—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Craft Beverage Brewery Winery Drinks ↔ relates to ↔ Mortgage Lending

19 Wikipedia bridge articles confirmed in both vertical ledgers. 285 deterministic cross-vertical edges. 7,208 external source links harvested. Every edge provenance-stamped. Every claim auditable.

19 QID Bridge Articles
285 Cross Edges
7,208 External Sources
325 Wikipedia Articles
21 🌲 Evergreen
189 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Craft Beverage Brewery Winery Drinks
× Mortgage Lending
QID Bridge Articles
19
confirmed Wikipedia overlap
Total Cross Edges
285
External Sources Harvested
7,208
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  17 shared tokens
QID Bridge Titles (19)
Boise State UniversityCollege of Western IdahoIdahoBoise metropolitan areaTreasure ValleyWater rightBoise RiverEagle, IdahoMergers and acquisitionsNampa, IdahoFranchisingPrivate equityAda County, IdahoBoise, IdahoCaldwell, IdahoKuna, IdahoCanyon County, IdahoMeridian, IdahoSnake River Plain
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadacapitalnorthwestcanyonwesterneastbusinesscollegenampatreasurevalleyagriculturalpubliccountiesapproximatelyland
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:15:22 UTC
Content Hash
9a46573df59ee2ba
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
19 BRIDGES
Boise State University
EXACT TITLE 1.150
QID OVERLAP: Q891082 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (17): "activity", "among", "boise", "business", "college", "division", "economics", "education", "idaho", "independent", "institution", "program", "programs", "public", "research", "school", "university". | URL->A (1): https://boisestate.edu/. | URL->B (1): https://boisestate.edu/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise State University". | EXACT TITLE in mortgage_lending: "Boise State University".
activityamongboisebusinesscollegedivisioneconomicseducationidahoindependentinstitutionprogramprogramspublicresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.150
QID OVERLAP: Q5146875 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (24): "academic", "ada", "boise", "canyon", "college", "community", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "southwest", "students".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "College of Western Idaho". | EXACT TITLE in mortgage_lending: "College of Western Idaho".
academicadaboisecanyoncollegecommunitycountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicsouthweststudentstreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Idaho
EXACT TITLE 1.000
QID OVERLAP: Q1221 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (27): "agricultural", "agriculture", "approximately", "around", "associated", "boise", "capital", "contains", "distinct", "east", "idaho", "land", "national", "northwest", "official", "pacific", "periods", "population", "products", "sector".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho". | EXACT TITLE in mortgage_lending: "Idaho".
agriculturalagricultureapproximatelyaroundassociatedboisecapitalcontainsdistincteastidaholandnationalnorthwestofficialpacificperiodspopulationproductssectorseparatesmallsuppliestechnologyterritoryuseswestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (18): "ada", "adds", "boise", "canyon", "component", "counties", "currently", "idaho", "larger", "meridian", "metropolitan", "nampa", "northwest", "pacific", "percent", "population", "treasure", "valley". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise metropolitan area".
adaaddsboisecanyoncomponentcountiescurrentlyidaholargermeridianmetropolitannampanorthwestpacificpercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 0.960
QID OVERLAP: Q7836726 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (13): "agricultural", "boise", "idaho", "land", "local", "metropolitan", "name", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Treasure Valley". | EXACT TITLE in mortgage_lending: "Treasure Valley".
agriculturalboiseidaholandlocalmetropolitannameregionresourcesruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
W
Q7973730 EXACT TITLE 0.880
QID OVERLAP: Q7973730 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (9): "different", "generally", "irrigation", "law", "legal", "physical", "source", "systems", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Water right". | EXACT TITLE in mortgage_lending: "Water right".
differentgenerallyirrigationlawlegalphysicalsourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
History In ancient Rome, the law was that people could obtain temporary usufructuary rights for running water. These rights were independent of land ownership, and lasted as long as use continued. Under English common law, all tidal waters were held by the Crown and all freshwater streams were included with title to the lands, with full accompanying rights. However, under the riparian doctrine, landowners had the right to receive water undiminished by upstream landowners. Over time, rights evolved from being strictly land-based to also include use-based, allowing non-landowners to hold enforceable rights to receive clean water. A reasonable use rule evolved in some countries. Finland In Finland, waterbodies are generally privately owned, but Finland also applies the Roman law principle of aqua profluens (flowing water), according to which the freely flowing water in waterbodies cannot be owned or possessed. This means that the owners of waterbodies cannot prohibit diversion of water for agricultural, industrial, municipal, or domestic use according to the provisions of the Finnish Water Law. A separate act regulates provision of water.
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "urban", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise River".
agriculturalapproximatelyboiseidahourbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Eagle, Idaho
Q1516870 EXACT TITLE 0.820
QID OVERLAP: Q1516870 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population". | EXACT TITLE in mortgage_lending: "Eagle, Idaho".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (44): "acquisition", "act", "activity", "allow", "another", "assets", "business", "capital", "central", "certain", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "federal"....
acquisitionactactivityallowanotherassetsbusinesscapitalcentralcertainconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesfederalgovernedgovernmentlawlegalmanagementmarketmergernoticeoperatingoperations+14
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "footprint", "idaho", "meaning", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "principal", "university", "western".
boisecanyoncollegefootprintidahomeaningmeridianmetropolitannamenampanorthwestpopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Franchising
Q171947 QID OVERLAP 0.800
QID OVERLAP: Q171947 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (29): "another", "brand", "branded", "business", "capital", "certain", "chain", "conditions", "corporate", "direct", "expansion", "fees", "growth", "large", "legal", "licenses", "licensing", "market", "model", "products"....
anotherbrandbrandedbusinesscapitalcertainchainconditionscorporatedirectexpansionfeesgrowthlargelegallicenseslicensingmarketmodelproductspropertyresearchrightsrulesetsmallspecificstrategysystem
Franchising is a business practice where a company licenses its business model to another company. It can involve the franchisor licensing some or part of its knowhow, procedures, intellectual property and other rights to sell its branded products and services to a franchisee. In return, the franchisee pays certain fees and agrees to comply with certain obligations, typically set out in a franchise agreement. For the franchisor, use of a franchise system is an alternative business growth strategy, compared to expansion through corporate owned outlets or "chain stores". Adopting a franchise system is a business growth strategy that minimizes the franchisor's capital investment and liability risk. Franchising is rarely an equal partnership, especially in the typical arrangement where the franchisee is an individual, unincorporated partnership or small privately-held corporation, as this ensures the franchisor has substantial legal and/or economic advantages over the franchisee. The usual exception to this rule is when the prospective franchisee is also a powerful corporate entity controlling a highly lucrative location, and/or captive market. For example, a large sports stadium for which prospective franchisors must compete to exclude one another.
e is also a powerful corporate entity controlling a highly lucrative location, and/or captive market. For example, a large sports stadium for which prospective franchisors must compete to exclude one another.
History The boom in franchising did not take place until after World War II. Nevertheless, the rudiments of modern franchising date back to the Middle Ages when landowners made franchise-like agreements with tax collectors, who retained a percentage of the money they collected and turned the rest over. The practice ended around 1562, but spread into other endeavors. For example, in 17th-century England, franchisees were granted the right to sponsor markets and fairs or operate ferries. There was little growth in franchising, though, until the mid-19th century, when it appeared in the United States for the first time. One of the first successful American franchising operations was started by an enterprising druggist named John S. Pemberton. In 1886, he concocted a beverage comprising sugar, molasses, spices, and cocaine. Pemberton licensed selected people to bottle and sell the drink, which was an early version of what is now known as Coca-Cola. His was one of the earliest and most successful franchising operations in the United States. The Singer Company implemented a franchising plan in the 1850s to distribute its sewing machines. The operation failed, though, because the company did not earn much money even though the machines sold well. The dealers, who had exclusive rights to their territories, absorbed most of the profits because of deep discounts. Some failed to push Singer products, so competitors were able to outsell the company. Under the existing contract, Singer could neither withdraw rights granted to franchisees nor send in its own salaried representatives. So, the company started repurchasing the rights it had sold. The experiment proved to be a failure. That may have been one of the first times a franchisor failed, but it was by no means the last. Colonel Harland Sanders did not initially succeed in his early efforts at franchising KFC. Still, the Singer venture did not put an end to franchising. Other companies attempted franchising in one form or another after the Singer experience. For example, several decades later, General Motors established a somewhat successful franchising operation in order to raise capital. Perhaps the father of modern franchising, though, is Louis K. Liggett. In 1902, Liggett invited a group of druggists to join a "drug cooperative". As he explained to them, they could increase profits by paying less for their purchases, especially if they set up their own manufacturing company. His idea was to market private-label products. About 40 druggists pooled $4,000 of their own money and adopted the name Rexall. Sales soared, and Rexall became a franchisor. The chain's success set a pattern for other franchisors to follow. Although many business owners did affiliate with cooperative ventures of one type or another, there was little growth in franchising until the early 20th century, and in whatever form franchising existed, it looked nothing like what it is today. As the United States shifted from an agricultural to an industrial economy, manufacturers licensed individuals to sell automobiles, trucks, gasoline, beverages, and a variety of other products. The franchisees did little more than selling the products, though. The sharing of responsibility associated with contemporary franchising arrangement did not exist to a great extent. Consequently, franchising was not a growth industry in the United States. It was not until the 1960s and 1970s that people began to take a close look at the attractiveness of franchising. The concept intrigued people with entrepreneurial spirit.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (23): "active", "business", "capital", "changes", "control", "described", "development", "expansion", "general", "management", "operational", "otherwise", "ownership", "private", "product", "products", "provide", "public", "rather", "role"....
activebusinesscapitalchangescontroldescribeddevelopmentexpansiongeneralmanagementoperationalotherwiseownershipprivateproductproductsprovidepublicratherrolespecializedspecificstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "capital", "district", "east", "estimated", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private", "roads".
adaboisecapitaldistricteastestimatedidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "counties", "east", "estimated", "idaho", "locally", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountieseastestimatedidaholocallymetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.680
QID OVERLAP: Q1515177 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (9): "ada", "additional", "boise", "gain", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboisegainidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in craft_beverage_brewery_winery_drinks (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Snake River Plain
Q1396049 QID OVERLAP 0.600
QID OVERLAP: Q1396049 in craft_beverage_brewery_winery_drinks (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (5): "agricultural", "east", "idaho", "land", "northwest".
agriculturaleastidaholandnorthwest
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
266 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP266 edges
🌲 EVERGREEN2 edges
0.650
actadministrationagencybureauchaptercodecontroldepartmentfederalformergovernmentindustrypowersstatutorytaxtitletrade
SHARED TOKENS (17): "act", "administration", "agency", "bureau", "chapter", "code", "control", "department", "federal", "former", "government", "industry", "powers", "statutory", "tax", "title", "trade". | URL->A (1): https://uscode.house.gov/view.xhtml?path=/prelim@title27/chapter8&edition=prelim. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Federal Alcohol Administration".
0.650
adaamericanboisebureaucanyoncountiesdepartmentestablishedidaholabellaborleastnationproductiontaxtradevalley
SHARED TOKENS (17): "ada", "american", "boise", "bureau", "canyon", "counties", "department", "established", "idaho", "label", "labor", "least", "nation", "production", "tax", "trade", "valley". | URL->A (2): https://idahowines.org/idaho-wines/idaho-wine-history/, https://www.stechapelle.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Snake River Valley AVA".
🌿 BRANCH189 edges
0.510
Untappd ↗ EXACT TITLE
applicationlistsmobileplatformratereviewshareuses
SHARED TOKENS (8): "application", "lists", "mobile", "platform", "rate", "review", "share", "uses". | URL->A (1): https://untappd.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Untappd".
0.510
americancertaincharacteristicsleastofficialpricesregionspecific
SHARED TOKENS (8): "american", "certain", "characteristics", "least", "official", "prices", "region", "specific". | URL->A (1): https://www.ttb.gov/regulated-commodities/beverage-alcohol/wine/established-avas. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "American Viticultural Area".
0.500
activitiesaroundassociatedbenefitsbuildingdevelopmentfacilitiesindustrialindustryinfrastructurepercentplanningprocessproductswork
SHARED TOKENS (15): "activities", "around", "associated", "benefits", "building", "development", "facilities", "industrial", "industry", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in mortgage_lending: "Construction".
0.500
additionalassetsbasebeyondcommercialcommunitiescommunitydecisionsdefinitionsfederalgovernmentinstitutioninsurancelocallocallynationalofficerequirementsroleserve
SHARED TOKENS (21): "additional", "assets", "base", "beyond", "commercial", "communities", "community", "decisions", "definitions", "federal", "government", "institution", "insurance", "local", "locally", "national", "office", "requirements", "role", "serve".... | EXACT TITLE in mortgage_lending: "Community bank".
0.500
Frost ↗ Q4590598 EXACT TITLE
affectcertainconcentrationconditionscontainscoveringdependsdevelopmentdirectlyevenformformationformsgrowinggrowthlargelargerlayernearprocess
SHARED TOKENS (24): "affect", "certain", "concentration", "conditions", "contains", "covering", "depends", "development", "directly", "even", "form", "formation", "forms", "growing", "growth", "large", "larger", "layer", "near", "process".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Frost".
0.500
Inventory ↗ Q815410 EXACT TITLE
americanbusinessdifferentinformationinventorymanagementmaterialsnetworkprocessproductionproductsrequiredsaleshapesupplysystemsystemswork
SHARED TOKENS (18): "american", "business", "different", "information", "inventory", "management", "materials", "network", "process", "production", "products", "required", "sale", "shape", "supply", "system", "systems", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Inventory". | EXACT TITLE in mortgage_lending: "Inventory".
0.500
Food safety ↗ Q909821 EXACT TITLE
chainconsumercontaminationcreatesdeliverydescribingdevelopedenforcementestimatedgrowthindustrymanagementmarketorganizationpersonphysicalpracticesrelatedsecurityserve
SHARED TOKENS (22): "chain", "consumer", "contamination", "creates", "delivery", "describing", "developed", "enforcement", "estimated", "growth", "industry", "management", "market", "organization", "person", "physical", "practices", "related", "security", "serve".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food safety".
0.500
becomebuyerscharacteristicsestablishedevaluationgeneralidentifyinginvolvingmodernpersonalpriceprocessproductionprofessionalregionspecialized
SHARED TOKENS (16): "become", "buyers", "characteristics", "established", "evaluation", "general", "identifying", "involving", "modern", "personal", "price", "process", "production", "professional", "region", "specialized". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine tasting".
0.500
affectdeterminediffersdocumentingestablishedestateframeworkinterestlandlawlegalotherwiseprincipalpublicrealrecordsystemsystemstitle
SHARED TOKENS (19): "affect", "determine", "differs", "documenting", "established", "estate", "framework", "interest", "land", "law", "legal", "otherwise", "principal", "public", "real", "record", "system", "systems", "title". | EXACT TITLE in mortgage_lending: "Recording (real estate)".
0.500
americanaroundassetscommercialconsumercorporateinstitutionnonprofitoperationspublicretailservesharesmallsystemstrust
SHARED TOKENS (16): "american", "around", "assets", "commercial", "consumer", "corporate", "institution", "nonprofit", "operations", "public", "retail", "serve", "share", "small", "systems", "trust". | EXACT TITLE in mortgage_lending: "Credit union".
0.500
anotherconditionsconsolidatedcorporatedifferentfeesformsinterestmanagementnationpersonalpotentiallyprimaryratereducereducedstabilitytax
SHARED TOKENS (18): "another", "conditions", "consolidated", "corporate", "different", "fees", "forms", "interest", "management", "nation", "personal", "potentially", "primary", "rate", "reduce", "reduced", "stability", "tax". | EXACT TITLE in mortgage_lending: "Refinancing".
0.500
accountbeyondboiseconnectseagleeastextendsidahoparkspermitresidentialroadspecialsystemurban
SHARED TOKENS (15): "account", "beyond", "boise", "connects", "eagle", "east", "extends", "idaho", "parks", "permit", "residential", "road", "special", "system", "urban". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Boise River Greenbelt".
0.500
boiseboundarybroadereastestablishedhistoricalhistoryidahoimpactmerelymetropolitannorthwestofficialpacificratherregionterritorywestern
SHARED TOKENS (18): "boise", "boundary", "broader", "east", "established", "historical", "history", "idaho", "impact", "merely", "metropolitan", "northwest", "official", "pacific", "rather", "region", "territory", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Pacific Northwest". | EXACT TITLE in mortgage_lending: "Pacific Northwest".
0.500
Beer ↗ Q44 EXACT TITLE
actactivitiesaroundassociatedbusinesscodecommercialcontainsdistributionformformsgroupindustrymodernproductionregionalvolumewater
SHARED TOKENS (18): "act", "activities", "around", "associated", "business", "code", "commercial", "contains", "distribution", "form", "forms", "group", "industry", "modern", "production", "regional", "volume", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer".
0.500
Chemistry ↗ Q2329 EXACT TITLE
applicationsbehaviorcentralchangescreateenvironmentalexplainsfieldsformationgrowthindustryphysicalpropertiesscopestructurestudysubjectwork
SHARED TOKENS (18): "applications", "behavior", "central", "changes", "create", "environmental", "explains", "fields", "formation", "growth", "industry", "physical", "properties", "scope", "structure", "study", "subject", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Chemistry".
0.500
abilityactactivityagencyauthorizedbureauconsumercourtdataenforcementestablishedfederalfeesgovernmentindependentindustryjunejurisdictionlawmechanism
SHARED TOKENS (38): "ability", "act", "activity", "agency", "authorized", "bureau", "consumer", "court", "data", "enforcement", "established", "federal", "fees", "government", "independent", "industry", "june", "jurisdiction", "law", "mechanism".... | EXACT TITLE in mortgage_lending: "Consumer Financial Protection Bureau".
0.500
accountingbusinesscreatedocumentseventsfunctionsgeneralinformationoperationsorganizationpersonprocessrealrecordrecordsreportreportssalessourcestatement
SHARED TOKENS (23): "accounting", "business", "create", "documents", "events", "functions", "general", "information", "operations", "organization", "person", "process", "real", "record", "records", "report", "reports", "sales", "source", "statement".... | EXACT TITLE in mortgage_lending: "Bookkeeping".
0.500
additionalaroundassetscertainclosecontractdiscoveryfeeindicatesinstrumentinterestinvestorslaterlossmanagersmarketmarketsmechanismotherwisephysical
SHARED TOKENS (37): "additional", "around", "assets", "certain", "close", "contract", "discovery", "fee", "indicates", "instrument", "interest", "investors", "later", "loss", "managers", "market", "markets", "mechanism", "otherwise", "physical".... | EXACT TITLE in mortgage_lending: "Short (finance)".
0.500
Food truck ↗ Q3303463 EXACT TITLE
amongbecomecommercialdevelopedestimatedgrowinghistoricalindustrylargemobileoperationpreviouslyregionalservesurroundingtreatswaterworkers
SHARED TOKENS (18): "among", "become", "commercial", "developed", "estimated", "growing", "historical", "industry", "large", "mobile", "operation", "previously", "regional", "serve", "surrounding", "treats", "water", "workers". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food truck".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessactivitiesapplicablechaincommunitiesconditionscurrentlydevelopmentenvironmentalgeneralgrowthimpactlackmaintainingnameoperatingpersonalpublicreducedrelated
SHARED TOKENS (27): "access", "activities", "applicable", "chain", "communities", "conditions", "currently", "development", "environmental", "general", "growth", "impact", "lack", "maintaining", "name", "operating", "personal", "public", "reduced", "related".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sanitation".
0.500
actcertaincodifiedconnectedconnectionconsumerfederalfeeslawlimitsmakingpracticesprincipalprohibitsregulatesregulationrequirementsrequiringstandardized
SHARED TOKENS (19): "act", "certain", "codified", "connected", "connection", "consumer", "federal", "fees", "law", "limits", "making", "practices", "principal", "prohibits", "regulates", "regulation", "requirements", "requiring", "standardized". | EXACT TITLE in mortgage_lending: "Truth in Lending Act".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliesapplyingcentralchangesconditionsconsolidationcontroldevelopeddirectlydistributionenvironmentalfieldsformgrowthirrigationlandlandscape
SHARED TOKENS (39): "agricultural", "agriculture", "application", "applies", "applying", "central", "changes", "conditions", "consolidation", "control", "developed", "directly", "distribution", "environmental", "fields", "form", "growth", "irrigation", "land", "landscape".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Irrigation". | EXACT TITLE in mortgage_lending: "Irrigation".
0.500
Yeast ↗ Q45422 EXACT TITLE
abilitycharacteristicsconditionsconnectedcurrentlydescribeddivisionformformsfunctionsgroupgrowthindustryleastmodelmodernprocessproduceproductionproducts
SHARED TOKENS (23): "ability", "characteristics", "conditions", "connected", "currently", "described", "division", "form", "forms", "functions", "group", "growth", "industry", "least", "model", "modern", "process", "produce", "production", "products".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Yeast".
0.500
activeagricultureanotherapplicationsbuildingchainchannelscomparisonconditionsconsumerdependentdevelopeddevelopmentdistributionexpandedformsgenerallyhouseholdimpactindustrial
SHARED TOKENS (45): "active", "agriculture", "another", "applications", "building", "chain", "channels", "comparison", "conditions", "consumer", "dependent", "developed", "development", "distribution", "expanded", "forms", "generally", "household", "impact", "industrial".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Refrigeration".
0.500
Credit risk ↗ Q162714 EXACT TITLE
anotherassetsassociatedbusinesscompleteconsumercostsgeneralgovernmentinsuranceinterestlossmarketprincipalprotectionratereducerequiresecuritytrade
SHARED TOKENS (21): "another", "assets", "associated", "business", "complete", "consumer", "costs", "general", "government", "insurance", "interest", "loss", "market", "principal", "protection", "rate", "reduce", "require", "security", "trade".... | EXACT TITLE in mortgage_lending: "Credit risk".
0.500
academicsaccessadditionaladvertisingallowbureauconsumerestatefacegenerallyindependentinsuranceinterestlegalmaintainmarketmoveproductspropertyprotection
SHARED TOKENS (26): "academics", "access", "additional", "advertising", "allow", "bureau", "consumer", "estate", "face", "generally", "independent", "insurance", "interest", "legal", "maintain", "market", "move", "products", "property", "protection".... | EXACT TITLE in mortgage_lending: "Reverse mortgage".
0.500
administrationbureaucodecodifiedcoveringdepartmentestatefederallawpayrollstatutestatutorytaxtaxestitle
SHARED TOKENS (15): "administration", "bureau", "code", "codified", "covering", "department", "estate", "federal", "law", "payroll", "statute", "statutory", "tax", "taxes", "title". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Internal Revenue Code".
0.500
applicationsbecomecomplianceconsumerdependsdevelopeddirectestatefeesjurisdictionmarketsproductsrealregulatedregulationrolespecific
SHARED TOKENS (17): "applications", "become", "compliance", "consumer", "depends", "developed", "direct", "estate", "fees", "jurisdiction", "markets", "products", "real", "regulated", "regulation", "role", "specific". | EXACT TITLE in mortgage_lending: "Mortgage broker".
0.500
amongapproximatelyboisedivisionestablishedidaholateroperatesparkproductionprofessionalpublicresearchruralstatewidestudentsuniversity
SHARED TOKENS (17): "among", "approximately", "boise", "division", "established", "idaho", "later", "operates", "park", "production", "professional", "public", "research", "rural", "statewide", "students", "university". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherbeginscontainscontaminationcreateenvironmentalleastmodernplacingproviderequireresourcesruralsitestabilitystructuresupplysurroundingtable
SHARED TOKENS (22): "access", "another", "begins", "contains", "contamination", "create", "environmental", "least", "modern", "placing", "provide", "require", "resources", "rural", "site", "stability", "structure", "supply", "surrounding", "table".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Well". | EXACT TITLE in mortgage_lending: "Well".
0.500
announcedbaseboiseidahomissionnearoperationspersonnelplacepopulationprimaryprovidesouthwesttrainingwestern
SHARED TOKENS (15): "announced", "base", "boise", "idaho", "mission", "near", "operations", "personnel", "place", "population", "primary", "provide", "southwest", "training", "western". | EXACT TITLE in mortgage_lending: "Mountain Home Air Force Base".
0.500
actactivityadditionalamongannualauthoritybureaucommunitycomplianceconsumerdatadepartmentdirectenforcementexpandedfederalfieldsgrowthinformationlaw
SHARED TOKENS (39): "act", "activity", "additional", "among", "annual", "authority", "bureau", "community", "compliance", "consumer", "data", "department", "direct", "enforcement", "expanded", "federal", "fields", "growth", "information", "law".... | EXACT TITLE in mortgage_lending: "Home Mortgage Disclosure Act".
0.500
Accountant ↗ Q326653 EXACT TITLE
abilityaccountantsaccountingcertaincharacteristicsdeterminefeesimpactindustryinfluenceorganizationpersonalprocessprofessionalprofessionalspublicqualityregisteredrequiresrole
SHARED TOKENS (25): "ability", "accountants", "accounting", "certain", "characteristics", "determine", "fees", "impact", "industry", "influence", "organization", "personal", "process", "professional", "professionals", "public", "quality", "registered", "requires", "role".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Accountant". | EXACT TITLE in mortgage_lending: "Accountant".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventgenerallygroupmanagementmodelparksplacespracticesprivateprovideservesservingspecialspecificstaff
SHARED TOKENS (17): "business", "commercial", "event", "generally", "group", "management", "model", "parks", "places", "practices", "private", "provide", "serves", "serving", "special", "specific", "staff". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Catering".
0.500
Soil ↗ Q36133 EXACT TITLE
accountassociatedbroaderclassificationdefinitionsdevelopmentdistinguishformformationformerfunctionsgrowthinfluencematerialsphysicalproductpropertiesstudysupplysystem
SHARED TOKENS (22): "account", "associated", "broader", "classification", "definitions", "development", "distinguish", "form", "formation", "former", "functions", "growth", "influence", "materials", "physical", "product", "properties", "study", "supply", "system".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Soil".
0.500
Ice wine ↗ Q828135 EXACT TITLE
concentratedgenerallyhourslargeleastmakingnoticeotherwiseproducingproductionrequiresshapesmallvolumewater
SHARED TOKENS (15): "concentrated", "generally", "hours", "large", "least", "making", "notice", "otherwise", "producing", "production", "requires", "shape", "small", "volume", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Ice wine".
0.500
applicationsbecomecommercialconcentrationfeaturesformsgrowthindustrylandmaterialsprimaryprocessproduceproductproductionregulatedsourcevisiblewater
SHARED TOKENS (19): "applications", "become", "commercial", "concentration", "features", "forms", "growth", "industry", "land", "materials", "primary", "process", "produce", "product", "production", "regulated", "source", "visible", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Carbon dioxide".
0.500
aroundbecomecentralcontentlargelawlegallylocalmakingnameprocessproductionproductsqualityregion
SHARED TOKENS (15): "around", "become", "central", "content", "large", "law", "legally", "local", "making", "name", "process", "production", "products", "quality", "region". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sparkling wine".
0.500
actapplicantsappliesauthoritybusinesscodifiedcommunityconsumercontractdefinesdevelopmentdifferentfederalgovernmentinstitutionlargelawnationalofficialperson
SHARED TOKENS (30): "act", "applicants", "applies", "authority", "business", "codified", "community", "consumer", "contract", "defines", "development", "different", "federal", "government", "institution", "large", "law", "national", "official", "person".... | EXACT TITLE in mortgage_lending: "Equal Credit Opportunity Act".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingcertaindeterminedevelopeddevelopmentdifferentdiffersformgovernmentgrowthindustriallandland-uselocalplacesplanningpropertyregulatoryresidential
SHARED TOKENS (29): "activities", "building", "certain", "determine", "developed", "development", "different", "differs", "form", "government", "growth", "industrial", "land", "land-use", "local", "places", "planning", "property", "regulatory", "residential".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Zoning". | EXACT TITLE in mortgage_lending: "Zoning".
0.500
americancentralchangescombinationconcentrationdevelopmenteastenvironmentalexpansionformationformsgrowinggrowthmodelpopulationprocessruralsuburbanurban
SHARED TOKENS (19): "american", "central", "changes", "combination", "concentration", "development", "east", "environmental", "expansion", "formation", "forms", "growing", "growth", "model", "population", "process", "rural", "suburban", "urban". | EXACT TITLE in mortgage_lending: "Suburbanization".
0.500
americanamongdifferenteducationeventfinalhistorypresentationproductionprofessionalqualityratescaletrustuses
SHARED TOKENS (15): "american", "among", "different", "education", "event", "final", "history", "presentation", "production", "professional", "quality", "rate", "scale", "trust", "uses". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer tasting".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybenefitsbeyondbusinesscommercialcommunitiesdefinesdevelopmentenvironmentalestimatedgenerallygrowinggrowthhourslocallossmarketsorganizationoutsideplaces
SHARED TOKENS (25): "activity", "benefits", "beyond", "business", "commercial", "communities", "defines", "development", "environmental", "estimated", "generally", "growing", "growth", "hours", "local", "loss", "markets", "organization", "outside", "places".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
advertisingamericanannualapproximatelybecomebusinesscomcurrentlydevelopsdirectoryestimatesexpandedformerheadquarteredhouseholdinformationlatermobileoperatespractices
SHARED TOKENS (29): "advertising", "american", "annual", "approximately", "become", "business", "com", "currently", "develops", "directory", "estimates", "expanded", "former", "headquartered", "household", "information", "later", "mobile", "operates", "practices".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Yelp".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
completecostscourtfeefeesinterestlawlegalmakingoperationownerprincipalprocesspropertyrealresidentialsalesecuritysellingspecific
SHARED TOKENS (25): "complete", "costs", "court", "fee", "fees", "interest", "law", "legal", "making", "operation", "owner", "principal", "process", "property", "real", "residential", "sale", "security", "selling", "specific".... | EXACT TITLE in mortgage_lending: "Foreclosure".
0.500
actchaptercodecodifiedcostsestatefeeslawpotentiallypracticesprocessproviderealrequirestitle
SHARED TOKENS (15): "act", "chapter", "code", "codified", "costs", "estate", "fees", "law", "potentially", "practices", "process", "provide", "real", "requires", "title". | EXACT TITLE in mortgage_lending: "Real Estate Settlement Procedures Act".
0.500
Brewery ↗ Q131734 EXACT TITLE
businesscommercialdistinctequipmentindustrylargerleastplaceprocessproduceproductionprotectionscalesellingworkers
SHARED TOKENS (15): "business", "commercial", "distinct", "equipment", "industry", "larger", "least", "place", "process", "produce", "production", "protection", "scale", "selling", "workers". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Brewery".
0.500
Pollination ↗ Q134624 EXACT TITLE
agriculturecarryingcontainingdependentdevelopsdirectlydivisioneconomicsevenfieldsinsidelaterprocessproduceproductionresearchscalestudysystemwater
SHARED TOKENS (21): "agriculture", "carrying", "containing", "dependent", "develops", "directly", "division", "economics", "even", "fields", "inside", "later", "process", "produce", "production", "research", "scale", "study", "system", "water".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Pollination".
0.500
Fermentation ↗ Q41760 EXACT TITLE
associatedbenefitsconditionsdemanddifferentdiscoveryformindustrialmakingprocessproduceproducingproductionproductsprofilesrelatedsupply
SHARED TOKENS (17): "associated", "benefits", "conditions", "demand", "different", "discovery", "form", "industrial", "making", "process", "produce", "producing", "production", "products", "profiles", "related", "supply". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Fermentation".
0.500
Easement ↗ Q448405 EXACT TITLE
accessallowamonganotherconceptsenteritselflandlawpersonpropertypublicpurposerealrightsroadstated
SHARED TOKENS (17): "access", "allow", "among", "another", "concepts", "enter", "itself", "land", "law", "person", "property", "public", "purpose", "real", "rights", "road", "stated". | EXACT TITLE in mortgage_lending: "Easement".
0.500
authorityestategoverninggovernmentjurisdictionlandnationalpropertyraterealregionrequiressystemtaxtransactionvaluewhose
SHARED TOKENS (17): "authority", "estate", "governing", "government", "jurisdiction", "land", "national", "property", "rate", "real", "region", "requires", "system", "tax", "transaction", "value", "whose". | EXACT TITLE in mortgage_lending: "Property tax".
0.500
businessbuyerscommercialcostscoverageestatefeeformgeneralgenerallyindependentinstitutionalinsuranceinterestlandlargelawlegallossobtain
SHARED TOKENS (37): "business", "buyers", "commercial", "costs", "coverage", "estate", "fee", "form", "general", "generally", "independent", "institutional", "insurance", "interest", "land", "large", "law", "legal", "loss", "obtain".... | EXACT TITLE in mortgage_lending: "Title insurance".
0.500
Logistics ↗ Q177777 EXACT TITLE
anotherchaincomponentcostsequipmentfieldsinformationlinesmaintainingmanagementmaterialsmodeloperationalphysicalplanningproductionproductsprofessionalprovidepublic
SHARED TOKENS (25): "another", "chain", "component", "costs", "equipment", "fields", "information", "lines", "maintaining", "management", "materials", "model", "operational", "physical", "planning", "production", "products", "professional", "provide", "public".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Logistics".
0.500
Packaging ↗ Q207822 EXACT TITLE
americanassociatedbusinesscontainscontentdescribeddistributiongoverninggovernmentindustrialinstitutionalintegratedlabelpersonalprocessproducingproductsprotectionsaleseparate
SHARED TOKENS (23): "american", "associated", "business", "contains", "content", "described", "distribution", "governing", "government", "industrial", "institutional", "integrated", "label", "personal", "process", "producing", "products", "protection", "sale", "separate".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Packaging".
0.500
Nitrogen ↗ Q627 EXACT TITLE
actapplicationscommercialcontainscontroldescribesestimatedformformsgroupindustrialindustrylargemakingnamesystemsystemstabletechnologyuses
SHARED TOKENS (21): "act", "applications", "commercial", "contains", "control", "describes", "estimated", "form", "forms", "group", "industrial", "industry", "large", "making", "name", "system", "systems", "table", "technology", "uses".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Nitrogen".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferentestatefarmgeneralgovernmentgrowinginterestlandlawlegalnonprofitownershippersonpersonalprivatepropertypublic
SHARED TOKENS (26): "acquisition", "business", "commercial", "different", "estate", "farm", "general", "government", "growing", "interest", "land", "law", "legal", "nonprofit", "ownership", "person", "personal", "private", "property", "public".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Real estate". | EXACT TITLE in mortgage_lending: "Real estate".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesamericancanyoncentralchannelcommercialcontroldevelopedeastfeatureshistoryidahoirrigationlargenationalnearnorthwestpacificparkprivate
SHARED TOKENS (30): "activities", "american", "canyon", "central", "channel", "commercial", "control", "developed", "east", "features", "history", "idaho", "irrigation", "large", "national", "near", "northwest", "pacific", "park", "private".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Snake River".
0.500
Freddie Mac ↗ Q935969 EXACT TITLE
agencyamericanannouncedassetsdepartmentdescribedfederalgovernmentheadquarteredinvestorsjunemakingmanagementmarketmarketsnamenationalorganizationpricesprivate
SHARED TOKENS (24): "agency", "american", "announced", "assets", "department", "described", "federal", "government", "headquartered", "investors", "june", "making", "management", "market", "markets", "name", "national", "organization", "prices", "private".... | EXACT TITLE in mortgage_lending: "Freddie Mac".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
buildingbusinesscapitalcharacteristicscommercialdemanddescribeddevelopeddirectlyestateeventfeaturesforminstitutioninterestinvestorslawlegalmarketsmeaning
SHARED TOKENS (36): "building", "business", "capital", "characteristics", "commercial", "demand", "described", "developed", "directly", "estate", "event", "features", "form", "institution", "interest", "investors", "law", "legal", "markets", "meaning".... | EXACT TITLE in mortgage_lending: "Mortgage".
0.500
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiescommunityconnectioncreatingeventintegratedlocalnationalplaceprovideresourceservesourcespecific
SHARED TOKENS (17): "agriculture", "among", "associated", "communities", "community", "connection", "creating", "event", "integrated", "local", "national", "place", "provide", "resource", "serve", "source", "specific". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Festival".
0.500
activitiesadditionalanotherbusinesscapitalcertaincommercialconsumerdirectlydiscoveryeligibleenterfacefederalfederallyfeefeesframeworkgenerallylarge
SHARED TOKENS (38): "activities", "additional", "another", "business", "capital", "certain", "commercial", "consumer", "directly", "discovery", "eligible", "enter", "face", "federal", "federally", "fee", "fees", "framework", "generally", "large".... | EXACT TITLE in mortgage_lending: "Mortgage bank".
0.500
ServSafe ↗ Q7455532 EXACT TITLE
americancertificatecredentialmanagementmanagersnationalnonprofitprocessprogramprotectionrequiredsetstafftrainingwork
SHARED TOKENS (15): "american", "certificate", "credential", "management", "managers", "national", "nonprofit", "process", "program", "protection", "required", "set", "staff", "training", "work". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "ServSafe".
0.500
Horticulture ↗ Q48803 EXACT TITLE
agricultureamericanaroundassociatedcommercialconventionaldistinctevengrowingindustrialindustryknowledgepracticesproductionprofessionalratherrequiringscalespecializedsystems
SHARED TOKENS (21): "agriculture", "american", "around", "associated", "commercial", "conventional", "distinct", "even", "growing", "industrial", "industry", "knowledge", "practices", "production", "professional", "rather", "requiring", "scale", "specialized", "systems".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Horticulture".
0.500
Wine ↗ Q282 EXACT TITLE
aroundbenefitscharacteristicscontentdifferentestablishedgeneralgenerallygrowingmarketingproductionqualityremainsroletradewestern
SHARED TOKENS (16): "around", "benefits", "characteristics", "content", "different", "established", "general", "generally", "growing", "marketing", "production", "quality", "remains", "role", "trade", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine".
0.500
componentcontrolcontrolsdefinesdescriptionsentitiesknowledgelistsmaintainmanagementpersonnelphysicalplacesprocessproductproductionqualityrecordsrelationshipsrequirements
SHARED TOKENS (21): "component", "control", "controls", "defines", "descriptions", "entities", "knowledge", "lists", "maintain", "management", "personnel", "physical", "places", "process", "product", "production", "quality", "records", "relationships", "requirements".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Quality control".
0.500
Wholesaling ↗ Q220695 EXACT TITLE
abilitybusinesscommercialconsumercostsdirectlygeneralindustrialinstitutionalmarketmarketsorganizationpersonpriceproductsprofessionalrateratherrelatedsale
SHARED TOKENS (23): "ability", "business", "commercial", "consumer", "costs", "directly", "general", "industrial", "institutional", "market", "markets", "organization", "person", "price", "products", "professional", "rate", "rather", "related", "sale".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wholesaling".
0.500
activitiesagriculturalagricultureannualapprovaldefinitionsdevelopmentevenformsgenerallyirrigationlandorganizationpermittedproduceproducingproductionrequirerequiresrequiring
SHARED TOKENS (21): "activities", "agricultural", "agriculture", "annual", "approval", "definitions", "development", "even", "forms", "generally", "irrigation", "land", "organization", "permitted", "produce", "producing", "production", "require", "requires", "requiring".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Agricultural land".
0.500
actadministrationagencyassociatedauthoritycontrolcurrentdepartmentdirectlyfederalfeedformerhouseholdprimaryproductspublicregulatedrelatedreportsuses
SHARED TOKENS (21): "act", "administration", "agency", "associated", "authority", "control", "current", "department", "directly", "federal", "feed", "former", "household", "primary", "products", "public", "regulated", "related", "reports", "uses".... | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food and Drug Administration".
0.500
Reddit ↗ Q1136 EXACT TITLE
abilityamericanamongcommunitiescontentcreatecurrentdatafeaturesindependentjunelinksmarketnewspageplatformregisteredrolesitesubject
SHARED TOKENS (22): "ability", "american", "among", "communities", "content", "create", "current", "data", "features", "independent", "june", "links", "market", "news", "page", "platform", "registered", "role", "site", "subject".... | EXACT TITLE in mortgage_lending: "Reddit".
0.480
Escrow ↗ Q338451 EXACT TITLE
accountconditionsdependentestablishedinsurancemeaningnamepersonprimaryprincipalpropertytaxestransactiontrust
SHARED TOKENS (14): "account", "conditions", "dependent", "established", "insurance", "meaning", "name", "person", "primary", "principal", "property", "taxes", "transaction", "trust". | EXACT TITLE in mortgage_lending: "Escrow".
0.480
accessactivitiesactivitydemandfacilitiesgaingeneralgenerallyoutsideparksphysicalpopulationrathertraining
SHARED TOKENS (14): "access", "activities", "activity", "demand", "facilities", "gain", "general", "generally", "outside", "parks", "physical", "population", "rather", "training". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Outdoor recreation".
0.480
chaindocumentshistoricallawofficeownerownershippropertyrecordregistrysequenceservestitletransfers
SHARED TOKENS (14): "chain", "documents", "historical", "law", "office", "owner", "ownership", "property", "record", "registry", "sequence", "serves", "title", "transfers". | EXACT TITLE in mortgage_lending: "Chain of title".
0.480
Impact fee ↗ Q6005889 EXACT TITLE
capitalcostsdevelopmentexpansionfeefeesgovernmentgrowthimpactlocalneededpopulationpublicreduce
SHARED TOKENS (14): "capital", "costs", "development", "expansion", "fee", "fees", "government", "growth", "impact", "local", "needed", "population", "public", "reduce". | EXACT TITLE in mortgage_lending: "Impact fee".
0.480
associateddemandformsgenerallygovernmenthouseholdindexlocalmarketsnationalownershipresponsesetsupply
SHARED TOKENS (14): "associated", "demand", "forms", "generally", "government", "household", "index", "local", "markets", "national", "ownership", "response", "set", "supply". | EXACT TITLE in mortgage_lending: "Affordable housing".
0.480
advertisingamericanapproximatelybrandcomcomparisoncontentfeaturesgroupheadquarteredmobileoperatespercentreviews
SHARED TOKENS (14): "advertising", "american", "approximately", "brand", "com", "comparison", "content", "features", "group", "headquartered", "mobile", "operates", "percent", "reviews". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Tripadvisor".
0.480
businesscurrentlydirectlymodelmodernoperatephysicalplatformproductsretailsalesalessellingthird-party
SHARED TOKENS (14): "business", "currently", "directly", "model", "modern", "operate", "physical", "platform", "products", "retail", "sale", "sales", "selling", "third-party". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Direct-to-consumer".
0.480
competenciescompleteemployergainlaborlicenseoutsideprofessionalregulatedskilledstudysystemtradetraining
SHARED TOKENS (14): "competencies", "complete", "employer", "gain", "labor", "license", "outside", "professional", "regulated", "skilled", "study", "system", "trade", "training". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Apprenticeship".
0.480
Liquor ↗ Q56139 EXACT TITLE
alonearounddistinguishevenformgrouplargepracticesprocessproductionrapidrathershapedvolume
SHARED TOKENS (14): "alone", "around", "distinguish", "even", "form", "group", "large", "practices", "process", "production", "rapid", "rather", "shaped", "volume". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Liquor".
0.460
accountingacquisitionanalysisassetsclassificationlawprincipalprocesspropertysystemtaxvaluezoning
SHARED TOKENS (13): "accounting", "acquisition", "analysis", "assets", "classification", "law", "principal", "process", "property", "system", "tax", "value", "zoning". | EXACT TITLE in mortgage_lending: "Amortization".
0.460
Hops ↗ Q3214940 EXACT TITLE
aroundbenefitscommercialdifferentdocumenteddocumentsfamilylaternameproductionseparatesourcestability
SHARED TOKENS (13): "around", "benefits", "commercial", "different", "documented", "documents", "family", "later", "name", "production", "separate", "source", "stability". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Hops".
0.440
Brewing ↗ Q869095 EXACT TITLE
additionalaroundcommercialindustryplaceprocessproductionreduceretainingsourcewaterwestern
SHARED TOKENS (12): "additional", "around", "commercial", "industry", "place", "process", "production", "reduce", "retaining", "source", "water", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Brewing".
0.440
Gin ↗ Q959362 EXACT TITLE
basecombinationdevelopmentdistinctindustrymodernnationalplaceproduceproviderestrictionswater
SHARED TOKENS (12): "base", "combination", "development", "distinct", "industry", "modern", "national", "place", "produce", "provide", "restrictions", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Gin". | EXACT TITLE in mortgage_lending: "Gin".
0.440
Lien ↗ Q4469383 EXACT TITLE
applicationcertainformformsgenerallyinterestmeaningownerpersonpropertysecurityspecific
SHARED TOKENS (12): "application", "certain", "form", "forms", "generally", "interest", "meaning", "owner", "person", "property", "security", "specific". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Lien". | EXACT TITLE in mortgage_lending: "Lien".
0.440
agencybureaucourtcreatingdepartmentenforcementidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (12): "agency", "bureau", "court", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "public", "statewide". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho State Police".
0.440
Kombucha ↗ Q657032 EXACT TITLE
approximatelybenefitscommercialcomponentcontainscontaminationdistinguishgenerallygrowthmarketnamesmall
SHARED TOKENS (12): "approximately", "benefits", "commercial", "component", "contains", "contamination", "distinguish", "generally", "growth", "market", "name", "small". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Kombucha".
0.420
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscombinationcommercialcommunityindustrialmunicipalsewerwater
SHARED TOKENS (11): "activities", "agricultural", "another", "applications", "combination", "commercial", "community", "industrial", "municipal", "sewer", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wastewater".
0.420
Malt ↗ Q152024 EXACT TITLE
containsdevelopsformformsprocessproductproductsrequiredsinglesmallwater
SHARED TOKENS (11): "contains", "develops", "form", "forms", "process", "product", "products", "required", "single", "small", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Malt".
0.420
Viticulture ↗ Q253140 EXACT TITLE
characteristicsdevelopmenthistoryirrigationleastmanagementmodernprovidesiteterritorywestern
SHARED TOKENS (11): "characteristics", "development", "history", "irrigation", "least", "management", "modern", "provide", "site", "territory", "western". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Viticulture".
0.420
alongsidebasecapitalcentraldetermineeventfederalinterestperiodsprincipalrate
SHARED TOKENS (11): "alongside", "base", "capital", "central", "determine", "event", "federal", "interest", "periods", "principal", "rate". | EXACT TITLE in mortgage_lending: "Interest rate".
0.420
createdetermineevenfinallargermanagementmodelsprocessprovidequalityuses
SHARED TOKENS (11): "create", "determine", "even", "final", "larger", "management", "models", "process", "provide", "quality", "uses". | EXACT TITLE in mortgage_lending: "Mortgage underwriting".
0.420
demandeducationfieldsgenerallyheadquarteredofficeorganizationpacificprovidersresponsetrust
SHARED TOKENS (11): "demand", "education", "fields", "generally", "headquartered", "office", "organization", "pacific", "providers", "response", "trust". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine & Spirit Education Trust".
0.410
Vivino ↗ Q17088880 EXACT TITLE
containingdifferentmobile
SHARED TOKENS (3): "containing", "different", "mobile". | URL->A (1): http://www.vivino.com/. | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Vivino".
0.400
Winery ↗ Q156362 EXACT TITLE
buildingbusinessequipmentlargelargerlinesmakingplaceproductionproperty
SHARED TOKENS (10): "building", "business", "equipment", "large", "larger", "lines", "making", "place", "production", "property". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Winery".
0.400
Barrel ↗ Q10289 EXACT TITLE
americancenterdifferentlargemodernsetsmallusesvolumewater
SHARED TOKENS (10): "american", "center", "different", "large", "modern", "set", "small", "uses", "volume", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barrel".
0.400
analysisbureauclassificationcorporatelabormanagementorganizationpersonrolestatistics
SHARED TOKENS (10): "analysis", "bureau", "classification", "corporate", "labor", "management", "organization", "person", "role", "statistics". | EXACT TITLE in mortgage_lending: "Credit analyst".
0.400
analysisdemandfunctiongrowingimpactneededratherspecificvaluewater
SHARED TOKENS (10): "analysis", "demand", "function", "growing", "impact", "needed", "rather", "specific", "value", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Biochemical oxygen demand".
0.400
chainevaluationinformationprocessprogramratingssourcestudysystemsystems
SHARED TOKENS (10): "chain", "evaluation", "information", "process", "program", "ratings", "source", "study", "system", "systems". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Beer rating".
0.400
Fannie Mae ↗ Q621096 EXACT TITLE
additionalassetsestablishedfederallocalmakingmarketnationalorganizationprocess
SHARED TOKENS (10): "additional", "assets", "established", "federal", "local", "making", "market", "national", "organization", "process". | EXACT TITLE in mortgage_lending: "Fannie Mae".
0.380
Zillow ↗ Q8071921 EXACT TITLE
americancomcurrentestateformergrouprealreal-estatetechnology
SHARED TOKENS (9): "american", "com", "current", "estate", "former", "group", "real", "real-estate", "technology". | EXACT TITLE in mortgage_lending: "Zillow".
0.380
Barley ↗ Q11577 EXACT TITLE
amongaroundcomponentfamilyfeedmakingproductionrolesource
SHARED TOKENS (9): "among", "around", "component", "family", "feed", "making", "production", "role", "source". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barley".
0.380
agencyboisedepartmentenvironmentalfederalgovernmentidahoqualityregional
SHARED TOKENS (9): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho Department of Environmental Quality".
0.380
agencybenefitsdepartmentdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (9): "agency", "benefits", "department", "development", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Idaho Department of Labor".
0.360
Trust deed ↗ Q7848150 EXACT TITLE
estategeneralinstrumentlawlegalrealsystemstrust
SHARED TOKENS (8): "estate", "general", "instrument", "law", "legal", "real", "systems", "trust". | EXACT TITLE in mortgage_lending: "Trust deed".
0.360
activitiesformsnearparticipatingpurchasepurposesourcewhose
SHARED TOKENS (8): "activities", "forms", "near", "participating", "purchase", "purpose", "source", "whose". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine tourism".
0.360
Mead ↗ Q184442 EXACT TITLE
certaincontainscontentdistinctpowersproductrolewater
SHARED TOKENS (8): "certain", "contains", "content", "distinct", "powers", "product", "role", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Mead".
0.360
costsestatefeespropertyrealsellertitletransaction
SHARED TOKENS (8): "costs", "estate", "fees", "property", "real", "seller", "title", "transaction". | EXACT TITLE in mortgage_lending: "Closing costs".
0.360
eventsformsinsurancelosspropertyprotectionrequirespecialized
SHARED TOKENS (8): "events", "forms", "insurance", "loss", "property", "protection", "require", "specialized". | EXACT TITLE in mortgage_lending: "Property insurance".
0.340
Wine club ↗ Q8024922 EXACT TITLE
independentmembershipmodernotherwiseprogramprovidepurchase
SHARED TOKENS (7): "independent", "membership", "modern", "otherwise", "program", "provide", "purchase". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Wine club".
0.340
Vineyard ↗ Q22715 EXACT TITLE
characteristicsitselfplaceproductionspecificstudytable
SHARED TOKENS (7): "characteristics", "itself", "place", "production", "specific", "study", "table". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Vineyard".
0.340
certainchangesprocessprocessingproductsstudywater
SHARED TOKENS (7): "certain", "changes", "process", "processing", "products", "study", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Food chemistry".
0.340
Bankruptcy ↗ Q152074 EXACT TITLE
courtentitieslegalmeaningpersonprocessstatus
SHARED TOKENS (7): "court", "entities", "legal", "meaning", "person", "process", "status". | EXACT TITLE in mortgage_lending: "Bankruptcy".
0.340
Restaurant ↗ Q11707 EXACT TITLE
businessdeliveryfamilygenerallymodelsservessingle
SHARED TOKENS (7): "business", "delivery", "family", "generally", "models", "serves", "single". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Restaurant".
0.340
Grape ↗ Q10978 EXACT TITLE
approximatelyformgenerallygrowinghistoryproductsrole
SHARED TOKENS (7): "approximately", "form", "generally", "growing", "history", "products", "role". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Grape".
0.320
codefederallawleastmobileregulated
SHARED TOKENS (6): "code", "federal", "law", "least", "mobile", "regulated". | EXACT TITLE in mortgage_lending: "Manufactured housing".
0.320
growinggrowthmarketretailsaleselling
SHARED TOKENS (6): "growing", "growth", "market", "retail", "sale", "selling". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Growler (jug)".
0.320
aroundcontainingoutsideproductsvolumewater
SHARED TOKENS (6): "around", "containing", "outside", "products", "volume", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Hard seltzer".
0.320
bureaudepartmentregulatestaxtaxestrade
SHARED TOKENS (6): "bureau", "department", "regulates", "tax", "taxes", "trade". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Alcohol and Tobacco Tax and Trade Bureau".
0.320
anotherconditionsinstrumentlegalspecifiedsubject
SHARED TOKENS (6): "another", "conditions", "instrument", "legal", "specified", "subject". | EXACT TITLE in mortgage_lending: "Promissory note".
0.320
Rum ↗ Q83376 EXACT TITLE
americanhistoryprofilesregionroletrade
SHARED TOKENS (6): "american", "history", "profiles", "region", "role", "trade". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Rum". | EXACT TITLE in mortgage_lending: "Rum".
0.320
businessretailserveservesservingwater
SHARED TOKENS (6): "business", "retail", "serve", "serves", "serving", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Bar (establishment)".
0.300
activityagriculturefarminvolvingoperation
SHARED TOKENS (5): "activity", "agriculture", "farm", "involving", "operation". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Agritourism".
0.300
amongassociatedbecomecharacteristicscommercialdifferentestategeneralgenerallyinstrumentinterestinvestorslargemakingmarketprincipalpublicpurchaseratherreal
SHARED TOKENS (29): "among", "associated", "become", "characteristics", "commercial", "different", "estate", "general", "generally", "instrument", "interest", "investors", "large", "making", "market", "principal", "public", "purchase", "rather", "real"....
0.300
amongbasebenefitschangesdirectdistinctfederalformsgenerallygovernmentindexinterestlegallylinkmarketmarketsobtainoutsideplacesrate
SHARED TOKENS (29): "among", "base", "benefits", "changes", "direct", "distinct", "federal", "forms", "generally", "government", "index", "interest", "legally", "link", "market", "markets", "obtain", "outside", "places", "rate"....
0.300
applicationbrandbuildingbusinesscorporatedevelopmentdifferentdifferseventeventsidentifyingindustryinterestknowledgelabelmanagementmarketmarketingpermitsperson
SHARED TOKENS (33): "application", "brand", "building", "business", "corporate", "development", "different", "differs", "event", "events", "identifying", "industry", "interest", "knowledge", "label", "management", "market", "marketing", "permits", "person"....
0.300
accessactadministrationagencycommunitiescurrentlydepartmentdevelopmentdifferentfacilitiesfederalgovernmentinsurancemarketnationalofficeorganizationownerprincipalprivate
SHARED TOKENS (25): "access", "act", "administration", "agency", "communities", "currently", "department", "development", "different", "facilities", "federal", "government", "insurance", "market", "national", "office", "organization", "owner", "principal", "private"....
0.300
approvalbuildingcodecompliancedevelopmentemploymentexpansiongenerallygovernmentlawlocalnationalneededobtainpermitpermitsplanningregionalrequiredsubject
SHARED TOKENS (21): "approval", "building", "code", "compliance", "development", "employment", "expansion", "generally", "government", "law", "local", "national", "needed", "obtain", "permit", "permits", "planning", "regional", "required", "subject"....
0.300
anotherbecomechainconsolidationdescribeddifferentdirectlyfinalintegratedlargemakingmanagementmarketneededownershipproduceproductproductsratherrelated
SHARED TOKENS (22): "another", "become", "chain", "consolidation", "described", "different", "directly", "final", "integrated", "large", "making", "management", "market", "needed", "ownership", "produce", "product", "products", "rather", "related"....
0.300
Terroir ↗ Q627003 KW CROSS HIGH
affectaffectingaroundcharacteristicsenvironmentalgrowinggrowthindustrylandmodelpracticesqualityregulationsinglesitespecificsystem
SHARED TOKENS (17): "affect", "affecting", "around", "characteristics", "environmental", "growing", "growth", "industry", "land", "model", "practices", "quality", "regulation", "single", "site", "specific", "system".
0.300
actallowamericanappliesauthorizedbasecertaincommunitycompliancecontentcurrentlydistributiondistrictfederalfinalgovernmenthourshouseholdjurisdictionland
SHARED TOKENS (54): "act", "allow", "american", "applies", "authorized", "base", "certain", "community", "compliance", "content", "currently", "distribution", "district", "federal", "final", "government", "hours", "household", "jurisdiction", "land"....
0.300
activitiesadministrationcommercialdepartmententitiesestatefederalfeefeesgenerallygovernmentinsuranceinterestinvestorsprincipalprivateprocesspurchaseratereal
SHARED TOKENS (27): "activities", "administration", "commercial", "department", "entities", "estate", "federal", "fee", "fees", "generally", "government", "insurance", "interest", "investors", "principal", "private", "process", "purchase", "rate", "real"....
0.300
actamericanaroundassetscapitalcentralcommercialconsumercreatedemanddepartmentdevelopmentestateestimatesfederalgovernmentgroupgrowinggrowthhistory
SHARED TOKENS (43): "act", "american", "around", "assets", "capital", "central", "commercial", "consumer", "create", "demand", "department", "development", "estate", "estimates", "federal", "government", "group", "growing", "growth", "history"....
0.300
actadministrationassetsauthoritybureaubusinesscertainchangescomplianceconsumercostsdataestablishedfederalgrowthlargelawmakingpracticesprimary
SHARED TOKENS (30): "act", "administration", "assets", "authority", "bureau", "business", "certain", "changes", "compliance", "consumer", "costs", "data", "established", "federal", "growth", "large", "law", "making", "practices", "primary"....
0.300
abilitycentralcombinationconformingdescribedestatelocallossmarketmarketsnationalnearpricepricespropertypublicrapidrealregional
SHARED TOKENS (19): "ability", "central", "combination", "conforming", "described", "estate", "local", "loss", "market", "markets", "national", "near", "price", "prices", "property", "public", "rapid", "real", "regional".
0.300
actamericanapplicableauthoritybehaviorcentralchangescommunitiescommunityconditionscostscreatingdependsdevelopmentdistrictsenvironmentalexposurefacilitiesfunctionland
SHARED TOKENS (32): "act", "american", "applicable", "authority", "behavior", "central", "changes", "communities", "community", "conditions", "costs", "creating", "depends", "development", "districts", "environmental", "exposure", "facilities", "function", "land"....
0.300
accountactagencyamericancapitalcertaincommercialconditionsconsumercoveragefederalfunctionsgovernmentindicatinginsuranceissueleverageownershipplacesprimary
SHARED TOKENS (29): "account", "act", "agency", "american", "capital", "certain", "commercial", "conditions", "consumer", "coverage", "federal", "functions", "government", "indicating", "insurance", "issue", "leverage", "ownership", "places", "primary"....
0.300
actagencyamongauthoritycombinationcommercialfederalformgroupinstitutioninsuranceinterestlargelaterlawmarketmergerpdfregulatorytemporary
SHARED TOKENS (20): "act", "agency", "among", "authority", "combination", "commercial", "federal", "form", "group", "institution", "insurance", "interest", "large", "later", "law", "market", "merger", "pdf", "regulatory", "temporary".
0.300
communitiesconnectedcontroldatafeesgroupinfluencelinesmanagementmarketingmarketspersonproductproductsrelatedreviewsystems
SHARED TOKENS (17): "communities", "connected", "control", "data", "fees", "group", "influence", "lines", "management", "marketing", "markets", "person", "product", "products", "related", "review", "systems".
0.300
commercialcontractcurrentdescribingestatefeaturesfinalinterestlargemarketownerperiodsprincipalpropertyprovisionsraterealresidentialresourcesstated
SHARED TOKENS (21): "commercial", "contract", "current", "describing", "estate", "features", "final", "interest", "large", "market", "owner", "periods", "principal", "property", "provisions", "rate", "real", "residential", "resources", "stated"....
0.300
affectinganalysisapplicationbusinesschangesdemandeconomicsestateindustrymarketsrealrelatedresearchresidentialscopesupplyurban
SHARED TOKENS (17): "affecting", "analysis", "application", "business", "changes", "demand", "economics", "estate", "industry", "markets", "real", "related", "research", "residential", "scope", "supply", "urban".
0.300
Distillation ↗ Q101017 KW CROSS HIGH
applicationsapproximatelychangescomponentcontentenvironmentalfeedfootprintidentifiesindustrialissuelargematerialsmechanismoperateoperatesoperationoperationsphysicalprocess
SHARED TOKENS (28): "applications", "approximately", "changes", "component", "content", "environmental", "feed", "footprint", "identifies", "industrial", "issue", "large", "materials", "mechanism", "operate", "operates", "operation", "operations", "physical", "process"....
0.300
analysiscommercialcostsdefinitionsdependsdevelopeddevelopmentdifferentindustriallandpreviouslyredevelopmentrequirerequiressitespecializedstudy
SHARED TOKENS (17): "analysis", "commercial", "costs", "definitions", "depends", "developed", "development", "different", "industrial", "land", "previously", "redevelopment", "require", "requires", "site", "specialized", "study".
0.300
administrationagencyamericanbenefitscostsdepartmenteducationeligibleestablishedestimatedexpandedfacilitiesfamilyfederalgovernmentinsurancejunemissionnationalprogram
SHARED TOKENS (20): "administration", "agency", "american", "benefits", "costs", "department", "education", "eligible", "established", "estimated", "expanded", "facilities", "family", "federal", "government", "insurance", "june", "mission", "national", "program".
0.300
actamericanapplicableappliescodeconcerningdevelopmentdifferentenforcementexpandedfamilyfederallawnationalprivateprogramsprovisionprovisionsrightssale
SHARED TOKENS (23): "act", "american", "applicable", "applies", "code", "concerning", "development", "different", "enforcement", "expanded", "family", "federal", "law", "national", "private", "programs", "provision", "provisions", "rights", "sale"....
0.300
Credit score ↗ Q1787103 KW CROSS HIGH
analysisdatadepartmentsdeterminefilesgovernmentinformationinsuranceinterestlimitsmobilepersonratereportrepresent
SHARED TOKENS (15): "analysis", "data", "departments", "determine", "files", "government", "information", "insurance", "interest", "limits", "mobile", "person", "rate", "report", "represent".
0.300
buildingcertaincharacteristicsconditionscontainingcreatesevengenerallyindicatesmaterialspersonnelphysicalpropertypublicspecificsubjectsystem
SHARED TOKENS (17): "building", "certain", "characteristics", "conditions", "containing", "creates", "even", "generally", "indicates", "materials", "personnel", "physical", "property", "public", "specific", "subject", "system".
0.300
Financial literacy ↗ KW CROSS HIGH
abilityallowauthoritybehaviorconceptscostsdecisionsdevelopmenteducationestablishedgovernmentinformationinterestknowledgenationalorganizationpersonalprogramsprovideresearch
SHARED TOKENS (24): "ability", "allow", "authority", "behavior", "concepts", "costs", "decisions", "development", "education", "established", "government", "information", "interest", "knowledge", "national", "organization", "personal", "programs", "provide", "research"....
0.300
Home equity loan ↗ KW CROSS HIGH
collegecreateseducationhistoryinstitutioninterestlawlinespersonpersonalplacepropertypurchaseraterequirespecifictaxtaxesvalue
SHARED TOKENS (19): "college", "creates", "education", "history", "institution", "interest", "law", "lines", "person", "personal", "place", "property", "purchase", "rate", "require", "specific", "tax", "taxes", "value".
0.300
Keg ↗ Q947211 EXACT TITLE
generallyinsidemaintainservesmall
SHARED TOKENS (5): "generally", "inside", "maintain", "serve", "small". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Keg".
0.300
Pollution ↗ Q58734 KW CROSS HIGH
agriculturalagriculturealongsideapproximatelyaroundcommunitiesconcentratedcontaminationdevelopmentenvironmentaleventsformformationformsgenerallyimpactlaterlocalmanagementnational
SHARED TOKENS (30): "agricultural", "agriculture", "alongside", "approximately", "around", "communities", "concentrated", "contamination", "development", "environmental", "events", "form", "formation", "forms", "generally", "impact", "later", "local", "management", "national"....
0.300
administrationagriculturecostsdepartmentdevelopmentevenfederalfederallygovernmentinterestinvestorsnationalofficepublicruralunderlyingurban
SHARED TOKENS (17): "administration", "agriculture", "costs", "department", "development", "even", "federal", "federally", "government", "interest", "investors", "national", "office", "public", "rural", "underlying", "urban".
0.300
actamericanamonganotherapproximatelybroaderchangesdifferentestimatedevengovernmenthouseholdinterestinvestorsleastmarketpricesproductproductsprogram
SHARED TOKENS (24): "act", "american", "among", "another", "approximately", "broader", "changes", "different", "estimated", "even", "government", "household", "interest", "investors", "least", "market", "prices", "product", "products", "program"....
0.300
H-1B visa ↗ Q974595 KW CROSS HIGH
additionaladministrationagencyagricultureapplicantsapplicationbeyondcertainclassificationcodifiedconditionsconsumercurrentlydefinesdepartmentemployeremploymentestimatedfeegrowth
SHARED TOKENS (39): "additional", "administration", "agency", "agriculture", "applicants", "application", "beyond", "certain", "classification", "codified", "conditions", "consumer", "currently", "defines", "department", "employer", "employment", "estimated", "fee", "growth"....
0.300
academicanotherbecomebehaviorcontentcostscurrentlydevelopeddevelopmentdiscoveryformsinformationinterestlargemobilenewsoperateoperatorsplatformplatforms
SHARED TOKENS (33): "academic", "another", "become", "behavior", "content", "costs", "currently", "developed", "development", "discovery", "forms", "information", "interest", "large", "mobile", "news", "operate", "operators", "platform", "platforms"....
0.300
alongsideamongchangescreatedifferentlawlegallegallylimitspersonplacesprivatepublicpurchasereducespecial
SHARED TOKENS (16): "alongside", "among", "changes", "create", "different", "law", "legal", "legally", "limits", "person", "places", "private", "public", "purchase", "reduce", "special".
0.300
activitiesamongbuildingcapitalchainchannelscontrolcostscreatingdemanddepartmentdevelopeddistributionfunctionsinformationinfrastructureintegratedinventorymanagementmarketing
SHARED TOKENS (37): "activities", "among", "building", "capital", "chain", "channels", "control", "costs", "creating", "demand", "department", "developed", "distribution", "functions", "information", "infrastructure", "integrated", "inventory", "management", "marketing"....
0.300
administrationaffectaffectingaloneamongestateevenfederalgovernmenthistoryimpactindexinstitutionalinvestorslargelargermarketmarketsnationalprice
SHARED TOKENS (31): "administration", "affect", "affecting", "alone", "among", "estate", "even", "federal", "government", "history", "impact", "index", "institutional", "investors", "large", "larger", "market", "markets", "national", "price"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcommercialcostscurrentlydescribeddevelopmentenvironmentalexpansionformgrowthindustrialinfrastructurelacklandlargelossmaintaining
SHARED TOKENS (38): "agency", "associated", "become", "building", "commercial", "costs", "currently", "described", "development", "environmental", "expansion", "form", "growth", "industrial", "infrastructure", "lack", "land", "large", "loss", "maintaining"....
0.300
americanassetscommercialestateinterestlawpropertyprotectionprovisionsrateratherrealresidentialsecuritystructuresubjecttaxtransactionstrustunderlying
SHARED TOKENS (20): "american", "assets", "commercial", "estate", "interest", "law", "property", "protection", "provisions", "rate", "rather", "real", "residential", "security", "structure", "subject", "tax", "transactions", "trust", "underlying".
0.300
Groundwater ↗ Q161598 KW CROSS HIGH
agriculturalagriculturebecomecentralcontainsdistributionenvironmentalformformationhouseholdindustrialinfluencelandlossmunicipaloperatingpercentprimaryprocessprovide
SHARED TOKENS (31): "agricultural", "agriculture", "become", "central", "contains", "distribution", "environmental", "form", "formation", "household", "industrial", "influence", "land", "loss", "municipal", "operating", "percent", "primary", "process", "provide"....
0.300
accessadditionalapplicationassetsassociatedconventionalcostscourtestateevaluationeventfeegeneralinterestlinespermitprimaryprocessingpropertyreal
SHARED TOKENS (27): "access", "additional", "application", "assets", "associated", "conventional", "costs", "court", "estate", "evaluation", "event", "fee", "general", "interest", "lines", "permit", "primary", "processing", "property", "real"....
0.300
activeassociatedconcentrationdeterminedistributioneconomicsemploymentfunctionindicatesindustrialindustrylandlawmarketorganizationpricesproductionratereducedregulation
SHARED TOKENS (29): "active", "associated", "concentration", "determine", "distribution", "economics", "employment", "function", "indicates", "industrial", "industry", "land", "law", "market", "organization", "prices", "production", "rate", "reduced", "regulation"....
0.300
activityadaamericanapproximatelyboisebureaucentercountieseagleestablishedgrowingidahonationnorthwestregiontaxtradevalley
SHARED TOKENS (18): "activity", "ada", "american", "approximately", "boise", "bureau", "center", "counties", "eagle", "established", "growing", "idaho", "nation", "northwest", "region", "tax", "trade", "valley".
0.300
Federal Reserve ↗ Q53536 KW CROSS HIGH
accountactactivityamongannualapproximatelycapitalcentralcommercialcontroldecisionsdepartmentemploymentestablishedeventsexpandedexpansionfederalgenerallygoverned
SHARED TOKENS (42): "account", "act", "activity", "among", "annual", "approximately", "capital", "central", "commercial", "control", "decisions", "department", "employment", "established", "events", "expanded", "expansion", "federal", "generally", "governed"....
0.300
accessanotherapplicationassociatedcapitalchangesclassificationdescribeddevelopmentdifferentdirectfamilyformformshouseholdlargelegalmoveplaceregion
SHARED TOKENS (22): "access", "another", "application", "associated", "capital", "changes", "classification", "described", "development", "different", "direct", "family", "form", "forms", "household", "large", "legal", "move", "place", "region"....
0.300
certainconditionconsumerdirectlyeducationgenerallyindustryinterestitselfmaintainproductspropertyrequirerequirementsuses
SHARED TOKENS (15): "certain", "condition", "consumer", "directly", "education", "generally", "industry", "interest", "itself", "maintain", "products", "property", "require", "requirements", "uses".
0.300
applicationsapprovalcommerciallicensedrelated
SHARED TOKENS (5): "applications", "approval", "commercial", "licensed", "related". | EXACT TITLE in mortgage_lending: "Loan officer".
0.300
actaddressadministrationagencyauthoritydocumentsfederalguidanceindustryissuelawleastlegalpowersreportsrequiressales
SHARED TOKENS (17): "act", "address", "administration", "agency", "authority", "documents", "federal", "guidance", "industry", "issue", "law", "least", "legal", "powers", "reports", "requires", "sales".
0.300
Supply chain ↗ Q1824206 KW CROSS HIGH
chainchannelsconsumercreatingdirectdirectlydistributionfacilitiesindependentmanagementmaterialsnetworkproductproductsstructuresupplysystemsystemsvalue
SHARED TOKENS (19): "chain", "channels", "consumer", "creating", "direct", "directly", "distribution", "facilities", "independent", "management", "materials", "network", "product", "products", "structure", "supply", "system", "systems", "value".
0.300
aroundcertaincharacteristicsclassificationcodecurrentlydifferentdistinguishexpandedfitformindicatesindicatinglinespropertiessequencestarsystem
SHARED TOKENS (18): "around", "certain", "characteristics", "classification", "code", "currently", "different", "distinguish", "expanded", "fit", "form", "indicates", "indicating", "lines", "properties", "sequence", "star", "system".
0.300
applicationapprovalcertainchaptercodeconsolidationcourtformgeneralgoverningpersonpersonalplatformpropertyprotectionprovidepurposerequirementssourcestatutes
SHARED TOKENS (23): "application", "approval", "certain", "chapter", "code", "consolidation", "court", "form", "general", "governing", "person", "personal", "platform", "property", "protection", "provide", "purpose", "requirements", "source", "statutes"....
0.300
agriculturalagricultureallowbusinesschangescodecommunityconditionsconventionalcreateenvironmentalfarmfeedfootprintformgrowinglandpopulationpracticesproduction
SHARED TOKENS (29): "agricultural", "agriculture", "allow", "business", "changes", "code", "community", "conditions", "conventional", "create", "environmental", "farm", "feed", "footprint", "form", "growing", "land", "population", "practices", "production"....
0.300
accountamericanapplicationappliescertaindifferentfacegenerallyindustrymarketmarketsnetworkplanningprocessresearchspecializedspecific
SHARED TOKENS (17): "account", "american", "application", "applies", "certain", "different", "face", "generally", "industry", "market", "markets", "network", "planning", "process", "research", "specialized", "specific".
0.300
Oak (wine) ↗ Q808963 EXACT TITLE
exposureformmakingperiodsprofile
SHARED TOKENS (5): "exposure", "form", "making", "periods", "profile". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Oak (wine)".
0.300
agencyanotherassetscommercialdifferentestatefacegenerallygovernmentgroupinstrumentinterestinvestorsissuemarketofficeperiodsprincipalratherreal
SHARED TOKENS (32): "agency", "another", "assets", "commercial", "different", "estate", "face", "generally", "government", "group", "instrument", "interest", "investors", "issue", "market", "office", "periods", "principal", "rather", "real"....
0.300
conditionestateformlandmarketpriceprocesspropertyrealreportreportsrolesaletaxationvalue
SHARED TOKENS (15): "condition", "estate", "form", "land", "market", "price", "process", "property", "real", "report", "reports", "role", "sale", "taxation", "value".
0.300
Food science ↗ Q1637030 KW CROSS HIGH
agriculturalcentralconceptsconductdevelopmentdirectlyevaluationextendsmaterialsmodernpracticesprocessingproduceproductionproductspropertiesscopestudytechnologytesting
SHARED TOKENS (20): "agricultural", "central", "concepts", "conduct", "development", "directly", "evaluation", "extends", "materials", "modern", "practices", "processing", "produce", "production", "products", "properties", "scope", "study", "technology", "testing".
0.300
administersbusinesscommunitiescommunitydevelopmentdistrictimpactindependentlocalnationalnetworknonprofitorganizationprofessionalprogramresearchruralserveservingstability
SHARED TOKENS (24): "administers", "business", "communities", "community", "development", "district", "impact", "independent", "local", "national", "network", "nonprofit", "organization", "professional", "program", "research", "rural", "serve", "serving", "stability"....
0.300
VA loan ↗ Q7906577 KW CROSS HIGH
additionalallowamericanapplicationconformingcurrentlydepartmentdirectlyeligiblefeeinsuranceinterestlargerpercentpriceprivateprogrampropertiespropertypurchase
SHARED TOKENS (28): "additional", "allow", "american", "application", "conforming", "currently", "department", "directly", "eligible", "fee", "insurance", "interest", "larger", "percent", "price", "private", "program", "properties", "property", "purchase"....
0.300
acquisitionallowcenterconsumercourtdependsfeesformerinterestlargelawlegalnationalperiodsprincipalproducepropertypublicpurchaserecord
SHARED TOKENS (28): "acquisition", "allow", "center", "consumer", "court", "depends", "fees", "former", "interest", "large", "law", "legal", "national", "periods", "principal", "produce", "property", "public", "purchase", "record"....
0.300
abilityadministrationagencyauthoritycourtdepartmentdevelopmententitiesexpandedfederalindependentinsurancelegalmissionofficeplacepowersregulatesregulatoryrole
SHARED TOKENS (24): "ability", "administration", "agency", "authority", "court", "department", "development", "entities", "expanded", "federal", "independent", "insurance", "legal", "mission", "office", "place", "powers", "regulates", "regulatory", "role"....
0.300
accountadministrationagencyamericanassetscentralcommercialcommunitydevelopmentfederalfederallygovernmentindependentinsurancenationaloperatesoperatingoperationsprovideshare
SHARED TOKENS (21): "account", "administration", "agency", "american", "assets", "central", "commercial", "community", "development", "federal", "federally", "government", "independent", "insurance", "national", "operates", "operating", "operations", "provide", "share"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesschaincommercialdataindustryinventorymanagementmarketingmobileplatformsprocessingproductsretailsegmentsellingsupplysystemstransaction
SHARED TOKENS (19): "activities", "business", "chain", "commercial", "data", "industry", "inventory", "management", "marketing", "mobile", "platforms", "processing", "products", "retail", "segment", "selling", "supply", "systems", "transaction".
0.300
businesscontrollocalregionretail
SHARED TOKENS (5): "business", "control", "local", "region", "retail". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Liquor store".
0.300
authoritybecomeconditionscontroldirectlydistributionentitiesformgovernmentindependentinventoryitselflacklawmarketingoperatingplaceprivateproductspurchase
SHARED TOKENS (30): "authority", "become", "conditions", "control", "directly", "distribution", "entities", "form", "government", "independent", "inventory", "itself", "lack", "law", "marketing", "operating", "place", "private", "products", "purchase"....
0.300
appliescontaminationdescribesfacilitiesindustrialindustrymaterialsmunicipalprocessproduceproductionreducesewerspecializedsystemtreatingwater
SHARED TOKENS (17): "applies", "contamination", "describes", "facilities", "industrial", "industry", "materials", "municipal", "process", "produce", "production", "reduce", "sewer", "specialized", "system", "treating", "water".
0.300
Rosé ↗ Q12979 KW CROSS HIGH
aroundconcentratedevenfinalgrowinghourslawmakingprimaryproduceproductratherreducedremainvolume
SHARED TOKENS (15): "around", "concentrated", "even", "final", "growing", "hours", "law", "making", "primary", "produce", "product", "rather", "reduced", "remain", "volume".
0.300
divisionlossprocessreducesale
SHARED TOKENS (5): "division", "loss", "process", "reduce", "sale". | EXACT TITLE in mortgage_lending: "Loss mitigation".
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesagriculturalassociatedchaindistributionequipmentlossmaintainmanagementproduceproductionproductsqualityrequiressequencesupplyuses
SHARED TOKENS (17): "activities", "agricultural", "associated", "chain", "distribution", "equipment", "loss", "maintain", "management", "produce", "production", "products", "quality", "requires", "sequence", "supply", "uses".
0.300
actapprovalapprovalsbuildingcommercialcostscreatesdeterminedevelopmentdifferentenvironmentalestategrowthlandleveragemarketingmixed-useobtainpermitsplace
SHARED TOKENS (37): "act", "approval", "approvals", "building", "commercial", "costs", "creates", "determine", "development", "different", "environmental", "estate", "growth", "land", "leverage", "marketing", "mixed-use", "obtain", "permits", "place"....
🫐 BERRY75 edges
0.280
costsevengrowingremains
SHARED TOKENS (4): "costs", "even", "growing", "remains". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Barrel-aged beer".
0.280
academicadministrationbusinesscollegedepartmentindustrymanagementmarketingparksrelevantschoolstudysubjectuniversity
SHARED TOKENS (14): "academic", "administration", "business", "college", "department", "industry", "management", "marketing", "parks", "relevant", "school", "study", "subject", "university".
0.280
Sommelier ↗ Q191493 EXACT TITLE
personprofessionalrolespecialized
SHARED TOKENS (4): "person", "professional", "role", "specialized". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Sommelier".
0.280
abilityassociatedcommercialestatelatermakingmarketpriceprocesspropertyrealremainresidentialvalue
SHARED TOKENS (14): "ability", "associated", "commercial", "estate", "later", "making", "market", "price", "process", "property", "real", "remain", "residential", "value".
0.280
Parcel ↗ Q7136418 EXACT TITLE
deliverygeographylandmodern
SHARED TOKENS (4): "delivery", "geography", "land", "modern". | EXACT TITLE in mortgage_lending: "Parcel".
0.280
advertisinganalysisappliesapplyingcomponentconsumerdepartmentsevaluationgenerallylargemarketingproductsrequirestesting
SHARED TOKENS (14): "advertising", "analysis", "applies", "applying", "component", "consumer", "departments", "evaluation", "generally", "large", "marketing", "products", "requires", "testing".
0.280
courtestablishedorganizationprofessionals
SHARED TOKENS (4): "court", "established", "organization", "professionals". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Court of Master Sommeliers".
0.260
benefitscertaincommunitydirectdistrictestateidentifiedpublicratherrealspecialspecifictax
SHARED TOKENS (13): "benefits", "certain", "community", "direct", "district", "estate", "identified", "public", "rather", "real", "special", "specific", "tax".
0.260
Mobile home ↗ Q1434998 KW CROSS HIGH
basedifferentlegalmobilemoveparkplacerequiredsharesitestructuretemporarywork
SHARED TOKENS (13): "base", "different", "legal", "mobile", "move", "park", "place", "required", "share", "site", "structure", "temporary", "work".
0.260
authoritydistrictdistrictsgovernmentirrigationlargelocalobtainpublicsetstatutetaxwater
SHARED TOKENS (13): "authority", "district", "districts", "government", "irrigation", "large", "local", "obtain", "public", "set", "statute", "tax", "water".
0.260
agriculturalagriculturedifferentidaholandnationprocessingproductionproductsrolesalesalessector
SHARED TOKENS (13): "agricultural", "agriculture", "different", "idaho", "land", "nation", "processing", "production", "products", "role", "sale", "sales", "sector".
0.260
amongassetsestateinvestorsinvolvinglargelargermakingmarketpricepricesrealreal-estate
SHARED TOKENS (13): "among", "assets", "estate", "investors", "involving", "large", "larger", "making", "market", "price", "prices", "real", "real-estate".
0.260
actagencybureaudepartmentestablishedfederalfederallyindependentlicensednationalofficeregulatoryserves
SHARED TOKENS (13): "act", "agency", "bureau", "department", "established", "federal", "federally", "independent", "licensed", "national", "office", "regulatory", "serves".
0.260
certainconsumerdirectlyfederallocalpriceproductproductsratherremainsimultaneouslytaxtaxes
SHARED TOKENS (13): "certain", "consumer", "directly", "federal", "local", "price", "product", "products", "rather", "remain", "simultaneously", "tax", "taxes".
0.260
actbureauconsumerdatafederalfilesinformationprivateprotectionregulatesreportingreportstrade
SHARED TOKENS (13): "act", "bureau", "consumer", "data", "federal", "files", "information", "private", "protection", "regulates", "reporting", "reports", "trade".
0.260
Vitis vinifera ↗ Q30046 KW CROSS HIGH
aroundcentralcommercialeastfamilyformformsproduceproductionregionrequiredseparatetable
SHARED TOKENS (13): "around", "central", "commercial", "east", "family", "form", "forms", "produce", "production", "region", "required", "separate", "table".
0.240
Pasteurization ↗ Q58148 KW CROSS HIGH
changescharacteristicsdirectindustryprocessprocessingproductsqualityresearchsystemwaterwhose
SHARED TOKENS (12): "changes", "characteristics", "direct", "industry", "process", "processing", "products", "quality", "research", "system", "water", "whose".
0.240
businessdifferenteconomicsestatelandmarketpersonrealreal-estateresidentialsellingsingle
SHARED TOKENS (12): "business", "different", "economics", "estate", "land", "market", "person", "real", "real-estate", "residential", "selling", "single".
0.240
annualconsumerdefinitionsfeeforminterestlegalprotectionrateratherrequiredstandardized
SHARED TOKENS (12): "annual", "consumer", "definitions", "fee", "form", "interest", "legal", "protection", "rate", "rather", "required", "standardized".
0.240
abilitybenefitsformsgenerallyinterestpersonraterealremainssingleunlessvalue
SHARED TOKENS (12): "ability", "benefits", "forms", "generally", "interest", "person", "rate", "real", "remains", "single", "unless", "value".
0.240
accessoryadditionalfamilyobtainpersonalprincipalpropertyprovideresidentialsecurityseparatesmall
SHARED TOKENS (12): "accessory", "additional", "family", "obtain", "personal", "principal", "property", "provide", "residential", "security", "separate", "small".
0.240
conformingconventionalfeesinterestlargelargerlimitspurchasequalityresidentialsetvalue
SHARED TOKENS (12): "conforming", "conventional", "fees", "interest", "large", "larger", "limits", "purchase", "quality", "residential", "set", "value".
0.240
Bridge loan ↗ Q2079582 KW CROSS HIGH
additionalapplicationsbusinessconventionalcostsfeesgenerallyinterestlargerparticipationraterequire
SHARED TOKENS (12): "additional", "applications", "business", "conventional", "costs", "fees", "generally", "interest", "larger", "participation", "rate", "require".
0.230
currentgovernmentidahooffice
SHARED TOKENS (4): "current", "government", "idaho", "office". | URL->B (1): https://sos.idaho.gov/.
0.220
communitieslandscapemaintainingmissionorganizationpartnerspracticesprivateprogramsqualitywater
SHARED TOKENS (11): "communities", "landscape", "maintaining", "mission", "organization", "partners", "practices", "private", "programs", "quality", "water".
0.220
Malting ↗ Q4395224 KW CROSS HIGH
allowamongchangesequipmentlargelayermakingmodernprocessproducerequired
SHARED TOKENS (11): "allow", "among", "changes", "equipment", "large", "layer", "making", "modern", "process", "produce", "required".
0.220
agencyagriculturalagriculturebureaudepartmentgovernmentidaholandlicensingmanagementprogram
SHARED TOKENS (11): "agency", "agricultural", "agriculture", "bureau", "department", "government", "idaho", "land", "licensing", "management", "program".
0.220
approximatelyboisedatadistrictdistrictsevengovernmentidaholimitspopulationsingle
SHARED TOKENS (11): "approximately", "boise", "data", "district", "districts", "even", "government", "idaho", "limits", "population", "single".
0.220
allowbroaderconforminglacklargeprivatepropertyreal-estaterequirestatussufficient
SHARED TOKENS (11): "allow", "broader", "conforming", "lack", "large", "private", "property", "real-estate", "require", "status", "sufficient".
0.220
associatedboisecentercontainsextendsfederallyidahometropolitanpopulationsidevalley
SHARED TOKENS (11): "associated", "boise", "center", "contains", "extends", "federally", "idaho", "metropolitan", "population", "side", "valley".
0.220
Wine label ↗ Q1420576 KW CROSS HIGH
addresscertaincodeinformationlabelnationalqualityrequirementsresourcesitespecific
SHARED TOKENS (11): "address", "certain", "code", "information", "label", "national", "quality", "requirements", "resource", "site", "specific".
0.220
Trailer park ↗ Q1426493 KW CROSS HIGH
americancommunitymobilemodernparkparksplacestatementstatustechnologytemporary
SHARED TOKENS (11): "american", "community", "mobile", "modern", "park", "parks", "place", "statement", "status", "technology", "temporary".
0.220
describedinstrumentlandlawlegalpropertyrealrequiredspecificstatementwritten
SHARED TOKENS (11): "described", "instrument", "land", "law", "legal", "property", "real", "required", "specific", "statement", "written".
0.220
interestitselflaborlinkmaterialsmeaningpersonalpropertyrealsecuritytitle
SHARED TOKENS (11): "interest", "itself", "labor", "link", "materials", "meaning", "personal", "property", "real", "security", "title".
0.220
aroundeveneventfamilyformhoursnameprovideratherseparatewhose
SHARED TOKENS (11): "around", "even", "event", "family", "form", "hours", "name", "provide", "rather", "separate", "whose".
0.220
Tied house ↗ Q7800977 KW CROSS HIGH
describedgenerallygovernmentindustrialleastpublicrelationshipsreportrequiredspecificsystem
SHARED TOKENS (11): "described", "generally", "government", "industrial", "least", "public", "relationships", "report", "required", "specific", "system".
0.220
controldistinctgoverninglawownershippropertyqualityrelatedresourceresourceswater
SHARED TOKENS (11): "control", "distinct", "governing", "law", "ownership", "property", "quality", "related", "resource", "resources", "water".
0.220
capitalcommercialconventionalestateinstrumentinterestprivatepropertyrealresidentialspecific
SHARED TOKENS (11): "capital", "commercial", "conventional", "estate", "instrument", "interest", "private", "property", "real", "residential", "specific".
0.220
functionsystem
SHARED TOKENS (2): "function", "system". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Distributor".
0.220
Red wine ↗ Q1827 EXACT TITLE
processproduction
SHARED TOKENS (2): "process", "production". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Red wine".
0.220
actamericanamongchangeschaptercodeconsumerlawpdfprotectionprovisions
SHARED TOKENS (11): "act", "american", "among", "changes", "chapter", "code", "consumer", "law", "pdf", "protection", "provisions".
0.220
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalgovernmentprogramreportsurban
SHARED TOKENS (11): "administers", "agency", "department", "departments", "development", "directly", "federal", "government", "program", "reports", "urban".
0.220
distributionuses
SHARED TOKENS (2): "distribution", "uses". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Glass bottle".
0.220
Cocktail ↗ Q134768 EXACT TITLE
combinationwater
SHARED TOKENS (2): "combination", "water". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Cocktail".
0.210
Cider ↗ Q167296 EXACT TITLE
content
SHARED TOKENS (1): "content". | EXACT TITLE in craft_beverage_brewery_winery_drinks: "Cider".
0.200
White wine ↗ Q10210 KW CROSS HIGH
abilityamongcompleteformshistoryinfluencelargeleastprocessproduce
SHARED TOKENS (10): "ability", "among", "complete", "forms", "history", "influence", "large", "least", "process", "produce".
0.200
agencyboisebureaudepartmentgovernmentidahonationalsecurityservestaff
SHARED TOKENS (10): "agency", "boise", "bureau", "department", "government", "idaho", "national", "security", "serve", "staff".
0.200
abilitybecomecomponentconditiondevelopmentformlayerstructuresupportswater
SHARED TOKENS (10): "ability", "become", "component", "condition", "development", "form", "layer", "structure", "supports", "water".
0.200
Cider mill ↗ Q5119518 KW CROSS HIGH
equipmentlegalmakingnearproductionproductspropertystructuresubjectwater
SHARED TOKENS (10): "equipment", "legal", "making", "near", "production", "products", "property", "structure", "subject", "water".
0.200
buildingestatepricepropertypurchaserealrepresentsellertransactionvalue
SHARED TOKENS (10): "building", "estate", "price", "property", "purchase", "real", "represent", "seller", "transaction", "value".
0.200
EXACT TITLE in mortgage_lending: "Subdivision".
0.200
Appraisal ↗ Q4781689 EXACT TITLE
EXACT TITLE in mortgage_lending: "Appraisal".
0.200
accessextendsinterestmaintainmaintainingmarketotherwiseprovisionqualityuniversity
SHARED TOKENS (10): "access", "extends", "interest", "maintain", "maintaining", "market", "otherwise", "provision", "quality", "university".
0.200
americancloseconsolidatedindustrylargermarketproducingproductssalessmall
SHARED TOKENS (10): "american", "close", "consolidated", "industry", "larger", "market", "producing", "products", "sales", "small".
0.180
adaboisegovernmentidahometropolitanmunicipalnamepopulationseparate
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "name", "population", "separate".
0.160
agencyestateeventfieldsindustryparksplanningreal
SHARED TOKENS (8): "agency", "estate", "event", "fields", "industry", "parks", "planning", "real".
0.160
Beer style ↗ Q1998962 KW CROSS HIGH
differenthistoryleastlocalmodernproductionstudywork
SHARED TOKENS (8): "different", "history", "least", "local", "modern", "production", "study", "work".
0.160
Wine cellar ↗ Q22995 KW CROSS HIGH
activecontroldepartmenthouseholdlargereducesmallsystem
SHARED TOKENS (8): "active", "control", "department", "household", "large", "reduce", "small", "system".
0.160
actaddressauthorizedcapitalgovernmentlargemarketpractices
SHARED TOKENS (8): "act", "address", "authorized", "capital", "government", "large", "market", "practices".
0.160
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturaldivisioneastidaholargernationalnearvalley
SHARED TOKENS (8): "agricultural", "division", "east", "idaho", "larger", "national", "near", "valley".
0.160
decisionsevaluationformproductproductsprofessionalreviewreviews
SHARED TOKENS (8): "decisions", "evaluation", "form", "product", "products", "professional", "review", "reviews".
0.160
Winemaking ↗ Q213376 KW CROSS HIGH
aroundgeneralgrowinghistoryplaceproductionselectionwater
SHARED TOKENS (8): "around", "general", "growing", "history", "place", "production", "selection", "water".
0.140
costsinsuranceprivatepropertypurposerequiredsale
SHARED TOKENS (7): "costs", "insurance", "private", "property", "purpose", "required", "sale".
0.140
Craft beer ↗ Q5487333 KW CROSS HIGH
distributionexpandedgenerallylargerproduceproductionsale
SHARED TOKENS (7): "distribution", "expanded", "generally", "larger", "produce", "production", "sale".
0.140
coveragedetermineinsurancelosspropertiespropertyspecific
SHARED TOKENS (7): "coverage", "determine", "insurance", "loss", "properties", "property", "specific".
0.140
estateformfunctionsownerpersonrealstatus
SHARED TOKENS (7): "estate", "form", "functions", "owner", "person", "real", "status".
0.140
amongassociatedconditionfeedgroupnamereduced
SHARED TOKENS (7): "among", "associated", "condition", "feed", "group", "name", "reduced".
0.140
Culinary arts ↗ Q2111686 KW CROSS HIGH
formgenerallargemakingpresentationprincipalrequires
SHARED TOKENS (7): "form", "general", "large", "making", "presentation", "principal", "requires".
0.140
affectingcontractgenerallegaloutsideprocesstrust
SHARED TOKENS (7): "affecting", "contract", "general", "legal", "outside", "process", "trust".
0.140
activitiesalongsideamongcomponentpurposestudysubject
SHARED TOKENS (7): "activities", "alongside", "among", "component", "purpose", "study", "subject".
0.140
chaptercodefederalformprocessstatutetitle
SHARED TOKENS (7): "chapter", "code", "federal", "form", "process", "statute", "title".
0.120
Vodka ↗ Q374 KW CROSS HIGH
basecontentestablishedmodernvolumewater
SHARED TOKENS (6): "base", "content", "established", "modern", "volume", "water".
0.120
Negative equity ↗ KW CROSS HIGH
assetsestateownerrealvaluewhose
SHARED TOKENS (6): "assets", "estate", "owner", "real", "value", "whose".
0.120
USDA home loan ↗ KW CROSS HIGH
agriculturedepartmentdevelopmentprogrampropertyrural
SHARED TOKENS (6): "agriculture", "department", "development", "program", "property", "rural".
0.100
affectingcurrentlydiscoveryidentifiedvalue
SHARED TOKENS (5): "affecting", "currently", "discovery", "identified", "value".
◈ Frequently Asked Questions
Craft Beverage Brewery Winery Drinks × Mortgage Lending — Treasure Valley
HAIKU · HIGH GATE
Why do craft beverage operations in Ada County need specialized mortgage products?
Breweries and wineries in Ada County typically require real estate financing that accounts for production facilities, tasting rooms, and water rights tied to Boise River access or groundwater permits. Lenders in the Treasure Valley have developed mortgage structures recognizing that these businesses generate revenue differently than standard commercial operations, with seasonal cash flow patterns and equipment-heavy balance sheets requiring longer amortization periods.
How do water rights affect mortgage lending for Nampa and Caldwell craft beverage producers?
Water rights secured to properties in Nampa and Caldwell directly influence the collateral valuation and risk assessment mortgage lenders apply to brewery and winery operations. Idaho water law recognizes adjudicated rights as real property interests, so lenders examine whether operations hold senior or junior water rights before determining loan-to-value ratios on facilities dependent on reliable irrigation or processing water.
What role do Boise State University and College of Western Idaho play in financing craft beverage businesses?
Boise State University and College of Western Idaho operate small business development centers that connect craft beverage entrepreneurs in the Treasure Valley with mortgage lenders and private equity investors experienced in agricultural and food production lending. These institutions provide financial literacy and business plan review services that strengthen loan applications for brewery and winery owners seeking expansion financing in Ada County and surrounding areas.
How do mergers and acquisitions in Boise's craft beverage sector affect mortgage portfolios?
When private equity firms or larger beverage companies acquire craft breweries and wineries across Boise, Nampa, and Caldwell, existing mortgages often require assumption or refinancing under new ownership structures. Lenders in the Treasure Valley track M&A activity in this sector to understand how consolidation changes debt obligations and collateral values for properties mortgaged to independent operators.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Craft Beverage Brewery Winery Drinks × Mortgage Lending 19 QID bridges 285 edges 7,208 ext links 2026-07-17 20:15:22 UTC a8aa10dc58d67ff0
Craft Beverage Brewery Winery Drinks corridor ↗ Mortgage Lending corridor ↗ Mortgage Lending × Craft Beverage Brewery Winery Drinks ↗ boisestandard.org/standard ↗
Parent Corridors
Craft Beverage Brewery Winery Drinks × All Other Verticals