011, USA Today noted that food trucks selling pricier food were gaining popularity across the United States, contrary to a common perception that food trucks are typically run-down and found at construction sites. In 2009, New York magazine noted that the food truck had "largely transcended its roach-coach classification and is now a respectable venue for aspiring chefs to launch careers." These gourmet trucks' menus run the gamut of ethnic and fusion cuisine. Often focusing on limited but creative dishes at reasonable prices, they offer customers a chance to experience food they otherwise may not. Finding a niche seems to be a path to success for most trucks. While one truck may specialize in outlandish burgers, another may serve only lobster rolls. Gourmet food trucks can also offer a unique dining experience. With the rise of millennial diners, experiential dining has become more mainstream, driving restaurant and food truck owners to create a unique experience for their customers.
kaged food, but many have on-board kitchens and prepare food from scratch, or they reheat food that was previously prepared in a brick and mortar commercial kitchen. Sandwiches, hamburgers, hot dogs, chicken, tacos, pizza, french fries and other typical fast food and finger food staples are common food truck fare, though since the pop-up restaurant phenomenon of the 2010s, food trucks specializing in a wide variety of gourmet, specialty, global, regional, and fusion cuisines have seen growing popularity. Food trucks often also sell or fully specialize in beverages such as soft drink, juice, coffee, tea, and water, as well as treats such as ice cream, pastries, and fried dough. Historical predecessors of food trucks were horse-drawn chuckwagons and lunch wagons of the 19th century. By the early-to-mid-20th century, trucks and vans were being used both as mobile canteens in the military and as "roach coaches" that traveled to worksites and primarily catered to blue-collar workers. Into the 21st century, economic and cultural shifts surrounding the foodservice industry led to a considerable rise in popularity among customers and food truck operation as a career.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:evergreen). | SHARED TOKENS (18): "annual", "boise", "capital", "downtown", "east", "elevation", "idaho", "locally", "major", "manufacturing", "miles", "north", "oregon", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in food: "Boise, Idaho".
annualboisecapitaldowntowneastelevationidaholocallymajormanufacturingmilesnorthoregonpopulationrivertechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
T
Q7797285 EXACT TITLE 1.000
QID OVERLAP: Q7797285 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:evergreen). | SHARED TOKENS (24): "alcohol", "become", "beverage", "brewers", "directly", "distribution", "distributors", "form", "government", "importers", "independent", "marketing", "operating", "private", "producers", "products", "purchase", "rather", "requiring", "structure".... | EXACT TITLE in food: "Three-tier system (alcohol distribution)".
alcoholbecomebeveragebrewersdirectlydistributiondistributorsformgovernmentimportersindependentmarketingoperatingprivateproducersproductspurchaseratherrequiringstructuresystemwarehousewholesalewine
The three-tier system of alcohol distribution is the system for distributing alcoholic beverages set up in the United States after the repeal of Prohibition. The three tiers are importers or producers; distributors; and retailers. The basic structure of the system is that producers can sell their products only to wholesale distributors who then sell to retailers, and only retailers may sell to consumers. Producers include brewers, wine makers, distillers and importers. The three-tier system is intended to prohibit tied houses and prevent "disorderly marketing conditions." Some states chose to become alcoholic beverage control jurisdictions after Prohibition. In these states, part or all of the distribution tier, and sometimes also the retailing tier, are operated by the state government itself (or by contractors operating under its authority) rather than by independent private entities. The only state with a privately operated retailing and distribution system that does not require any form of three-tier system is the State of Washington. In Washington, retailers may purchase alcoholic beverages directly from producers, may negotiate volume discounts, and may warehouse their inventory themselves.
Producers include brewers, wine makers, distillers and importers. The three-tier system is intended to prohibit tied houses and prevent "disorderly marketing conditions." Some states chose to become alcoholic beverage control jurisdictions after Prohibition. In these states, part or all of the distribution tier, and sometimes also the retailing tier, are operated by the state government itself (or by contractors operating under its authority) rather than by independent private entities. The only state with a privately operated retailing and distribution system that does not require any form of three-tier system is the State of Washington. In Washington, retailers may purchase alcoholic beverages directly from producers, may negotiate volume discounts, and may warehouse their inventory themselves.
ities. The only state with a privately operated retailing and distribution system that does not require any form of three-tier system is the State of Washington. In Washington, retailers may purchase alcoholic beverages directly from producers, may negotiate volume discounts, and may warehouse their inventory themselves.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (12): "agricultural", "boise", "idaho", "local", "oregon", "payette", "region", "river", "snake", "treasure", "valley", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Treasure Valley". | EXACT TITLE in food: "Treasure Valley".
agriculturalboiseidaholocaloregonpayetteregionriversnaketreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Viticulture
Q253140 EXACT TITLE 0.920
QID OVERLAP: Q253140 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:branch). | SHARED TOKENS (11): "development", "fruit", "grapes", "history", "modern", "science", "site", "western", "wine", "winemakers", "winery". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Viticulture".
developmentfruitgrapeshistorymodernsciencesitewesternwinewinemakerswinery
re can be found on every continent except Antarctica. The duties of a viticulturist include monitoring and controlling pests and diseases, fertilizing, irrigation, canopy management, monitoring fruit development and characteristics, deciding when to harvest, and vine pruning during the winter months. Viticulturists are often intimately involved with winemakers, because vineyard management and the resulting grape characteristics provide the basis from which winemaking can begin. A great number of varieties are now approved in the European Union as true grapes for winegrowing and viticulture. The history of wine dates back at least 8,000 years. Evidence suggests that some of the earliest domestication of Vitis vinifera occurred in the area of the modern countries Georgia and Armenia. The oldest-known winery was discovered in the "Areni-1" cave in Vayots Dzor, Armenia.
The grape is classified as a berry. On the vine, grapes are organized through systems known as clusters. Grape clusters can vary in compactness which can result in long clusters (resulting in the grapes spreading out) or short clusters (resulting in grapes packed together). In some grape species, clusters ripen collectively, which allows them to be harvested together. For others, grapes may ripen individually within a cluster. Each grape berry contains a pedicel which attaches to the rachis. The main function of the rachis is to allow the grapes to receive their water and nutrients. The pollination and fertilization of grapes results in one to four seeds within each berry. When fertilization does not occur, seedless grapes are formed, which are sought after for the production of raisins. Regardless of pollination and fertilization, most plants will produce around 100 to 200 grapes. The skin of the grape accounts for 5 to 20% of the total weight of a grape depending on the variety. When grape skin ripens, it contains the majority of the aromatic substances and tannin. These factors become important in winemaking for methods including color extraction or aroma dissolution. Although the skin contains the majority of the tannin, small percentages can be found throughout the grape and during all of its developmental stages.
Climate is the most significant external factor in determining a grape's inherent qualities. Each grape variety has a uniquely preferred environment for ideal growing. Because climates vary from region to region, selecting the best strain is an important decision in grape cultivation. Additionally, because climatic factors such as temperature and rain can be unpredictable and uncontrollable, each year will produce unique qualities and yields of grapes. Wine grapes are also especially susceptible to climate change and temperature variation. Grape vines need approximately 1300–1500 hours of sunshine during the growing season and around 690 millimetres (27 in) of rainfall throughout the year in order to produce grapes suitable for winemaking. In ideal circumstances, the vine will receive most of the rainfall during the winter and spring months: rain at harvesttime can create many hazards, such as fungal diseases and berry splitting. The optimum weather during the growing season is a long, warm summer that allows the grapes the opportunity to ripen fully and to develop a balance between the levels of acids and sugars in the grape. Hot and sunny climates have a frost-free growing season of 200 days or more. These climates allow grapes to ripen faster with higher sugar levels and lower acidity. Cooler climates have a frost-free growing season of around 150–160 days. Cooler seasons force the grapes to ripen earlier, which produces a fresher and more acidic harvest. In general, the average yearly temperature for most crops should average around 15 °C (59 °F) in order to achieve the highest quality in each grape. Summer: Ideal temperatures in summer average around 22 °C (72 °F). Ideal summer temperatures enable fruits to ripen. Temperature and sunshine are the most important factors in ripening. Winter: Ideal temperatures in winter average around 3 °C (37 °F). Ideal winter temperatures are necessary to allow grape vines to enter their resting phase. If temperatures fall too low, the crops can be injured. Spring and Fall: Spring and fall are critical seasons for grape development, because the plants are susceptible to frost damage, which can injure the fruiting buds. Wet weather in spring can increase the odds of mildew formation. To prevent mildew, some farms introduce devices such as heaters or large fans in vineyards.
T
Q1770710 EXACT TITLE 0.920
QID OVERLAP: Q1770710 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (11): "advertising", "american", "brand", "brands", "com", "group", "headquartered", "million", "mobile", "operates", "tripadvisor". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Tripadvisor". | EXACT TITLE in food: "Tripadvisor".
advertisingamericanbrandbrandscomgroupheadquarteredmillionmobileoperatestripadvisor
company is headquartered in Needham, Massachusetts. In 2023, Tripadvisor earned 25 percent of its revenues from Expedia Group and Booking Holdings and their subsidiaries, primarily for pay-per-click advertising. Matt Goldberg has been Tripadvisor's CEO and president since July 2022. History 2000–2009 Tripadvisor LLC was founded by Stephen Kaufer, Langley Steinert, Nick Shanny, and Thomas Palka in February 2000.
Fine for improper commercial practices In December 2014, the Italian Antitrust Authority fined Tripadvisor €500,000 for improper commercial practices on the Tripadvisor website. The Italian Authority said Tripadvisor and its Italian arm should stop publishing misleading information about the sources of the reviews. In June 2015, a fake restaurant created by a newspaper rose to the top of the site's rankings in Italy. In August 2013, Kenneth Seaton lost a $10 million lawsuit against the company in which he claimed that the ranking for his Grand Resort Hotel and Convention Center in Pigeon Forge, Tennessee, as "America's dirtiest hotel" was based on unsubstantiated rumors. Breaches of advertising standards In September 2011, after receiving a complaint submitted by online investigations company KwikChex, the UK Advertising Standards Authority (ASA) launched a formal investigation into Tripadvisor's claims to provide trustworthy and honest reviews from travelers. The ASA found that Tripadvisor "should not claim or imply that all its reviews were from real travellers, or were honest, real or trusted", and as a result of the investigation, Tripadvisor was ordered to remove the slogan "reviews you can trust" from its UK website. It changed its hotel review section slogan to "reviews from our community." Tripadvisor said the branding change had been planned for some time and that changes began in June 2011, before the ASA investigation. ASA commented that "it was concerned that consumers might be fooled by fraudulent posts since the entries could be made without any form of verification", but recognized that Tripadvisor used "advanced and highly effective fraud systems" in an attempt to identify and remove fake content.Approximately 30 hotels have been penalized on the website by the company for suspicious reviews, including a Cornwall hotel that bribed guests to leave positive reviews of the hotel. Tripadvisor has stated that reviews are subject to a verification process that considers the IP address and email address of the author, and tries to detect any suspicious patterns or obscene or abusive language.
Tripadvisor is an American company that operates online travel agencies, comparison shopping websites, and mobile apps with user-generated content. Its namesake brand, Tripadvisor.com, operates in 40 countries and 20 languages, and features approximately 1 billion reviews and opinions on roughly 8 million establishments. The company's other brands include Bokun.io, Cruise Critic, FlipKey, TheFork, Holiday Lettings, Housetrip, Jetsetter, Singleplatform, Niumba, SeatGuru, and Viator.
C
Q5487333 EXACT TITLE 0.880
QID OVERLAP: Q5487333 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:evergreen). | SHARED TOKENS (9): "beer", "breweries", "brewing", "craft", "distribution", "emerged", "expanded", "produce", "production". | EXACT TITLE in food: "Craft beer".
beerbreweriesbrewingcraftdistributionemergedexpandedproduceproduction
Craft beer is beer manufactured by craft breweries, which typically produce smaller amounts of beer than larger "macro" breweries and are often independently owned. Such breweries are generally perceived and marketed as emphasising enthusiasm, new flavours, and varied brewing techniques. The microbrewery movement began in both the United States and United Kingdom in the 1970s, although traditional artisanal brewing existed in Europe for centuries and subsequently spread to other countries. As the movement grew, and some breweries expanded their production and distribution, the more encompassing concept of craft brewing emerged.
to other countries. As the movement grew, and some breweries expanded their production and distribution, the more encompassing concept of craft brewing emerged. A brewpub is a pub that brews its own beer for sale on the premises. Producer definitions Microbrewery Although the term "microbrewery" was originally used in relation to the size of breweries, it gradually came to reflect an alternative attitude and approach to brewing flexibility, adaptability, experimentation and customer service. The term and trend spread from the UK to the US in the 1980s, and was eventually used as a designation for breweries that produce fewer than 15,000 U.S. beer barrels (1,800,000 liters; 460,000 U.S. gallons) annually. In 1995, there were 205 microbreweries in the US.
Although the term "microbrewery" was originally used in relation to the size of breweries, it gradually came to reflect an alternative attitude and approach to brewing flexibility, adaptability, experimentation and customer service. The term and trend spread from the UK to the US in the 1980s, and was eventually used as a designation for breweries that produce fewer than 15,000 U.S. beer barrels (1,800,000 liters; 460,000 U.S. gallons) annually. In 1995, there were 205 microbreweries in the US. In 2000, that number more than doubled to 420 microbreweries. Nanobrewery The website The Food Section defines a "nanobrewery" as, "a scaled-down microbrewery, often run by a solo entrepreneur, that produces beer in small batches." Nanobrewers often work out of garages or small industrial spaces. Small batches are then sold to local bars or directly to customers. The U.S. Department of the Treasury defines nanobreweries as "very small brewery operations" that produce beer for sale. These small operations still must meet state and federal licensing requirements. In 2013, there were more than 200 "nanos" in the United States.
Caldwell, Idaho
Q849592 EXACT TITLE 0.880
QID OVERLAP: Q849592 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:evergreen). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "east", "idaho", "locally", "miles", "oregon", "population". | EXACT TITLE in food: "Caldwell, Idaho".
boisecaldwellcanyoneastidaholocallymilesoregonpopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Restaurant
Q11707 EXACT TITLE 0.880
QID OVERLAP: Q11707 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:evergreen). | SHARED TOKENS (9): "business", "customers", "delivery", "family", "food", "restaurant", "restaurants", "serves", "single". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Restaurant". | EXACT TITLE in food: "Restaurant".
businesscustomersdeliveryfamilyfoodrestaurantrestaurantsservessingle
A restaurant is a business that prepares and serves food and beverages to customers. Meals are generally served and eaten on the premises, but many restaurants also offer take-out and food delivery services.
A public eating-establishment similar to a restaurant is mentioned in a 512 BC record from Ancient Egypt. It served only one dish, a plate of cereal, wildfowl, and onions. A forerunner for the modern restaurant is the thermopolium, an establishment in Ancient Greece or Ancient Rome that sold and served ready-to-eat food and beverages. These establishments were somewhat similar in function to modern fast-food restaurants. They were most often frequented by people who lacked private kitchens. In the Roman Empire, they were popular among residents of insulae. In Pompeii, 158 thermopolia with service-counters have been identified throughout the town. They were concentrated along the main axis of the town and near public spaces where they were frequented by the locals. The Romans also had the popina, a wine bar which in addition to a variety of wines offered a limited selection of simple foods such as olives, bread, cheese, stews, sausage, and porridge. The popinae were known as places for the plebeians of the lower classes of Roman society to socialize. While some were confined to one standing room only, others had tables and stools and a few even had couches. Another early forerunner of the restaurant was the inn. Throughout the ancient world, inns were set up alongside roads to cater to people travelling between cities, offering lodging and food. Meals were typically served at a common table to guests. However, there were no menus or options to choose from. Early eating establishments recognizable as restaurants in the modern sense emerged in Song dynasty China during the 11th and 12th centuries. In large cities, such as Kaifeng and Hangzhou, food catering establishments catered to merchants who travelled between cities. Probably growing out of tea houses and taverns which catered to travellers, Kaifeng's restaurants blossomed into an industry that catered to locals as well as people from other regions of China. As travelling merchants were not used to the local cuisine of other cities, these establishments were set up to serve dishes familiar to merchants from other parts of China. Such establishments were located in the entertainment districts of major cities, alongside hotels, bars, and brothels. The larger and more opulent of these establishments offered a dining experience similar to modern restaurant culture. According to a Chinese manuscript from 1126, patrons of one such establishment were greeted with a selection of pre-plated demonstration dishes which represented food options. Customers had their orders taken by a team of waiters who would then sing their orders to the kitchen and distribute the dishes in the exact order in which they had been ordered. There is a direct correlation between the growth of the restaurant businesses and institutions of theatrical stage drama, gambling and prostitution which served the burgeoning merchant middle class during the Song dynasty. Restaurants catered to different styles of cuisine, price brackets, and religious requirements. Even within a single restaurant choices were available, and people ordered the entrée from written menus.
38,797 full-service restaurants 34,629 limited-service restaurants 741 contract and social caterers 6,749 drinking places Fully 63% of restaurants in Canada are independent brands. Chain restaurants account for the remaining 37%, and many of these are locally owned and operated franchises. European Union The EU-27 has an estimated 1.6 million businesses involved in 'accommodation & food services', more than 75% of which are small and medium enterprises. India The Indian restaurant industry is highly fragmented with more than 1.5 million outlets of which only around 3,000 of them are from the organised segment.
Barrel-aged beer
Q85745517 EXACT TITLE 0.840
QID OVERLAP: Q85745517 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:branch). | SHARED TOKENS (7): "barrel", "barrel-aged", "beer", "beers", "growing", "produced", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barrel-aged beer".
barrelbarrel-agedbeerbeersgrowingproducedwine
A barrel-aged beer is a beer that has been aged for a period of time in a wooden barrel. Typically, these barrels once housed bourbon, whisky, wine, or, to a lesser extent, brandy, sherry, or port. There is a particular tradition of barrel ageing beer in Belgium, notably of lambic beers. The first bourbon barrel-aged beers were produced in the United States in the early 1990s. Beers can be aged in barrels to achieve a variety of effects, such as imparting flavours from the wood (from tannins and lactones) or from the previous contents of the barrels, or causing a Brettanomyces fermentation. Oak remains the wood of choice, but other woods are in use as well. Chestnut, ash, poplar, cedar, acacia, cypress, redwood, pine, and even eucalyptus have been used for barrel-ageing with varying success. The flavours imparted by oak barrels differ widely depending on the oak species, the growing area, and how the wood has been treated. New oak barrels can be used for ageing beer, but they are not common due to high costs.
e is a particular tradition of barrel ageing beer in Belgium, notably of lambic beers. The first bourbon barrel-aged beers were produced in the United States in the early 1990s. Beers can be aged in barrels to achieve a variety of effects, such as imparting flavours from the wood (from tannins and lactones) or from the previous contents of the barrels, or causing a Brettanomyces fermentation. Oak remains the wood of choice, but other woods are in use as well. Chestnut, ash, poplar, cedar, acacia, cypress, redwood, pine, and even eucalyptus have been used for barrel-ageing with varying success. The flavours imparted by oak barrels differ widely depending on the oak species, the growing area, and how the wood has been treated. New oak barrels can be used for ageing beer, but they are not common due to high costs.
a Brettanomyces fermentation. Oak remains the wood of choice, but other woods are in use as well. Chestnut, ash, poplar, cedar, acacia, cypress, redwood, pine, and even eucalyptus have been used for barrel-ageing with varying success. The flavours imparted by oak barrels differ widely depending on the oak species, the growing area, and how the wood has been treated. New oak barrels can be used for ageing beer, but they are not common due to high costs.
Eagle, Idaho
Q1516870 EXACT TITLE 0.840
QID OVERLAP: Q1516870 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:evergreen). | SHARED TOKENS (7): "boise", "downtown", "eagle", "idaho", "miles", "northwest", "population". | EXACT TITLE in food: "Eagle, Idaho".
boisedowntowneagleidahomilesnorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District. The portion in the Boise School District is zoned to: Shadow Hills Elementary School, Riverglen Middle School, and Capital High School. In popular culture The 2008 show The Baby Borrowers was filmed in Eagle.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
A
Q4694038 QID OVERLAP 0.800
QID OVERLAP: Q4694038 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:branch). | SHARED TOKENS (16): "acres", "agricultural", "agriculture", "beverage", "different", "farms", "food", "idaho", "million", "potatoes", "processing", "produces", "production", "products", "sales", "second".
acresagriculturalagriculturebeveragedifferentfarmsfoodidahomillionpotatoesprocessingproducesproductionproductssalessecond
own for its potatoes. Idaho is the number one producer of potatoes in the nation and contributes to 32% of the country's production. Idaho has nearly 25,000 farms and ranches spread over 11.8 million acres of land that produces more than 185 different agricultural products.
2015 Top Idaho Commodities In 2015, Idaho's top commodities, by value of production, were milk products and cattle/calves. Following dairy products, potatoes were the next highest producing commodity. 2015 Idaho Organic Production There are roughly 168 farms in Idaho that produce organic commodities. In 2015, 95,739 acres of cropland and 71,443 acres of pasture/rangeland produced $85,014,000 in sales. As the popularity of organic foods rises, we will continue to see an increase in the sales of these commodities. Total Cash Receipts In 2015, Idaho's agricultural products were valued at $7,463,718,000.
2015 Cash Receipts Breakdown Livestock and Crops 2015 Idaho Farms and Farmland Idaho's agriculture is sustained by a high acreage of farmland and ranches. Idaho has 24,400 farms and ranches that take up 11,800,000 acres of land throughout the state. 2012 Agriculture Census 2015 National Rankings Idaho's agriculture production ranks in the top ten in the nation in nearly 30 of the 168 commodities it produces.
Distillation
Q101017 QID OVERLAP 0.800
QID OVERLAP: Q101017 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:branch). | SHARED TOKENS (21): "alcohol", "bar", "changes", "distilled", "distillery", "environmental", "footprint", "industrial", "large", "operate", "operates", "operation", "operations", "produce", "produces", "producing", "products", "separate", "store", "transport"....
alcoholbarchangesdistilleddistilleryenvironmentalfootprintindustriallargeoperateoperatesoperationoperationsproduceproducesproducingproductsseparatestoretransportwater
sed as a unit of operation that identifies and denotes a process of physical separation, not a chemical reaction; thus an industrial installation that produces distilled beverages, is a distillery of alcohol.
lled beverages, is a distillery of alcohol. These are some applications of the distillation process: Distilling fermented products to yield alcoholic beverages with a high content by volume of ethyl alcohol. Desalination to produce potable water and for medico-industrial applications. Crude oil stabilisation, a partial distillation to reduce the vapor pressure of crude oil, which thus is safe to store and to transport, and thereby reduces the volume of atmospheric emissions of volatile hydrocarbons. Fractional distillation is used in the midstream operations of an oil refinery for producing fuels and chemical raw materials for livestock feed. Cryogenic air separation into the component gases — oxygen, nitrogen, and argon — for use as industrial gases. Chemical synthesis to separate impurities and unreacted materials.
Medieval Muslim chemists such as Abū Bakr al-Rāzī (Latin: Rhazes, c. 865–925) and the anonymous chemists writing under the name of Jābir ibn Ḥayyān (Latin: Geber, ninth century) experimented extensively with the distillation of various substances. The fractional distillation of organic substances plays an important role in the works attributed to Jābir, such as in the Kitāb al-Sabʿīn ('The Book of Seventy'), translated into Latin by Gerard of Cremona (c. 1114–1187) under the title Liber de septuaginta. The Jabirian experiments with fractional distillation of animal and vegetable substances, and to a lesser degree also of mineral substances, is the main topic of the De anima in arte alkimiae, an originally Arabic work falsely attributed to Avicenna that was translated into Latin and would go on to form the most important alchemical source for Roger Bacon (c. 1220–1292). The distillation of wine is attested in Arabic works attributed to al-Kindī (c. 801–873 CE) and to al-Fārābī (c. 872–950), and in the 28th book of al-Zahrāwī's (Latin: Abulcasis, 936–1013) Kitāb al-Taṣrīf (later translated into Latin as Liber servatoris). In the twelfth century, recipes for the production of aqua ardens ("burning water", i.e., ethanol) by distilling wine with salt started to appear in a number of Latin works, and by the end of the thirteenth century it had become a widely known substance among Western European chemists. The works of Taddeo Alderotti (1223–1296) describe a method for concentrating alcohol involving repeated distillation through a water-cooled still, by which an alcohol purity of 90% could be obtained. Medieval China The distillation of beverages began in the Southern Song (10th–13th century) and Jin (12th–13th century) dynasties, according to archaeological evidence. A still was found in an archaeological site in Qinglong, Hebei province, China, dating back to the 12th century.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "footprint", "idaho", "meridian", "miles", "nampa", "northwest", "population", "second", "western".
boisecanyonfootprintidahomeridianmilesnampanorthwestpopulationsecondwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Sour beer
Q7565081 EXACT TITLE 0.720
QID OVERLAP: Q7565081 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:evergreen). | SHARED TOKENS (2): "beer", "sour". | EXACT TITLE in food: "Sour beer".
beersour
Sour beer is beer which has an intentionally acidic, tart, or sour taste. Sour beer styles include Belgian lambics, Flanders red ale, German Gose, and Berliner Weisse. Brewing Unlike modern brewing, which is done in a sanitary environment to guard against the intrusion of wild yeast, historically the starter used from one batch to another usually contained some wild yeast and bacteria. Sours are made by intentionally allowing wild yeast strains or bacteria into the brew, traditionally through the barrels or during the cooling of the wort in a coolship open to the outside air. The most common microbes used to intentionally sour beer are the bacteria Lactobacillus and Pediococcus, while the fungus Brettanomyces can also add some acidity. Another method for achieving a tart flavor is adding fruit, which directly contributes organic acids such as citric acid. Additionally, acid can be directly added to beer or added by the use of unusually large amounts of acidulated malt. Depending on the process employed, the uncertainty involved in using wild yeast may cause the beer to take months to ferment and potentially years to mature.
American wild ale Beers brewed in the United States utilize yeast and bacteria strains instead of or in addition to standard brewers yeasts. These microflora may be cultured or acquired spontaneously, and the beer may be fermented in a number of different types of brewing vessels.
Beers brewed in the United States utilize yeast and bacteria strains instead of or in addition to standard brewers yeasts. These microflora may be cultured or acquired spontaneously, and the beer may be fermented in a number of different types of brewing vessels. American wild ales tend not to have specific parameters or guidelines stylistically, but instead simply refer to the use of unusual yeasts. Berliner Weisse At one time the most popular alcoholic beverage in Berlin, this is a somewhat weaker (usually around 3% abv) beer made sour by use of Lactobacillus bacteria. This type of beer is usually served with flavored syrups to balance the tart flavor. Flanders red ale Flanders red ales are fermented with brewers yeast, then placed into oak barrels to age and mature. Usually, the mature beer is blended with younger beer to adjust the taste for consistency.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in craft_beverage_brewery_winery_drinks (tier:evergreen) and food (tier:branch). | SHARED TOKENS (10): "boise", "capital", "district", "east", "idaho", "local", "northwest", "population", "private", "second".
boisecapitaldistricteastidaholocalnorthwestpopulationprivatesecond
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:branch). | SHARED TOKENS (7): "boise", "capital", "cities", "idaho", "meridian", "population", "second".
boisecapitalcitiesidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in craft_beverage_brewery_winery_drinks (tier:branch) and food (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "nampa", "population".
boisecaldwellcanyonidahonampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
206 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP206 edges
🌲 EVERGREEN2 edges
0.650
activityboisebusinessdivisioneducationfoundedhealthidahoindependentinstitutionmillionprogrampublicresearchschool
SHARED TOKENS (15): "activity", "boise", "business", "division", "education", "founded", "health", "idaho", "independent", "institution", "million", "program", "public", "research", "school". | URL->A (1): https://boisestate.edu/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise State University".
0.650
boisecampuscanyoncommunitydevelopmenteducationidaholargenampanorthpopulationprimarypublictreasurevalleywestern
SHARED TOKENS (16): "boise", "campus", "canyon", "community", "development", "education", "idaho", "large", "nampa", "north", "population", "primary", "public", "treasure", "valley", "western". | URL->A (1): https://cwi.edu/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "College of Western Idaho".
🌿 BRANCH136 edges
0.550
Untappd ↗ EXACT TITLE
appbeerbeersfoundedlistsmobileplatformsharetapuses
SHARED TOKENS (10): "app", "beer", "beers", "founded", "lists", "mobile", "platform", "share", "tap", "uses". | URL->A (1): https://untappd.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Untappd".
0.510
alcoholbureaucodedepartmentformergovernmentindustrytrade
SHARED TOKENS (8): "alcohol", "bureau", "code", "department", "former", "government", "industry", "trade". | URL->A (1): https://uscode.house.gov/view.xhtml?path=/prelim@title27/chapter8&edition=prelim. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Federal Alcohol Administration".
0.500
Idaho ↗ EXACT TITLE
agriculturalagriculturearoundboisecapitaldeathdistincteastidahomanufacturingmilesmillionnationalnorthnorthwestoregonpopulationproductsregionsriver
SHARED TOKENS (31): "agricultural", "agriculture", "around", "boise", "capital", "death", "distinct", "east", "idaho", "manufacturing", "miles", "million", "national", "north", "northwest", "oregon", "population", "products", "regions", "river".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho". | EXACT TITLE in food: "Idaho".
0.500
Frost ↗ Q4590598 EXACT TITLE
colddevelopmentdirectlyexperiencesformglassgrowingicelargelayerlongnearregionsspecifictemperaturevisiblewarmwater
SHARED TOKENS (18): "cold", "development", "directly", "experiences", "form", "glass", "growing", "ice", "large", "layer", "long", "near", "regions", "specific", "temperature", "visible", "warm", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Frost".
0.500
becomechefsfoodfrenchhighlyhousemenusnorthrestaurantrestaurantssinglesmallspecialtytastingvalley
SHARED TOKENS (15): "become", "chefs", "food", "french", "highly", "house", "menus", "north", "restaurant", "restaurants", "single", "small", "specialty", "tasting", "valley". | EXACT TITLE in food: "Tasting menu".
0.500
Brewing ↗ Q869095 EXACT TITLE
additionalaroundbeerbottlebrewerybrewingclosedcommercialfeatureindustrymainproductionsourcesquarewarmwaterwestern
SHARED TOKENS (17): "additional", "around", "beer", "bottle", "brewery", "brewing", "closed", "commercial", "feature", "industry", "main", "production", "source", "square", "warm", "water", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Brewing". | EXACT TITLE in food: "Brewing".
0.500
brewerybuildingbusinessbuychaincorporatedatadepartmentemployeeenvironmentalformmainnationaloperatingownerownersownershipplanningprimaryprivate
SHARED TOKENS (24): "brewery", "building", "business", "buy", "chain", "corporate", "data", "department", "employee", "environmental", "form", "main", "national", "operating", "owner", "owners", "ownership", "planning", "primary", "private".... | EXACT TITLE in food: "Employee stock ownership plan".
0.500
Soil ↗ Q36133 EXACT TITLE
developmentelevationformformerlooseorganicoriginalproductsciencesoilsspacespecificallysupplysystemthoughwater
SHARED TOKENS (16): "development", "elevation", "form", "former", "loose", "organic", "original", "product", "science", "soils", "space", "specifically", "supply", "system", "though", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Soil". | EXACT TITLE in food: "Soil".
0.500
americanfamilyfoundedgroceryidaholocalmarketoregonoutletproductproductsretailretailerstorestores
SHARED TOKENS (15): "american", "family", "founded", "grocery", "idaho", "local", "market", "oregon", "outlet", "product", "products", "retail", "retailer", "store", "stores". | EXACT TITLE in food: "Grocery Outlet".
0.500
Ice wine ↗ Q828135 EXACT TITLE
coldfreegoodgrapeshoursicelargelimitedlostproducedproducingproductionregionssmalltemperaturewaterwinewines
SHARED TOKENS (18): "cold", "free", "good", "grapes", "hours", "ice", "large", "limited", "lost", "produced", "producing", "production", "regions", "small", "temperature", "water", "wine", "wines". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Ice wine".
0.500
becomebeveragecommercialfoodiceindustrylongmainmillionorganicprimaryproduceproducedproducesproductproductionroomsourcetemperaturevisible
SHARED TOKENS (21): "become", "beverage", "commercial", "food", "ice", "industry", "long", "main", "million", "organic", "primary", "produce", "produced", "produces", "product", "production", "room", "source", "temperature", "visible".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Carbon dioxide".
0.500
aroundbecomebottlefrenchlargelocallongproducedproducersproductionproductsqualityregionsparklingwinewinemakerswines
SHARED TOKENS (17): "around", "become", "bottle", "french", "large", "local", "long", "produced", "producers", "production", "products", "quality", "region", "sparkling", "wine", "winemakers", "wines". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sparkling wine". | EXACT TITLE in food: "Sparkling wine".
0.500
Gin ↗ Q959362 EXACT TITLE
brandsdevelopmentdistilleddistinctemergedfrenchfruitgrapesindustryliquormodernnationalproduceproducedspiritswater
SHARED TOKENS (16): "brands", "development", "distilled", "distinct", "emerged", "french", "fruit", "grapes", "industry", "liquor", "modern", "national", "produce", "produced", "spirits", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Gin". | EXACT TITLE in food: "Gin".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialconsecutivedevelopmentenvironmentalgrowinghourslimitedlocalmarketsorganizationorganizationsoutsiderealsecondsourcespendingsupporting
SHARED TOKENS (21): "activity", "beyond", "business", "commercial", "consecutive", "development", "environmental", "growing", "hours", "limited", "local", "markets", "organization", "organizations", "outside", "real", "second", "source", "spending", "supporting".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Tourism". | EXACT TITLE in food: "Tourism".
0.500
agriculturaldivisioneastelevationidahomajormilesnationalnearnorthpayetteriversnakesquarevalley
SHARED TOKENS (15): "agricultural", "division", "east", "elevation", "idaho", "major", "miles", "national", "near", "north", "payette", "river", "snake", "square", "valley". | EXACT TITLE in food: "Payette River".
0.500
agriculturalagriculturearoundcommercialcoversculturalculturecurrentdifferentdistributioneventsfoodformhealthhistoryindustrynewspersonalproducingproduction
SHARED TOKENS (30): "agricultural", "agriculture", "around", "commercial", "covers", "cultural", "culture", "current", "different", "distribution", "events", "food", "form", "health", "history", "industry", "news", "personal", "producing", "production".... | EXACT TITLE in food: "Food journalism".
0.500
Brewery ↗ Q131734 EXACT TITLE
beerbreweriesbrewersbrewerybrewingbusinesscommercialdistinctfarmsindustryproduceproducedproductionsellingworkers
SHARED TOKENS (15): "beer", "breweries", "brewers", "brewery", "brewing", "business", "commercial", "distinct", "farms", "industry", "produce", "produced", "production", "selling", "workers". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Brewery". | EXACT TITLE in food: "Brewery".
0.500
boiseculturalcultureeastfrenchhistoryidaholimitedmillionnorthnorthwestoregonratherregionthoughwestern
SHARED TOKENS (16): "boise", "cultural", "culture", "east", "french", "history", "idaho", "limited", "million", "north", "northwest", "oregon", "rather", "region", "though", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Pacific Northwest".
0.500
chainchannelsconsumercreatingcustomersdirectdirectlydistributionindependentnetworkproductproductsstructuresupplysystemvalue
SHARED TOKENS (16): "chain", "channels", "consumer", "creating", "customers", "direct", "directly", "distribution", "independent", "network", "product", "products", "structure", "supply", "system", "value". | EXACT TITLE in food: "Supply chain".
0.500
Instacart ↗ Q22909236 EXACT TITLE
alcoholamericanappbrandsbusinessconsumercustomersdeliveryfoodfoundinggrocerymillionmobilenorthoperatespersonalregionsretailstoresvalue
SHARED TOKENS (20): "alcohol", "american", "app", "brands", "business", "consumer", "customers", "delivery", "food", "founding", "grocery", "million", "mobile", "north", "operates", "personal", "regions", "retail", "stores", "value". | EXACT TITLE in food: "Instacart".
0.500
appbecomecitiescustomersdeliverydistributorsfeesfoodgrocerygrowinghealthindependentindustrymobilepersonrestaurantrestaurantsstoresupplierwholesale
SHARED TOKENS (20): "app", "become", "cities", "customers", "delivery", "distributors", "fees", "food", "grocery", "growing", "health", "independent", "industry", "mobile", "person", "restaurant", "restaurants", "store", "supplier", "wholesale". | EXACT TITLE in food: "Food delivery".
0.500
Packaging ↗ Q207822 EXACT TITLE
americanbusinessdescribeddistributiongovernmentindustriallabelinglabelspersonalproducingproductsregionsscienceseparatesystemtechnologytransport
SHARED TOKENS (17): "american", "business", "described", "distribution", "government", "industrial", "labeling", "labels", "personal", "producing", "products", "regions", "science", "separate", "system", "technology", "transport". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Packaging".
0.500
Beer ↗ Q44 EXACT TITLE
alcoholaroundbarsbeerbeveragebreweriesbrewingbusinesscodecommercialculturedistributeddistributionformgrouphealthindustrymodernproducedproducers
SHARED TOKENS (24): "alcohol", "around", "bars", "beer", "beverage", "breweries", "brewing", "business", "code", "commercial", "culture", "distributed", "distribution", "form", "group", "health", "industry", "modern", "produced", "producers".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer". | EXACT TITLE in food: "Beer".
0.500
Nitrogen ↗ Q627 EXACT TITLE
commercialfoodformfrenchgroupindustrialindustrylargemajororganicproducedsecondstoressystemtabletechnologytemperatureuseswater
SHARED TOKENS (19): "commercial", "food", "form", "french", "group", "industrial", "industry", "large", "major", "organic", "produced", "second", "stores", "system", "table", "technology", "temperature", "uses", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Nitrogen".
0.500
Malbec ↗ Q1414045 EXACT TITLE
differententirelyfrenchgrapesgrowingoriginalproduceproducedratherregionregionssystemthoughvalleyvineyardswinewinemakerswines
SHARED TOKENS (18): "different", "entirely", "french", "grapes", "growing", "original", "produce", "produced", "rather", "region", "regions", "system", "though", "valley", "vineyards", "wine", "winemakers", "wines". | EXACT TITLE in food: "Malbec".
0.500
Snake River ↗ Q272074 EXACT TITLE
americancanyoncommercialcultureeasthellshillshistoryiceidaholargelimitedlongmajormilesnationalnearnorthnorthwestoregon
SHARED TOKENS (33): "american", "canyon", "commercial", "culture", "east", "hells", "hills", "history", "ice", "idaho", "large", "limited", "long", "major", "miles", "national", "near", "north", "northwest", "oregon".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Snake River". | EXACT TITLE in food: "Snake River".
0.500
Costco ↗ EXACT TITLE
americanbrandbusinessbusinesseschainclubcorporateformerfoundedgroceryhistoryhousemodelnorthoperatesorganicproduceproductsrankedretail
SHARED TOKENS (27): "american", "brand", "business", "businesses", "chain", "club", "corporate", "former", "founded", "grocery", "history", "house", "model", "north", "operates", "organic", "produce", "products", "ranked", "retail".... | EXACT TITLE in food: "Costco".
0.500
Chobani ↗ Q5103456 EXACT TITLE
americanannouncedbrandcoldexpandedfacilityfoodfoundedmainmarketmillionoperatesownershipproducesproductssharestyle
SHARED TOKENS (17): "american", "announced", "brand", "cold", "expanded", "facility", "food", "founded", "main", "market", "million", "operates", "ownership", "produces", "products", "share", "style". | EXACT TITLE in food: "Chobani".
0.500
Espresso ↗ Q180289 EXACT TITLE
becomebeveragebeyondculturalcultureformhighlyproducedproductionprofilequalityservesservingshopsmalltemperaturewater
SHARED TOKENS (17): "become", "beverage", "beyond", "cultural", "culture", "form", "highly", "produced", "production", "profile", "quality", "serves", "serving", "shop", "small", "temperature", "water". | EXACT TITLE in food: "Espresso".
0.500
Supermarket ↗ Q180846 EXACT TITLE
advertisingalcoholamericanaroundbuychaincustomersdepartmentdistributionfacilityfoodformatgroceryhourslargelimitedmobilenearparkingprocessing
SHARED TOKENS (36): "advertising", "alcohol", "american", "around", "buy", "chain", "customers", "department", "distribution", "facility", "food", "format", "grocery", "hours", "large", "limited", "mobile", "near", "parking", "processing".... | EXACT TITLE in food: "Supermarket".
0.500
Syrah ↗ Q332720 EXACT TITLE
acresavafollowingfruitgrapeshillsproduceproducedprofileregionsriversinglestylevalleywinewines
SHARED TOKENS (16): "acres", "ava", "following", "fruit", "grapes", "hills", "produce", "produced", "profile", "regions", "river", "single", "style", "valley", "wine", "wines". | EXACT TITLE in food: "Syrah".
0.500
Sanitation ↗ Q949149 EXACT TITLE
chaindevelopmentenvironmentalhealthlimitedmainoperatingorganicpersonalpublicrelatedsafetysanitationsystemtechnologyvaluewaterworkers
SHARED TOKENS (18): "chain", "development", "environmental", "health", "limited", "main", "operating", "organic", "personal", "public", "related", "safety", "sanitation", "system", "technology", "value", "water", "workers". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sanitation". | EXACT TITLE in food: "Sanitation".
0.500
ServSafe ↗ Q7455532 EXACT TITLE
administeredalcoholamericanbeveragecertificationcredentialfoodmillionnationalnonprofitprogramrequiredrestaurantrestaurantssafetysanitationwork
SHARED TOKENS (17): "administered", "alcohol", "american", "beverage", "certification", "credential", "food", "million", "national", "nonprofit", "program", "required", "restaurant", "restaurants", "safety", "sanitation", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "ServSafe".
0.500
Local food ↗ Q2674120 EXACT TITLE
chaincommunityconsumerdifferentexplicitlyfarmingfoodhealthlocallongmodelorganicproducedproducersproximityregionrelatedstructuresuppliersupply
SHARED TOKENS (21): "chain", "community", "consumer", "different", "explicitly", "farming", "food", "health", "local", "long", "model", "organic", "produced", "producers", "proximity", "region", "related", "structure", "supplier", "supply".... | EXACT TITLE in food: "Local food".
0.500
Liquor ↗ Q56139 EXACT TITLE
alcoholalreadyaroundbeveragecocktaildistilledformgrouphealthlargeliquornorthproducedproductionrathershapedspirits
SHARED TOKENS (17): "alcohol", "already", "around", "beverage", "cocktail", "distilled", "form", "group", "health", "large", "liquor", "north", "produced", "production", "rather", "shaped", "spirits". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Liquor". | EXACT TITLE in food: "Liquor".
0.500
Albertsons ↗ Q2831861 EXACT TITLE
americanannouncedboisecapitalchaincommissioncorporatedifferentformerfoundedgroceryheadquarteredidahojanuaryjobsnorthrankedregionalrevenuesold
SHARED TOKENS (23): "american", "announced", "boise", "capital", "chain", "commission", "corporate", "different", "former", "founded", "grocery", "headquartered", "idaho", "january", "jobs", "north", "ranked", "regional", "revenue", "sold".... | EXACT TITLE in food: "Albertsons".
0.500
Horticulture ↗ Q48803 EXACT TITLE
agricultureamericanaroundcommercialculturedistinctemergedgrowinghighlyindustrialindustrylimitedorganizationsoutdoorproductionprofessionalratherrequiringsciencevalue
SHARED TOKENS (20): "agriculture", "american", "around", "commercial", "culture", "distinct", "emerged", "growing", "highly", "industrial", "industry", "limited", "organizations", "outdoor", "production", "professional", "rather", "requiring", "science", "value". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Horticulture".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagriculturechangesdirectlydistributeddistributionenvironmentalformlandscapenetworkoperationoperationsoutsideproductionqualityrequiredrequiringriversmallsoils
SHARED TOKENS (24): "agricultural", "agriculture", "changes", "directly", "distributed", "distribution", "environmental", "form", "landscape", "network", "operation", "operations", "outside", "production", "quality", "required", "requiring", "river", "small", "soils".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Irrigation".
0.500
brandsbusinessclubcustomersdirect-to-consumerdirectlymainmodelmodernoperateplatformproductsretailsalesselling
SHARED TOKENS (15): "brands", "business", "club", "customers", "direct-to-consumer", "directly", "main", "model", "modern", "operate", "platform", "products", "retail", "sales", "selling". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Direct-to-consumer". | EXACT TITLE in food: "Direct-to-consumer".
0.500
Wine ↗ Q282 EXACT TITLE
alcoholaroundbarsdifferentfoodgrapesgrowingmarketingproducedproductionqualityregionsrestaurantssecondtradevineyardswesternwinewinemakers
SHARED TOKENS (19): "alcohol", "around", "bars", "different", "food", "grapes", "growing", "marketing", "produced", "production", "quality", "regions", "restaurants", "second", "trade", "vineyards", "western", "wine", "winemakers". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine". | EXACT TITLE in food: "Wine".
0.500
barsbeerbeersbottlebreweriesbrewingcraftdraftglassgrocerygrowingmarketrestaurantsretailsellingsoldstoresthoughtransport
SHARED TOKENS (19): "bars", "beer", "beers", "bottle", "breweries", "brewing", "craft", "draft", "glass", "grocery", "growing", "market", "restaurants", "retail", "selling", "sold", "stores", "though", "transport". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Growler (jug)".
0.500
Wholesaling ↗ Q220695 EXACT TITLE
businessbusinessescommercialconsumerdirectlyindustrialmanufacturermarketmarketsorganizationpersonproductsprofessionalpurchasingratherrelatedsourcetransactionwholesale
SHARED TOKENS (19): "business", "businesses", "commercial", "consumer", "directly", "industrial", "manufacturer", "market", "markets", "organization", "person", "products", "professional", "purchasing", "rather", "related", "source", "transaction", "wholesale". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wholesaling".
0.500
barbarsbeerbusinessclubextensionfoodhouseliquorrestaurantretailservesservingwaterwine
SHARED TOKENS (15): "bar", "bars", "beer", "business", "club", "extension", "food", "house", "liquor", "restaurant", "retail", "serves", "serving", "water", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Bar (establishment)". | EXACT TITLE in food: "Bar (establishment)".
0.500
Yeast ↗ Q45422 EXACT TITLE
clusterconnecteddescribeddivisionformgroupindustrymodelmodernproduceproductionproductsresearchseparatesingletemperature
SHARED TOKENS (16): "cluster", "connected", "described", "division", "form", "group", "industry", "model", "modern", "produce", "production", "products", "research", "separate", "single", "temperature". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Yeast".
0.500
activeagriculturebuildingcellarschainchannelscitiescoldconsumerdailydevelopmentdistributionearlierexpandedfarmsfoodiceindustrialindustryinfrastructure
SHARED TOKENS (46): "active", "agriculture", "building", "cellars", "chain", "channels", "cities", "cold", "consumer", "daily", "development", "distribution", "earlier", "expanded", "farms", "food", "ice", "industrial", "industry", "infrastructure".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Refrigeration".
0.500
agriculturebrewerychangesdirectdistributiondistributorfamilyfarmfarmsfoodformgrowinghighlylocallocallymarketmodelranchrestaurantrestaurants
SHARED TOKENS (28): "agriculture", "brewery", "changes", "direct", "distribution", "distributor", "family", "farm", "farms", "food", "form", "growing", "highly", "local", "locally", "market", "model", "ranch", "restaurant", "restaurants".... | EXACT TITLE in food: "Farm-to-table".
0.500
DoorDash ↗ Q20714323 EXACT TITLE
americancategorydatadeliveryfoodfoundedlistingmarketmillionoperatesoperatingpersonalplatformrestaurantssellingshareworkers
SHARED TOKENS (17): "american", "category", "data", "delivery", "food", "founded", "listing", "market", "million", "operates", "operating", "personal", "platform", "restaurants", "selling", "share", "workers". | EXACT TITLE in food: "DoorDash".
0.490
Vivino ↗ Q17088880 EXACT TITLE
appdifferentfoundedmillionmobilewinewines
SHARED TOKENS (7): "app", "different", "founded", "million", "mobile", "wine", "wines". | URL->A (1): http://www.vivino.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Vivino".
0.480
boisecampusdivisionextensionidahomainoperatesparkproductionprofessionalpublicresearchspendingstatewide
SHARED TOKENS (14): "boise", "campus", "division", "extension", "idaho", "main", "operates", "park", "production", "professional", "public", "research", "spending", "statewide". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "University of Idaho".
0.480
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventfdafoodgroupmodelprivaterestaurantrestaurantssafetyservesservingspecific
SHARED TOKENS (14): "business", "commercial", "event", "fda", "food", "group", "model", "private", "restaurant", "restaurants", "safety", "serves", "serving", "specific". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Catering".
0.480
anchoredboisecanyoncitiesidahomainmeridiannampanorthwestoregonpayettepopulationtreasurevalley
SHARED TOKENS (14): "anchored", "boise", "canyon", "cities", "idaho", "main", "meridian", "nampa", "northwest", "oregon", "payette", "population", "treasure", "valley". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise metropolitan area".
0.480
Terroir ↗ Q627003 EXACT TITLE
aroundenvironmentalfarmingfrenchgrapesgrowingindustrymodelqualitysinglesitespecificsystemwine
SHARED TOKENS (14): "around", "environmental", "farming", "french", "grapes", "growing", "industry", "model", "quality", "single", "site", "specific", "system", "wine". | EXACT TITLE in food: "Terroir".
0.480
americanbeerdifferenteducationeventgoodhistoryproductionprofessionalqualitytastingtrustuseswine
SHARED TOKENS (14): "american", "beer", "different", "education", "event", "good", "history", "production", "professional", "quality", "tasting", "trust", "uses", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer tasting".
0.480
beyondboiseconnectseagleeastgreenbeltidahomilesriverriversideroadsystemtrailurban
SHARED TOKENS (14): "beyond", "boise", "connects", "eagle", "east", "greenbelt", "idaho", "miles", "river", "riverside", "road", "system", "trail", "urban". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise River Greenbelt". | EXACT TITLE in food: "Boise River Greenbelt".
0.480
Barrel ↗ Q10289 EXACT TITLE
alcoholamericanbarrelbeercenterdifferentlargemodernoregonsmallspaceuseswaterwine
SHARED TOKENS (14): "alcohol", "american", "barrel", "beer", "center", "different", "large", "modern", "oregon", "small", "space", "uses", "water", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barrel". | EXACT TITLE in food: "Barrel".
0.480
Festival ↗ Q132241 EXACT TITLE
agriculturecommunitycreatingculturalcultureentertainmenteventfestivalfoodgoodlocalnationalsourcespecific
SHARED TOKENS (14): "agriculture", "community", "creating", "cultural", "culture", "entertainment", "event", "festival", "food", "good", "local", "national", "source", "specific". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Festival". | EXACT TITLE in food: "Festival".
0.480
currentdepartmentdirectlyfdafoodformerhealthprimaryproductspublicrelatedsafetyuseswork
SHARED TOKENS (14): "current", "department", "directly", "fda", "food", "former", "health", "primary", "products", "public", "related", "safety", "uses", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food and Drug Administration".
0.480
Wine club ↗ Q8024922 EXACT TITLE
clubculturecustomersextensionindependentmembershipmodernprogrampurchaseshopsspecialtyvineyardswinewines
SHARED TOKENS (14): "club", "culture", "customers", "extension", "independent", "membership", "modern", "program", "purchase", "shops", "specialty", "vineyards", "wine", "wines". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine club".
0.470
businesscaldwellidahoregionalrestaurantrestaurants
SHARED TOKENS (6): "business", "caldwell", "idaho", "regional", "restaurant", "restaurants". | URL->B (1): https://www.amanorestaurante.com/. | EXACT TITLE in food: "Amano (restaurant)".
0.460
Inventory ↗ Q815410 EXACT TITLE
americanbusinessbusinessesdifferentfacilitymanufacturingnetworkproductionproductsrequiredsupplysystemwork
SHARED TOKENS (13): "american", "business", "businesses", "different", "facility", "manufacturing", "network", "production", "products", "required", "supply", "system", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Inventory".
0.460
Uber Eats ↗ Q21462723 EXACT TITLE
americanbrandcomdeliveryeatfeesfoodindependentoperateoperationsplatformwesternworker
SHARED TOKENS (13): "american", "brand", "com", "delivery", "eat", "fees", "food", "independent", "operate", "operations", "platform", "western", "worker". | EXACT TITLE in food: "Uber Eats".
0.460
WinCo Foods ↗ EXACT TITLE
americanboisechaincomdistributionfeaturefoodfoundedidahooregonretailstorestores
SHARED TOKENS (13): "american", "boise", "chain", "com", "distribution", "feature", "food", "founded", "idaho", "oregon", "retail", "store", "stores". | EXACT TITLE in food: "WinCo Foods".
0.460
Pollination ↗ Q134624 EXACT TITLE
agricultureclosedcoversdirectlydivisionmainproduceproductionresearchstylesystemwaterwork
SHARED TOKENS (13): "agriculture", "closed", "covers", "directly", "division", "main", "produce", "production", "research", "style", "system", "water", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Pollination".
0.460
Logistics ↗ Q177777 EXACT TITLE
chaincustomersfacilityfoodlinesmodelplanningproductionproductsprofessionalpublicrelatedsupply
SHARED TOKENS (13): "chain", "customers", "facility", "food", "lines", "model", "planning", "production", "products", "professional", "public", "related", "supply". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Logistics".
0.460
agriculturalagriculturechangesdifferentenvironmentalfoodformindustrialprimaryprocessingproductproductsrequired
SHARED TOKENS (13): "agricultural", "agriculture", "changes", "different", "environmental", "food", "form", "industrial", "primary", "processing", "product", "products", "required". | EXACT TITLE in food: "Food processing".
0.460
alcoholbeerbeveragebottlebusinesslimitedliquorlocalregionretailshopstorewine
SHARED TOKENS (13): "alcohol", "beer", "beverage", "bottle", "business", "limited", "liquor", "local", "region", "retail", "shop", "store", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Liquor store".
0.460
Riesling ↗ Q456471 EXACT TITLE
acresdevelopmentfrenchfruithighlyqualityregionregionssparklingvalleywesternwinewines
SHARED TOKENS (13): "acres", "development", "french", "fruit", "highly", "quality", "region", "regions", "sparkling", "valley", "western", "wine", "wines". | EXACT TITLE in food: "Riesling".
0.460
Hops ↗ Q3214940 EXACT TITLE
aroundbeerbeersbrewersbrewingcommercialdifferentfamilygardenproductionseparatesourcethough
SHARED TOKENS (13): "around", "beer", "beers", "brewers", "brewing", "commercial", "different", "family", "garden", "production", "separate", "source", "though". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Hops". | EXACT TITLE in food: "Hops".
0.460
Potato ↗ Q10998 EXACT TITLE
becomedifferentexpansionfamilyfollowingfoodpotatoesproduceproductionregionsecondsinglesupply
SHARED TOKENS (13): "become", "different", "expansion", "family", "following", "food", "potatoes", "produce", "production", "region", "second", "single", "supply". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Potato". | EXACT TITLE in food: "Potato".
0.440
Winery ↗ Q156362 EXACT TITLE
buildingbusinessfarmsfeaturelargelineslongproducesproductionwinewinerieswinery
SHARED TOKENS (12): "building", "business", "farms", "feature", "large", "lines", "long", "produces", "production", "wine", "wineries", "winery". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Winery". | EXACT TITLE in food: "Winery".
0.440
Mead ↗ Q184442 EXACT TITLE
alcoholbeveragedistinctfruitgrapesmeadproducedproductsparklingwaterwinewines
SHARED TOKENS (12): "alcohol", "beverage", "distinct", "fruit", "grapes", "mead", "produced", "product", "sparkling", "water", "wine", "wines". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Mead". | EXACT TITLE in food: "Mead".
0.440
Tempranillo ↗ Q519874 EXACT TITLE
acresbarrelearliergrapesmainproduceprofileregionregionssoilswinewines
SHARED TOKENS (12): "acres", "barrel", "earlier", "grapes", "main", "produce", "profile", "region", "regions", "soils", "wine", "wines". | EXACT TITLE in food: "Tempranillo".
0.420
eatfoodformhighlyindustrialmajorprocessingproductionproductsvaluewater
SHARED TOKENS (11): "eat", "food", "form", "highly", "industrial", "major", "processing", "production", "products", "value", "water". | EXACT TITLE in food: "Nixtamalization".
0.420
Malt ↗ Q152024 EXACT TITLE
alreadybeerformingredientproductproductsrequiredsinglesmallthoughwater
SHARED TOKENS (11): "already", "beer", "form", "ingredient", "product", "products", "required", "single", "small", "though", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Malt".
0.420
Rum ↗ Q83376 EXACT TITLE
americanbeverageculturaldistilledhistoryliquormajorproducedprofilesregiontrade
SHARED TOKENS (11): "american", "beverage", "cultural", "distilled", "history", "liquor", "major", "produced", "profiles", "region", "trade". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Rum". | EXACT TITLE in food: "Rum".
0.400
activitycitiesdogfreeoutdooroutsidepopulationratherriverrock
SHARED TOKENS (10): "activity", "cities", "dog", "free", "outdoor", "outside", "population", "rather", "river", "rock". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Outdoor recreation".
0.400
culturalcultureeasteventsfoodindianlocallynorthregionaltrade
SHARED TOKENS (10): "cultural", "culture", "east", "events", "food", "indian", "locally", "north", "regional", "trade". | EXACT TITLE in food: "Indian cuisine".
0.400
Kombucha ↗ Q657032 EXACT TITLE
alcoholbeveragecommercialculturefruithealthmarketproducedsmallsold
SHARED TOKENS (10): "alcohol", "beverage", "commercial", "culture", "fruit", "health", "market", "produced", "small", "sold". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Kombucha".
0.400
americanboiseeaglefoodfrenchheadquarteredidahoprocessingproducersproducts
SHARED TOKENS (10): "american", "boise", "eagle", "food", "french", "headquartered", "idaho", "processing", "producers", "products". | EXACT TITLE in food: "Lamb Weston".
0.400
Boise River ↗ Q891080 EXACT TITLE
agriculturalboisehighlyidahomilesriversnakesquareurbanwestern
SHARED TOKENS (10): "agricultural", "boise", "highly", "idaho", "miles", "river", "snake", "square", "urban", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise River". | EXACT TITLE in food: "Boise River".
0.380
Food & Wine ↗ EXACT TITLE
americanchefseventfoodfoundedpublicrestauranttastingwine
SHARED TOKENS (9): "american", "chefs", "event", "food", "founded", "public", "restaurant", "tasting", "wine". | EXACT TITLE in food: "Food & Wine".
0.380
becomemodernpersonalproductionprofessionalregiontastingwinewines
SHARED TOKENS (9): "become", "modern", "personal", "production", "professional", "region", "tasting", "wine", "wines". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine tasting". | EXACT TITLE in food: "Wine tasting".
0.380
alcoholaroundbeverageentirelyfruitoutsideproductssparklingwater
SHARED TOKENS (9): "alcohol", "around", "beverage", "entirely", "fruit", "outside", "products", "sparkling", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Hard seltzer".
0.380
Vodka ↗ Q374 EXACT TITLE
alcoholbeveragebrandsdistilledfruiticemodernpotatoeswater
SHARED TOKENS (9): "alcohol", "beverage", "brands", "distilled", "fruit", "ice", "modern", "potatoes", "water". | EXACT TITLE in food: "Vodka".
0.380
bureaucourtcreatingdepartmentidaholegislatureorganizationpublicstatewide
SHARED TOKENS (9): "bureau", "court", "creating", "department", "idaho", "legislature", "organization", "public", "statewide". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho State Police".
0.380
beerbeeradvocatecertificationchainprogramsourcestoresystemthough
SHARED TOKENS (9): "beer", "beeradvocate", "certification", "chain", "program", "source", "store", "system", "though". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer rating".
0.380
chainmodernnorthproducedqualityrelatedspecialtysupplytrade
SHARED TOKENS (9): "chain", "modern", "north", "produced", "quality", "related", "specialty", "supply", "trade". | EXACT TITLE in food: "Specialty coffee".
0.380
beereducationfoundedheadquarteredorganizationprovidersspiritstrustwine
SHARED TOKENS (9): "beer", "education", "founded", "headquartered", "organization", "providers", "spirits", "trust", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine & Spirit Education Trust".
0.380
Barley ↗ Q11577 EXACT TITLE
aroundbeerdistilledfamilymajormillionproducedproductionsource
SHARED TOKENS (9): "around", "beer", "distilled", "family", "major", "million", "produced", "production", "source". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barley".
0.380
americanaroundbarscitiesfoodnetworkpagerestaurantsroad
SHARED TOKENS (9): "american", "around", "bars", "cities", "food", "network", "page", "restaurants", "road". | EXACT TITLE in food: "Diners, Drive-Ins and Dives".
0.360
Vineyard ↗ Q22715 EXACT TITLE
frenchgrapesproductionsciencespecifictablevineyardswine
SHARED TOKENS (8): "french", "grapes", "production", "science", "specific", "table", "vineyards", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Vineyard". | EXACT TITLE in food: "Vineyard".
0.360
boisedepartmentenvironmentalgovernmentidahomainqualityregional
SHARED TOKENS (8): "boise", "department", "environmental", "government", "idaho", "main", "quality", "regional". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho Department of Environmental Quality".
0.360
Beer garden ↗ Q857909 EXACT TITLE
beerbrewerycapitalfoodgardenlocaloutdoorrestaurant
SHARED TOKENS (8): "beer", "brewery", "capital", "food", "garden", "local", "outdoor", "restaurant". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer garden". | EXACT TITLE in food: "Beer garden".
0.360
Sommelier ↗ Q191493 EXACT TITLE
foodfrenchpairingpersonprofessionalrestaurantstastingwine
SHARED TOKENS (8): "food", "french", "pairing", "person", "professional", "restaurants", "tasting", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sommelier".
0.360
functiongrowingorganicratherspecifictemperaturevaluewater
SHARED TOKENS (8): "function", "growing", "organic", "rather", "specific", "temperature", "value", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Biochemical oxygen demand".
0.360
Grape ↗ Q10978 EXACT TITLE
culturalfoodformfruitgrapesgrowinghistoryproducts
SHARED TOKENS (8): "cultural", "food", "form", "fruit", "grapes", "growing", "history", "products". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Grape". | EXACT TITLE in food: "Grape".
0.340
Mezcal ↗ Q726413 EXACT TITLE
americanbeveragedistilledfamilyformproductregions
SHARED TOKENS (7): "american", "beverage", "distilled", "family", "form", "product", "regions". | EXACT TITLE in food: "Mezcal".
0.340
activityagriculturefarmoperationranchtourismvisitors
SHARED TOKENS (7): "activity", "agriculture", "farm", "operation", "ranch", "tourism", "visitors". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Agritourism".
0.340
Food hall ↗ Q18355750 EXACT TITLE
departmentfoodlargeretailsoldstandalonestore
SHARED TOKENS (7): "department", "food", "large", "retail", "sold", "standalone", "store". | EXACT TITLE in food: "Food hall".
0.340
Birria ↗ Q4916959 EXACT TITLE
arounddistinctformregionalrestaurantsstreetwestern
SHARED TOKENS (7): "around", "distinct", "form", "regional", "restaurants", "street", "western". | EXACT TITLE in food: "Birria".
0.340
barsdinnerfoodfrenchmenuspotatoesrestaurants
SHARED TOKENS (7): "bars", "dinner", "food", "french", "menus", "potatoes", "restaurants". | EXACT TITLE in food: "French fries".
0.340
beerchangesfoodmainprocessingproductswater
SHARED TOKENS (7): "beer", "changes", "food", "main", "processing", "products", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food chemistry".
0.340
Chemistry ↗ Q2329 EXACT TITLE
changesenvironmentalfoundationindustrysciencestructurework
SHARED TOKENS (7): "changes", "environmental", "foundation", "industry", "science", "structure", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Chemistry".
0.340
culturelistsmajorproductproductionqualityrelationships
SHARED TOKENS (7): "culture", "lists", "major", "product", "production", "quality", "relationships". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Quality control".
0.340
nearpurchasesourcetastingtourismwinewineries
SHARED TOKENS (7): "near", "purchase", "source", "tasting", "tourism", "wine", "wineries". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine tourism".
0.340
Oyster bar ↗ Q7116364 EXACT TITLE
bardistinctfoodhouserestaurantservesserving
SHARED TOKENS (7): "bar", "distinct", "food", "house", "restaurant", "serves", "serving". | EXACT TITLE in food: "Oyster bar".
0.320
Wastewater ↗ Q336191 EXACT TITLE
agriculturalcommercialcommunityindustrialproducedwater
SHARED TOKENS (6): "agricultural", "commercial", "community", "industrial", "produced", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wastewater".
0.320
beveragecourtfoodorganizationpairingwine
SHARED TOKENS (6): "beverage", "court", "food", "organization", "pairing", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Court of Master Sommeliers".
0.320
certificationemployeroutsideprofessionalsystemtrade
SHARED TOKENS (6): "certification", "employer", "outside", "professional", "system", "trade". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Apprenticeship".
0.320
Keg ↗ Q947211 EXACT TITLE
barrelbeerbeveragesmallstoretransport
SHARED TOKENS (6): "barrel", "beer", "beverage", "small", "store", "transport". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Keg". | EXACT TITLE in food: "Keg".
0.320
bottledistributionfoodglassliquoruses
SHARED TOKENS (6): "bottle", "distribution", "food", "glass", "liquor", "uses". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Glass bottle".
0.300
buildingbusinessescapitalchainchannelscreatingcustomersdepartmentdistributioninfrastructuremarketingnodeoperationspartnersplanningproductproductionproductspurchasingrequired
SHARED TOKENS (26): "building", "businesses", "capital", "chain", "channels", "creating", "customers", "department", "distribution", "infrastructure", "marketing", "node", "operations", "partners", "planning", "product", "production", "products", "purchasing", "required"....
0.300
brandbuildingbusinesscorporatedevelopmentdifferenteventeventsindustrymarketmarketingorganizationsparkingpermitspersonpersonalplanningproductionpublicrelationships
SHARED TOKENS (25): "brand", "building", "business", "corporate", "development", "different", "event", "events", "industry", "market", "marketing", "organizations", "parking", "permits", "person", "personal", "planning", "production", "public", "relationships"....
0.300
activebusinessesdistributionfunctionindustrialindustrymarketorganizationproducesproductionregulatoryrelatedsalessharesharessmallstructurework
SHARED TOKENS (18): "active", "businesses", "distribution", "function", "industrial", "industry", "market", "organization", "produces", "production", "regulatory", "related", "sales", "share", "shares", "small", "structure", "work".
0.300
Simplot ↗ Q3484788 EXACT TITLE
agricultureamericanboiseheadquarteredidaho
SHARED TOKENS (5): "agriculture", "american", "boise", "headquartered", "idaho". | EXACT TITLE in food: "Simplot".
0.300
becomechaindescribeddifferentdirectlyfreelargemarketownershipproduceproducedproducesproductproductsratherrelatedriversuppliessupply
SHARED TOKENS (19): "become", "chain", "described", "different", "directly", "free", "large", "market", "ownership", "produce", "produced", "produces", "product", "products", "rather", "related", "river", "supplies", "supply".
0.300
alcoholamericanbarsbeerbeersbrewbrewersbrewingcidercommunitydistilleddistributiondistrictfacilityfreegovernmenthourslegalliquorlocal
SHARED TOKENS (38): "alcohol", "american", "bars", "beer", "beers", "brew", "brewers", "brewing", "cider", "community", "distilled", "distribution", "district", "facility", "free", "government", "hours", "legal", "liquor", "local"....
0.300
culturallocalregionregionsshares
SHARED TOKENS (5): "cultural", "local", "region", "regions", "shares". | EXACT TITLE in food: "Eritrean cuisine".
0.300
agriculturalagriculturebusinesscertificationcertifiedchangescodecommunityenvironmentalfarmfarmingfoodfootprintformgrowingorganicpopulationproductiontradewater
SHARED TOKENS (20): "agricultural", "agriculture", "business", "certification", "certified", "changes", "code", "community", "environmental", "farm", "farming", "food", "footprint", "form", "growing", "organic", "population", "production", "trade", "water".
0.300
agriculturalagriculturecommunityconnectsconsumerdistributioneventsfarmfarmingfarmsfoodgardengrouplocalmarketmarketsmodelnorthorganicorganization
SHARED TOKENS (33): "agricultural", "agriculture", "community", "connects", "consumer", "distribution", "events", "farm", "farming", "farms", "food", "garden", "group", "local", "market", "markets", "model", "north", "organic", "organization"....
0.300
Oak (wine) ↗ Q808963 EXACT TITLE
barrelexposureformprofilewine
SHARED TOKENS (5): "barrel", "exposure", "form", "profile", "wine". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Oak (wine)".
0.300
activitybusinesscapitalcommissioncorporatedepartmentdescribeddirectgovernmentlegalmarketoperatingoperationsorganizationownershipregulatorysharesingletradetransaction
SHARED TOKENS (20): "activity", "business", "capital", "commission", "corporate", "department", "described", "direct", "government", "legal", "market", "operating", "operations", "organization", "ownership", "regulatory", "share", "single", "trade", "transaction".
0.300
alcoholbureaudepartmentregulatestrade
SHARED TOKENS (5): "alcohol", "bureau", "department", "regulates", "trade". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Alcohol and Tobacco Tax and Trade Bureau".
0.300
differentlegalriversourcewater
SHARED TOKENS (5): "different", "legal", "river", "source", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Water right".
0.300
Winemaking ↗ Q213376 KW CROSS HIGH
alcoholaroundbeerciderfruitgrapesgrowinghistorymainmeadproductionscienceselectionsparklingspiritswaterwine
SHARED TOKENS (17): "alcohol", "around", "beer", "cider", "fruit", "grapes", "growing", "history", "main", "mead", "production", "science", "selection", "sparkling", "spirits", "water", "wine".
0.300
Bistro ↗ Q866742 EXACT TITLE
formoriginalrestaurantservingsmall
SHARED TOKENS (5): "form", "original", "restaurant", "serving", "small". | EXACT TITLE in food: "Bistro".
0.300
beveragecocktaildistilledfoodfruitingredientliquorlocallocallymainnationalpotatoesproductsregionregionalvisiblewine
SHARED TOKENS (17): "beverage", "cocktail", "distilled", "food", "fruit", "ingredient", "liquor", "local", "locally", "main", "national", "potatoes", "products", "region", "regional", "visible", "wine".
0.300
brandsbusinessbusinessescustomersdeliveryestatefoodformatkitchenoperaterealrestaurantrestaurantsroomseparateservessharesinglespace
SHARED TOKENS (19): "brands", "business", "businesses", "customers", "delivery", "estate", "food", "format", "kitchen", "operate", "real", "restaurant", "restaurants", "room", "separate", "serves", "share", "single", "space".
0.300
Rosé ↗ Q12979 KW CROSS HIGH
aroundfrenchgrapesgrowinghighlyhoursmajorprimaryproduceproducedproducersproductratherregionssparklingwinewines
SHARED TOKENS (17): "around", "french", "grapes", "growing", "highly", "hours", "major", "primary", "produce", "produced", "producers", "product", "rather", "regions", "sparkling", "wine", "wines".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
brandbusinesscapitalchaincorporatedirectexpansionexplicitlyfeeshighlylargelegallicensingmarketmodelpartnershipproductsresearchrightssmall
SHARED TOKENS (23): "brand", "business", "capital", "chain", "corporate", "direct", "expansion", "explicitly", "fees", "highly", "large", "legal", "licensing", "market", "model", "partnership", "products", "research", "rights", "small"....
0.300
Cocktail ↗ Q134768 EXACT TITLE
cocktailoriginalregionsspiritswater
SHARED TOKENS (5): "cocktail", "original", "regions", "spirits", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Cocktail". | EXACT TITLE in food: "Cocktail".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangesdescribeddevelopmententerpriseexpansionlimitedownershipprivateproductproductspublicratherspecific
SHARED TOKENS (17): "active", "business", "capital", "category", "changes", "described", "development", "enterprise", "expansion", "limited", "ownership", "private", "product", "products", "public", "rather", "specific".
0.300
becomedevelopmententertainmentgatewaylargemajormobilenewsoperateplatformproductproductsresearchrestaurantsselectionsinglesourcespecificsystemvalue
SHARED TOKENS (20): "become", "development", "entertainment", "gateway", "large", "major", "mobile", "news", "operate", "platform", "product", "products", "research", "restaurants", "selection", "single", "source", "specific", "system", "value".
0.300
americanbeerbeveragebrewbreweriescraftindustrymarketmillionnorthproducedproducingproductsrankedsalessecondsmallstyle
SHARED TOKENS (18): "american", "beer", "beverage", "brew", "breweries", "craft", "industry", "market", "million", "north", "produced", "producing", "products", "ranked", "sales", "second", "small", "style".
0.300
Vitis vinifera ↗ Q30046 KW CROSS HIGH
aroundcommercialeastfamilyformfruitgrapesmajornorthproduceproducedproductionregionregionsrequiredseparatetablethoughwinewines
SHARED TOKENS (20): "around", "commercial", "east", "family", "form", "fruit", "grapes", "major", "north", "produce", "produced", "production", "region", "regions", "required", "separate", "table", "though", "wine", "wines".
0.300
bureaucodedepartmentestaterevenue
SHARED TOKENS (5): "bureau", "code", "department", "estate", "revenue". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Internal Revenue Code".
🫐 BERRY68 edges
0.280
Pasteurization ↗ Q58148 KW CROSS HIGH
changesdirectfoodfrenchfruitindustryprocessingproductsqualityresearchsafetysystemwaterwine
SHARED TOKENS (14): "changes", "direct", "food", "french", "fruit", "industry", "processing", "products", "quality", "research", "safety", "system", "water", "wine".
0.280
culturedirectlylargelivelocalmarketmarketsproduceproductspublicretailshopssoldvendors
SHARED TOKENS (14): "culture", "directly", "large", "live", "local", "market", "markets", "produce", "products", "public", "retail", "shops", "sold", "vendors".
0.280
departmentdevelopmentidahotechnology
SHARED TOKENS (4): "department", "development", "idaho", "technology". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho Department of Labor".
0.280
Tied house ↗ Q7800977 KW CROSS HIGH
beerbeersbrewerybuydescribedfreegovernmenthouseindustrialpublicrelationshipsrequiredspecificsystem
SHARED TOKENS (14): "beer", "beers", "brewery", "buy", "described", "free", "government", "house", "industrial", "public", "relationships", "required", "specific", "system".
0.280
departmenthealthidahopublic
SHARED TOKENS (4): "department", "health", "idaho", "public". | EXACT TITLE in food: "Idaho Department of Health and Welfare".
0.280
agriculturalamericanchickenculturalculturefollowingfoodhistorylocalproductsregionalregionsstructuretrade
SHARED TOKENS (14): "agricultural", "american", "chicken", "cultural", "culture", "following", "food", "history", "local", "products", "regional", "regions", "structure", "trade".
0.280
distributorfunctionmainsystem
SHARED TOKENS (4): "distributor", "function", "main", "system". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Distributor". | EXACT TITLE in food: "Distributor".
0.280
Red wine ↗ Q1827 EXACT TITLE
grapesproductionwinewines
SHARED TOKENS (4): "grapes", "production", "wine", "wines". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Red wine". | EXACT TITLE in food: "Red wine".
0.280
Cider ↗ Q167296 EXACT TITLE
beverageciderfruitsecond
SHARED TOKENS (4): "beverage", "cider", "fruit", "second". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Cider". | EXACT TITLE in food: "Cider".
0.280
App store ↗ Q3814081 KW CROSS HIGH
additionalappcommercialdistributionlicensingmobileoperatingpersonalplatformrelatedspecificstorestoressystem
SHARED TOKENS (14): "additional", "app", "commercial", "distribution", "licensing", "mobile", "operating", "personal", "platform", "related", "specific", "store", "stores", "system".
0.280
Cold chain ↗ Q592197 KW CROSS HIGH
agriculturalchaincolddestinationdistributeddistributionfoodproduceproductionproductsqualitysafetysupplyuses
SHARED TOKENS (14): "agricultural", "chain", "cold", "destination", "distributed", "distribution", "food", "produce", "production", "products", "quality", "safety", "supply", "uses".
0.260
Omakase ↗ Q7089494 EXACT TITLE
formrestaurantrestaurants
SHARED TOKENS (3): "form", "restaurant", "restaurants". | EXACT TITLE in food: "Omakase".
0.260
Empanada ↗ Q747457 EXACT TITLE
americannorthturnover
SHARED TOKENS (3): "american", "north", "turnover". | EXACT TITLE in food: "Empanada".
0.260
Steakhouse ↗ Q3109696 EXACT TITLE
housemodernrestaurant
SHARED TOKENS (3): "house", "modern", "restaurant". | EXACT TITLE in food: "Steakhouse".
0.260
connecteddatafeesgrouplinesmarketingmarketsorganizationspersonproductproductsrelatedspace
SHARED TOKENS (13): "connected", "data", "fees", "group", "lines", "marketing", "markets", "organizations", "person", "product", "products", "related", "space".
0.260
familynorthrelated
SHARED TOKENS (3): "family", "north", "related". | EXACT TITLE in food: "Huckleberry".
0.260
E-commerce ↗ Q484847 KW CROSS HIGH
businesschaincommercialdataindustrymarketingmobileprocessingproductsretailsellingsupplytransaction
SHARED TOKENS (13): "business", "chain", "commercial", "data", "industry", "marketing", "mobile", "processing", "products", "retail", "selling", "supply", "transaction".
0.260
eastregionwestern
SHARED TOKENS (3): "east", "region", "western". | EXACT TITLE in food: "Intermountain West".
0.240
White wine ↗ Q10210 KW CROSS HIGH
alcoholbottlegrapeshistorylargelongproduceproducedsparklingstylewinewines
SHARED TOKENS (12): "alcohol", "bottle", "grapes", "history", "large", "long", "produce", "produced", "sparkling", "style", "wine", "wines".
0.240
agriculturalagriculturebureaudepartmentfoodfoundedgovernmentidaholicensingprogramsafetystate-level
SHARED TOKENS (12): "agricultural", "agriculture", "bureau", "department", "food", "founded", "government", "idaho", "licensing", "program", "safety", "state-level".
0.240
agriculturalcitiescoverseastfeatureidahomajormilesnorthwestriversnakevolcanic
SHARED TOKENS (12): "agricultural", "cities", "covers", "east", "feature", "idaho", "major", "miles", "northwest", "river", "snake", "volcanic".
0.240
barsbeveragecategoryestateeventfoodhospitalityindustryplanningrealrestaurantstourism
SHARED TOKENS (12): "bars", "beverage", "category", "estate", "event", "food", "hospitality", "industry", "planning", "real", "restaurants", "tourism".
0.240
Food science ↗ Q1637030 KW CROSS HIGH
agriculturaldevelopmentdirectlyfoodmodernprocessingproduceproductionproductssafetysciencetechnology
SHARED TOKENS (12): "agricultural", "development", "directly", "food", "modern", "processing", "produce", "production", "products", "safety", "science", "technology".
0.240
becomedevelopmentformgoodgrapeshealthlayersoilsstructuresupportsvineyardswater
SHARED TOKENS (12): "become", "development", "form", "good", "grapes", "health", "layer", "soils", "structure", "supports", "vineyards", "water".
0.220
Sourdough ↗ Q3360560 EXACT TITLE
producessour
SHARED TOKENS (2): "produces", "sour". | EXACT TITLE in food: "Sourdough".
0.220
businesscoversdepartmentdestinationhospitalityindustrymarketingorganizationsrestaurantsschooltourism
SHARED TOKENS (11): "business", "covers", "department", "destination", "hospitality", "industry", "marketing", "organizations", "restaurants", "school", "tourism".
0.220
arounddinnereventfamilyfoodformhospitalityhoursratherreceiveseparate
SHARED TOKENS (11): "around", "dinner", "event", "family", "food", "form", "hospitality", "hours", "rather", "receive", "separate".
0.220
consumercorporatedistributionfoodnationaloutletoutsideprivateproductionpublicrather
SHARED TOKENS (11): "consumer", "corporate", "distribution", "food", "national", "outlet", "outside", "private", "production", "public", "rather".
0.220
boisedatadistrictgovernmenthouseidaholegislaturenorthpopulationsinglesplit
SHARED TOKENS (11): "boise", "data", "district", "government", "house", "idaho", "legislature", "north", "population", "single", "split".
0.220
fdafoodgroceryhouseindustryjanuarylegallostmajorsafetysales
SHARED TOKENS (11): "fda", "food", "grocery", "house", "industry", "january", "legal", "lost", "major", "safety", "sales".
0.220
Natural wine ↗ Q3559389 KW CROSS HIGH
formfrenchgrapesindustriallimitedproducedproductionrathersmallwinewinemakers
SHARED TOKENS (11): "form", "french", "grapes", "industrial", "limited", "produced", "production", "rather", "small", "wine", "winemakers".
0.210
Injera ↗ Q935807 EXACT TITLE
sour
SHARED TOKENS (1): "sour". | EXACT TITLE in food: "Injera".
0.210
Trattoria ↗ Q1690553 EXACT TITLE
restaurant
SHARED TOKENS (1): "restaurant". | EXACT TITLE in food: "Trattoria".
0.200
businessesfarmslandscapemissionorganizationpartnersprivatequalityspacewater
SHARED TOKENS (10): "businesses", "farms", "landscape", "mission", "organization", "partners", "private", "quality", "space", "water".
0.200
beyondgrapesgrowingproducedproducersratherregionsvineyardswinewines
SHARED TOKENS (10): "beyond", "grapes", "growing", "produced", "producers", "rather", "regions", "vineyards", "wine", "wines".
0.200
Wine label ↗ Q1420576 KW CROSS HIGH
codelabelinglabelsnationalproducerspurchasingqualitysitespecificwine
SHARED TOKENS (10): "code", "labeling", "labels", "national", "producers", "purchasing", "quality", "site", "specific", "wine".
0.200
Beer style ↗ Q1998962 KW CROSS HIGH
beerbeersdifferentguidehistorylocalmodernproductionstylework
SHARED TOKENS (10): "beer", "beers", "different", "guide", "history", "local", "modern", "production", "style", "work".
0.200
foodindustrialindustrymanufacturingorganicproduceproducedproductionsystemwater
SHARED TOKENS (10): "food", "industrial", "industry", "manufacturing", "organic", "produce", "produced", "production", "system", "water".
0.200
Wine cellar ↗ Q22995 KW CROSS HIGH
activecellarsdepartmenthouselargeroomsmallsystemtemperaturewine
SHARED TOKENS (10): "active", "cellars", "department", "house", "large", "room", "small", "system", "temperature", "wine".
0.200
Cider mill ↗ Q5119518 KW CROSS HIGH
ciderlegalnearproductionproductsspecificallystorestructurewaterwine
SHARED TOKENS (10): "cider", "legal", "near", "production", "products", "specifically", "store", "structure", "water", "wine".
0.200
alcoholalongsidechangesdifferentlegalpersonprivatepublicpurchasepurchasing
SHARED TOKENS (10): "alcohol", "alongside", "changes", "different", "legal", "person", "private", "public", "purchase", "purchasing".
0.180
boisegardengovernmentidahomainpopulationsecondseparatestreet
SHARED TOKENS (9): "boise", "garden", "government", "idaho", "main", "population", "second", "separate", "street".
0.180
Malting ↗ Q4395224 KW CROSS HIGH
brewingchangeshouselargelayerloosemodernproducerequired
SHARED TOKENS (9): "brewing", "changes", "house", "large", "layer", "loose", "modern", "produce", "required".
0.160
Liqueur ↗ Q178780 KW CROSS HIGH
additionalbeveragebeyondfrenchiceproducedproductionspirits
SHARED TOKENS (8): "additional", "beverage", "beyond", "french", "ice", "produced", "production", "spirits".
0.160
brewcoldfrenchhoursiceroomtemperaturewater
SHARED TOKENS (8): "brew", "cold", "french", "hours", "ice", "room", "temperature", "water".
0.160
alcoholconsumerdirectlylocalproductproductsratherretailer
SHARED TOKENS (8): "alcohol", "consumer", "directly", "local", "product", "products", "rather", "retailer".
0.160
aroundcodedifferentexpandedformlinessystemtemperature
SHARED TOKENS (8): "around", "code", "different", "expanded", "form", "lines", "system", "temperature".
0.160
americandescribedfoodfoundationindustrynonprofitorganizationrelated
SHARED TOKENS (8): "american", "described", "food", "foundation", "industry", "nonprofit", "organization", "related".
0.140
commerciallargeproducesproductsprofileshopsspecialty
SHARED TOKENS (7): "commercial", "large", "produces", "products", "profile", "shops", "specialty".
0.140
Pincho ↗ Q1452513 KW CROSS HIGH
barsculturefoodlocalmainrelatedsmall
SHARED TOKENS (7): "bars", "culture", "food", "local", "main", "related", "small".
0.140
Txakoli ↗ Q1792144 KW CROSS HIGH
alcoholhistorylargenearproducedsparklingwine
SHARED TOKENS (7): "alcohol", "history", "large", "near", "produced", "sparkling", "wine".
0.140
guidehealthpublicqualityrestaurantrestaurantssanitation
SHARED TOKENS (7): "guide", "health", "public", "quality", "restaurant", "restaurants", "sanitation".
0.120
Basque cuisine ↗ Q521179 KW CROSS HIGH
ciderlocalregionsparklingstylewine
SHARED TOKENS (6): "cider", "local", "region", "sparkling", "style", "wine".
0.120
advertisingconsumerdepartmentslargemarketingproducts
SHARED TOKENS (6): "advertising", "consumer", "departments", "large", "marketing", "products".
0.120
customersformproductproductsprofessionalpurchasing
SHARED TOKENS (6): "customers", "form", "product", "products", "professional", "purchasing".
0.120
beercategorycrafteastlongstyle
SHARED TOKENS (6): "beer", "category", "craft", "east", "long", "style".
0.120
Culinary arts ↗ Q2111686 KW CROSS HIGH
chefsfoodformlargerestaurantsscience
SHARED TOKENS (6): "chefs", "food", "form", "large", "restaurants", "science".
0.120
boisecenteridahoindianpopulationvalley
SHARED TOKENS (6): "boise", "center", "idaho", "indian", "population", "valley".
0.120
americandistinctfeaturehighlyregionspecific
SHARED TOKENS (6): "american", "distinct", "feature", "highly", "region", "specific".
0.120
Basques ↗ Q126756 KW CROSS HIGH
aroundculturedirectgroupregionwestern
SHARED TOKENS (6): "around", "culture", "direct", "group", "region", "western".
0.120
Foodie ↗ Q1435960 KW CROSS HIGH
aroundculturedifferentfoodpersonrelated
SHARED TOKENS (6): "around", "culture", "different", "food", "person", "related".
0.120
annualchefsfoodfoundationreceiverecognition
SHARED TOKENS (6): "annual", "chefs", "food", "foundation", "receive", "recognition".
0.120
alcoholbeerbeveragedistilledspiritswine
SHARED TOKENS (6): "alcohol", "beer", "beverage", "distilled", "spirits", "wine".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
additionalboiseidahokunapopulation
SHARED TOKENS (5): "additional", "boise", "idaho", "kuna", "population".
0.100
aroundfeaturelongphilosophysour
SHARED TOKENS (5): "around", "feature", "long", "philosophy", "sour".
0.100
beerfoodproduceproducingwine
SHARED TOKENS (5): "beer", "food", "produce", "producing", "wine".
0.100
distinctownershipqualityrelatedwater
SHARED TOKENS (5): "distinct", "ownership", "quality", "related", "water".
0.100
eatformlargeoutsideproducts
SHARED TOKENS (5): "eat", "form", "large", "outside", "products".
◈ Frequently Asked Questions
Craft Beverage Brewery Winery Drinks × Food — Treasure Valley
HAIKU · HIGH GATE
How do Caldwell wineries source food for their tasting rooms?
Caldwell-based wineries in the Snake River Valley AVA frequently partner with Treasure Valley restaurants and food trucks to supply locally-prepared dishes for pairing with their wine production. This direct relationship between winemakers in Caldwell and regional food vendors strengthens the culinary reputation of the Treasure Valley's second-largest city.
What role does food truck service play at Boise-area breweries?
Food trucks operate regularly at craft breweries throughout Boise, providing on-site dining options that eliminate the need for customers to leave brewery premises during fermentation tours and tastings. This arrangement allows breweries to focus on beverage production while food trucks handle meal service under the three-tier system's regulatory framework.
How does the Eagle Foothills AVA wine region connect to Treasure Valley restaurants?
Eagle Foothills AVA wineries supply their viticulture products directly to Treasure Valley restaurants, which feature these regional wines on their menus and attract both local diners and Yelp and Tripadvisor reviewers. Food safety protocols for restaurant wine service in Idaho follow the same regulatory standards that govern fermentation and food handling in the Eagle Foothills production zone.
Why do craft beverage producers in the Treasure Valley coordinate with food establishments?
Breweries and wineries across the Treasure Valley coordinate with restaurants to create paired dining experiences that increase alcohol consumption per visit and enhance the region's food and beverage tourism profile. Boise-area craft beverage operations recognize that food pairing directly influences production decisions for their fermentation programs and American Viticultural Area positioning.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Craft Beverage Brewery Winery Drinks × Food 24 QID bridges 230 edges 6,175 ext links 2026-07-17 20:13:37 UTC c5ff96b00d417b65
Craft Beverage Brewery Winery Drinks corridor ↗ Food corridor ↗ Food × Craft Beverage Brewery Winery Drinks ↗ boisestandard.org/standard ↗
Parent Corridors
Craft Beverage Brewery Winery Drinks × All Other Verticals