—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Beauty Salon ↔ relates to ↔ Mortgage Lending

17 Wikipedia bridge articles confirmed in both vertical ledgers. 252 deterministic cross-vertical edges. 6,494 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
252 Cross Edges
6,494 External Sources
292 Wikipedia Articles
19 🌲 Evergreen
161 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Beauty Salon
× Mortgage Lending
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
252
External Sources Harvested
6,494
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (17)
IdahoZoningReal estateFranchisingTreasure ValleyBoise, IdahoPlanning permissionPrivate equityEagle, IdahoBoise metropolitan areaNampa, IdahoAda County, IdahoCaldwell, IdahoKuna, IdahoCanyon County, IdahoMeridian, IdahoBoise River
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitancapitalwesternlocalhomeapproximatelyproductswestdevelopmentpropertyurbanbusinessprivateexpansiontreasurevalleymeridian
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:40:46 UTC
Content Hash
5afb799900251f6a
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in beauty_salon (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (25): "approximately", "around", "associated", "becoming", "boise", "capital", "distinct", "geographic", "idaho", "july", "national", "official", "organized", "population", "prior", "products", "sector", "separate", "small", "south".... | EXACT TITLE in beauty_salon: "Idaho". | EXACT TITLE in mortgage_lending: "Idaho".
approximatelyaroundassociatedbecomingboisecapitaldistinctgeographicidahojulynationalofficialorganizedpopulationpriorproductssectorseparatesmallsouthsuppliestechnologyuseswestwestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in beauty_salon (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (29): "building", "combine", "developed", "development", "different", "form", "growth", "land-use", "local", "particular", "permission", "places", "planning", "policy", "procedure", "property", "question", "regulations", "regulatory", "residential".... | EXACT TITLE in beauty_salon: "Zoning". | EXACT TITLE in mortgage_lending: "Zoning".
buildingcombinedevelopeddevelopmentdifferentformgrowthland-uselocalparticularpermissionplacesplanningpolicyprocedurepropertyquestionregulationsregulatoryresidentialrulesscalesetshapesinglesystemsurbanuseszoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
(e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
pment may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
R
Q684740 EXACT TITLE 1.000
QID OVERLAP: Q684740 in beauty_salon (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (19): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "law", "legal", "ownership", "personal", "private", "property", "public", "question", "real", "residential", "resources", "status". | EXACT TITLE in beauty_salon: "Real estate". | EXACT TITLE in mortgage_lending: "Real estate".
acquisitionbusinesscommercialdifferententityestategenerallawlegalownershippersonalprivatepropertypublicquestionrealresidentialresourcesstatus
lic. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S. state. History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes.
ats, jewelry, furniture, tools, and the rolling stock of a farm and farm animals. The term real estate includes any land and buildings under private ownership, public (state) ownership or commercial (business) ownership. The purpose or usage of the real estate in question may differ from its ownership status. The property may be for residential or commercial use, used by the state, government or the general public. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S.
History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes. Internet real estate as a concept began with the first appearance of real estate platforms on the World Wide Web (www) and occurred in 1999. Residential real estate Residential real estate may contain either a single-family or multifamily structure that is available for occupation or for non-business purposes. Residences can be classified by how they are connected to neighbouring residences and land. Different types of housing tenure can be used for the same physical type. For example, connected residences might be owned by a single entity and leased out, or owned separately with an agreement covering the relationship between units and common areas and concerns. According to the Congressional Research Service, in 2021, 65% of homes in the U.S.
Franchising
Q171947 EXACT TITLE 1.000
QID OVERLAP: Q171947 in beauty_salon (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (35): "another", "brand", "branded", "business", "capital", "chain", "conditions", "controlling", "corporate", "direct", "entity", "expansion", "fees", "financial", "growth", "individual", "investment", "large", "legal", "licenses".... | EXACT TITLE in beauty_salon: "Franchising".
anotherbrandbrandedbusinesscapitalchainconditionscontrollingcorporatedirectentityexpansionfeesfinancialgrowthindividualinvestmentlargelegallicenseslicensingmarketmodelobligationspracticeproceduresproductspropertyresearchrule+5
Franchising is a business practice where a company licenses its business model to another company. It can involve the franchisor licensing some or part of its knowhow, procedures, intellectual property and other rights to sell its branded products and services to a franchisee. In return, the franchisee pays certain fees and agrees to comply with certain obligations, typically set out in a franchise agreement. For the franchisor, use of a franchise system is an alternative business growth strategy, compared to expansion through corporate owned outlets or "chain stores". Adopting a franchise system is a business growth strategy that minimizes the franchisor's capital investment and liability risk. Franchising is rarely an equal partnership, especially in the typical arrangement where the franchisee is an individual, unincorporated partnership or small privately-held corporation, as this ensures the franchisor has substantial legal and/or economic advantages over the franchisee. The usual exception to this rule is when the prospective franchisee is also a powerful corporate entity controlling a highly lucrative location, and/or captive market. For example, a large sports stadium for which prospective franchisors must compete to exclude one another.
e is also a powerful corporate entity controlling a highly lucrative location, and/or captive market. For example, a large sports stadium for which prospective franchisors must compete to exclude one another.
History The boom in franchising did not take place until after World War II. Nevertheless, the rudiments of modern franchising date back to the Middle Ages when landowners made franchise-like agreements with tax collectors, who retained a percentage of the money they collected and turned the rest over. The practice ended around 1562, but spread into other endeavors. For example, in 17th-century England, franchisees were granted the right to sponsor markets and fairs or operate ferries. There was little growth in franchising, though, until the mid-19th century, when it appeared in the United States for the first time. One of the first successful American franchising operations was started by an enterprising druggist named John S. Pemberton. In 1886, he concocted a beverage comprising sugar, molasses, spices, and cocaine. Pemberton licensed selected people to bottle and sell the drink, which was an early version of what is now known as Coca-Cola. His was one of the earliest and most successful franchising operations in the United States. The Singer Company implemented a franchising plan in the 1850s to distribute its sewing machines. The operation failed, though, because the company did not earn much money even though the machines sold well. The dealers, who had exclusive rights to their territories, absorbed most of the profits because of deep discounts. Some failed to push Singer products, so competitors were able to outsell the company. Under the existing contract, Singer could neither withdraw rights granted to franchisees nor send in its own salaried representatives. So, the company started repurchasing the rights it had sold. The experiment proved to be a failure. That may have been one of the first times a franchisor failed, but it was by no means the last. Colonel Harland Sanders did not initially succeed in his early efforts at franchising KFC. Still, the Singer venture did not put an end to franchising. Other companies attempted franchising in one form or another after the Singer experience. For example, several decades later, General Motors established a somewhat successful franchising operation in order to raise capital. Perhaps the father of modern franchising, though, is Louis K. Liggett. In 1902, Liggett invited a group of druggists to join a "drug cooperative". As he explained to them, they could increase profits by paying less for their purchases, especially if they set up their own manufacturing company. His idea was to market private-label products. About 40 druggists pooled $4,000 of their own money and adopted the name Rexall. Sales soared, and Rexall became a franchisor. The chain's success set a pattern for other franchisors to follow. Although many business owners did affiliate with cooperative ventures of one type or another, there was little growth in franchising until the early 20th century, and in whatever form franchising existed, it looked nothing like what it is today. As the United States shifted from an agricultural to an industrial economy, manufacturers licensed individuals to sell automobiles, trucks, gasoline, beverages, and a variety of other products. The franchisees did little more than selling the products, though. The sharing of responsibility associated with contemporary franchising arrangement did not exist to a great extent. Consequently, franchising was not a growth industry in the United States. It was not until the 1960s and 1970s that people began to take a close look at the attractiveness of franchising. The concept intrigued people with entrepreneurial spirit.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in beauty_salon (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (11): "association", "boise", "historically", "idaho", "local", "metropolitan", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in beauty_salon: "Treasure Valley". | EXACT TITLE in mortgage_lending: "Treasure Valley".
associationboisehistoricallyidaholocalmetropolitanregionresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 EXACT TITLE 0.920
QID OVERLAP: Q35775 in beauty_salon (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (11): "annual", "boise", "capital", "home", "idaho", "locally", "metropolitan", "population", "technology", "treasure", "valley". | EXACT TITLE in beauty_salon: "Boise, Idaho".
annualboisecapitalhomeidaholocallymetropolitanpopulationtechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
Planning permission
Q7571373 QID OVERLAP 0.800
QID OVERLAP: Q7571373 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (24): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "employment", "expansion", "law", "local", "national", "obtain", "permission", "permit", "permits", "planning", "plans", "processes"....
approvalbuildingcannotcodecodescomplianceconstructiondevelopmentemploymentexpansionlawlocalnationalobtainpermissionpermitpermitsplanningplansprocessesregionalrequiredsubjecturban
Planning permission or building permit refers to the approval needed for construction or expansion (including significant renovation), and sometimes for demolition, in some jurisdictions. House building permits, for example, are subject to building codes. There is also a "plan check" (PLCK) to check compliance with plans for the area, if any. For example, one cannot obtain permission to build a nightclub in an area where it is inappropriate such as a high-density suburb. The criteria for planning permission are a part of urban planning and construction law, and are usually managed by town planners employed by local governments. Failure to obtain a permit can result in fines, penalties, and demolition of unauthorized construction if it cannot be made to meet code. Generally, the new construction must be inspected during construction and after completion to ensure compliance with national, regional, and local building codes. Since building permits usually precede outlays for construction, employment, financing and furnishings, they are often used as a leading indicator for development in other areas of the economy. The number of building permits issued per year varies by country.
oyment, financing and furnishings, they are often used as a leading indicator for development in other areas of the economy. The number of building permits issued per year varies by country. By-right approval processes can be faster than discretionary approval processes. In specific industries Broadcasting As part of broadcast law, the term is also used in broadcasting, where individual radio and television stations typically must apply for and receive permission to construct radio towers and radio antennas. This type of permit is issued by a national broadcasting authority, but does not imply zoning any other permission that must be given by local government. The permit itself also does not necessarily imply permission to operate the station once constructed. In the U.S., a construction permit is valid for three years. Afterwards, the station must receive a full license to operate, which is good for seven years. This is provided by a separate broadcast license, also called a "license to cover" by the Federal Communications Commission (FCC) in the United States. Further permission or registration for towers may be needed from aviation authorities. In the U.S., construction permits for new commercial stations are now assigned by auction, rather than the former process of determining who would serve the community of license best.
ized construction if it cannot be made to meet code. Generally, the new construction must be inspected during construction and after completion to ensure compliance with national, regional, and local building codes. Since building permits usually precede outlays for construction, employment, financing and furnishings, they are often used as a leading indicator for development in other areas of the economy. The number of building permits issued per year varies by country.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (25): "active", "business", "capital", "changes", "control", "described", "development", "equity", "expansion", "financial", "general", "investment", "long-term", "management", "operational", "otherwise", "ownership", "private", "product", "products"....
activebusinesscapitalchangescontroldescribeddevelopmentequityexpansionfinancialgeneralinvestmentlong-termmanagementoperationalotherwiseownershipprivateproductproductsprovidepublicratherspecializedspecific
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Eagle, Idaho
Q1516870 EXACT TITLE 0.780
QID OVERLAP: Q1516870 in beauty_salon (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (4): "boise", "eagle", "idaho", "population". | EXACT TITLE in mortgage_lending: "Eagle, Idaho".
boiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District. The portion in the Boise School District is zoned to: Shadow Hills Elementary School, Riverglen Middle School, and Capital High School. In popular culture The 2008 show The Baby Borrowers was filmed in Eagle.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Boise metropolitan area
Q4938481 QID OVERLAP 0.760
QID OVERLAP: Q4938481 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (13): "adds", "boise", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "percent", "population", "section", "treasure", "valley".
addsboisehomeidaholargermeridianmetropolitannampapercentpopulationsectiontreasurevalley
n, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
ally designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (12): "according", "boise", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "west", "western".
accordingboisecollegehomeidahomeaningmeridianmetropolitannampapopulationwestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in beauty_salon (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (10): "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private".
boisecapitaldistricthomeidahojurisdictionlocalmetropolitanpopulationprivate
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
QID OVERLAP 0.640
QID OVERLAP: Q1515177 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (7): "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
additionalboiseidahokunametropolitanpercentpopulation
metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020. History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (7): "among", "boise", "capital", "idaho", "making", "meridian", "population".
amongboisecapitalidahomakingmeridianpopulation
population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
Boise River
Q891080 QID OVERLAP 0.600
QID OVERLAP: Q891080 in beauty_salon (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (5): "approximately", "boise", "idaho", "urban", "western".
approximatelyboiseidahourbanwestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
235 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP235 edges
🌲 EVERGREEN2 edges
0.650
applicationapplicationscarecombinationcourseidentifyingitselfleastlicensedproductsprofessionalshapespecifictechniciantrainingtreatmentwhosework
SHARED TOKENS (18): "application", "applications", "care", "combination", "course", "identifying", "itself", "least", "licensed", "products", "professional", "shape", "specific", "technician", "training", "treatment", "whose", "work". | URL->A (1): https://www.cdc.gov/niosh/nail-technicians/about/index.html. | EXACT TITLE in beauty_salon: "Nail technician".
0.650
activityamongboisebusinesscollegedivisioneconomicseducationidahoindependentinstitutionprogramprogramspublicresearchschoolteamswest
SHARED TOKENS (18): "activity", "among", "boise", "business", "college", "division", "economics", "education", "idaho", "independent", "institution", "program", "programs", "public", "research", "school", "teams", "west". | URL->B (1): https://boisestate.edu/. | EXACT TITLE in mortgage_lending: "Boise State University".
🌿 BRANCH161 edges
0.500
actsapplicationscomplianceconsumercreditdevelopeddirectestatefeesindividualinstitutionsjurisdictionmarketsproductsrealregulatedregulationspecific
SHARED TOKENS (18): "acts", "applications", "compliance", "consumer", "credit", "developed", "direct", "estate", "fees", "individual", "institutions", "jurisdiction", "markets", "products", "real", "regulated", "regulation", "specific". | EXACT TITLE in mortgage_lending: "Mortgage broker".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherconstructioncreatehistoricallyleastmaterialmodernoccurplacingpotentialproviderequireresourcesselectedsitesourcesstructuresupplytable
SHARED TOKENS (22): "access", "another", "construction", "create", "historically", "least", "material", "modern", "occur", "placing", "potential", "provide", "require", "resources", "selected", "site", "sources", "structure", "supply", "table".... | EXACT TITLE in beauty_salon: "Well". | EXACT TITLE in mortgage_lending: "Well".
0.500
additionalbeyondcommercialcommunitiescommunitydecisionsfederalinstitutioninstitutionsinsurancelocallocallynationalofficesoperatedrequirements
SHARED TOKENS (16): "additional", "beyond", "commercial", "communities", "community", "decisions", "federal", "institution", "institutions", "insurance", "local", "locally", "national", "offices", "operated", "requirements". | EXACT TITLE in mortgage_lending: "Community bank".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbusinesscontactcreatecreatingdevelopeddirectexposureforminsidelatermaterialoperatespracticeprocessingrealrecordingstudentsusesvisible
SHARED TOKENS (20): "application", "business", "contact", "create", "creating", "developed", "direct", "exposure", "form", "inside", "later", "material", "operates", "practice", "processing", "real", "recording", "students", "uses", "visible". | EXACT TITLE in beauty_salon: "Photography".
0.500
actactivityadditionaladequateagainstamongannualauthoritybureaucollectioncommunitycomplianceconsumercreditdatadepartmentdirectenforcementestablishexamination
SHARED TOKENS (49): "act", "activity", "additional", "adequate", "against", "among", "annual", "authority", "bureau", "collection", "community", "compliance", "consumer", "credit", "data", "department", "direct", "enforcement", "establish", "examination".... | EXACT TITLE in mortgage_lending: "Home Mortgage Disclosure Act".
0.500
Accountant ↗ Q326653 EXACT TITLE
associationsfeesfinancialimpactindependentlyindustryinfluenceobligationspersonalpractitionerpractitionersprocessprofessionalprofessionalspublicqualityrequiressectorstatutestatutory
SHARED TOKENS (22): "associations", "fees", "financial", "impact", "independently", "industry", "influence", "obligations", "personal", "practitioner", "practitioners", "process", "professional", "professionals", "public", "quality", "requires", "sector", "statute", "statutory".... | EXACT TITLE in mortgage_lending: "Accountant".
0.500
alonebeyondbuildingcodecodesconditionscontroldemanddependdescribeddirectdirectlyexposurehazardimpactissuemaintainingmodernoperationoutside
SHARED TOKENS (38): "alone", "beyond", "building", "code", "codes", "conditions", "control", "demand", "depend", "described", "direct", "directly", "exposure", "hazard", "impact", "issue", "maintaining", "modern", "operation", "outside".... | EXACT TITLE in beauty_salon: "Ventilation (architecture)".
0.500
actagainstapplicantapplicantsappliesassistanceauthoritybusinesscapacitycommunityconsumercoursecreditdefinesdevelopmentdifferentfederalfinancialindividualinstitution
SHARED TOKENS (34): "act", "against", "applicant", "applicants", "applies", "assistance", "authority", "business", "capacity", "community", "consumer", "course", "credit", "defines", "development", "different", "federal", "financial", "individual", "institution".... | EXACT TITLE in mortgage_lending: "Equal Credit Opportunity Act".
0.500
centralchangescombinationconcentrationcoredevelopmentexpansionformsgrowthinformalmodelpatternspopulationprocesssouthsuburbansuburbanizationurban
SHARED TOKENS (18): "central", "changes", "combination", "concentration", "core", "development", "expansion", "forms", "growth", "informal", "model", "patterns", "population", "process", "south", "suburban", "suburbanization", "urban". | EXACT TITLE in beauty_salon: "Suburbanization". | EXACT TITLE in mortgage_lending: "Suburbanization".
0.500
addressassociatedcannotcarecommunityconditionsdisabilityfacilitieshomelong-termmedicalpractitionerspreparationprovidequalityrequiressafesenior
SHARED TOKENS (18): "address", "associated", "cannot", "care", "community", "conditions", "disability", "facilities", "home", "long-term", "medical", "practitioners", "preparation", "provide", "quality", "requires", "safe", "senior". | EXACT TITLE in beauty_salon: "Long-term care".
0.500
Fashion ↗ Q12684 EXACT TITLE
alongsideamongannualconsumersdescribesdifferentdistrictgeneralimpactindustryinfluenceissuemetropolitanparticipatepatternspricessalespecificstatusstudy
SHARED TOKENS (20): "alongside", "among", "annual", "consumers", "describes", "different", "district", "general", "impact", "industry", "influence", "issue", "metropolitan", "participate", "patterns", "prices", "sale", "specific", "status", "study". | EXACT TITLE in beauty_salon: "Fashion".
0.500
Skin care ↗ Q1294114 EXACT TITLE
accordingcareconditionsexposureindividualmaintainingmanagementmarketedpracticepracticesprocessproductsprofessionalsregulatedsupport
SHARED TOKENS (15): "according", "care", "conditions", "exposure", "individual", "maintaining", "management", "marketed", "practice", "practices", "process", "products", "professionals", "regulated", "support". | EXACT TITLE in beauty_salon: "Skin care".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmentendgrowthhourslocallossmarketsnumbersoutsideplacespotentialpracticesprogramsreal
SHARED TOKENS (22): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "end", "growth", "hours", "local", "loss", "markets", "numbers", "outside", "places", "potential", "practices", "programs", "real".... | EXACT TITLE in beauty_salon: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
acquiredannualapproximatelybusinesscomcomplaintsdirectoryestimatesformerinformationlatermobileoperatespracticepracticespublicpublishesratingsreviewreviews
SHARED TOKENS (25): "acquired", "annual", "approximately", "business", "com", "complaints", "directory", "estimates", "former", "information", "later", "mobile", "operates", "practice", "practices", "public", "publishes", "ratings", "review", "reviews".... | EXACT TITLE in beauty_salon: "Yelp".
0.500
determiningdocumentingestateframeworkinstrumentslawlegalotherwisepublicrealrecordrecordingregisterregistrationsystemsystemstitle
SHARED TOKENS (17): "determining", "documenting", "estate", "framework", "instruments", "law", "legal", "otherwise", "public", "real", "record", "recording", "register", "registration", "system", "systems", "title". | EXACT TITLE in beauty_salon: "Recording (real estate)". | EXACT TITLE in mortgage_lending: "Recording (real estate)".
0.500
collegecommunityeducationeducationalformsgeneralindividualinformalinstitutionknowledgenamesoccupationsproviderelatedschoolschoolsspecializedspecifictechnologytrade
SHARED TOKENS (22): "college", "community", "education", "educational", "forms", "general", "individual", "informal", "institution", "knowledge", "names", "occupations", "provide", "related", "school", "schools", "specialized", "specific", "technology", "trade".... | EXACT TITLE in beauty_salon: "Vocational education".
0.500
aroundcertificatescommercialconsumercorporatecreditfinancialinstitutioninstitutionsoperationspublicretailsharesmallsystems
SHARED TOKENS (15): "around", "certificates", "commercial", "consumer", "corporate", "credit", "financial", "institution", "institutions", "operations", "public", "retail", "share", "small", "systems". | EXACT TITLE in mortgage_lending: "Credit union".
0.500
alteranotherconditionsconsolidatedcorporatecreditdifferentexistingfeesfinancialformshomelongermanagementobligationspaymentpersonalprimaryreduceregulations
SHARED TOKENS (22): "alter", "another", "conditions", "consolidated", "corporate", "credit", "different", "existing", "fees", "financial", "forms", "home", "longer", "management", "obligations", "payment", "personal", "primary", "reduce", "regulations".... | EXACT TITLE in mortgage_lending: "Refinancing".
0.500
Disinfectant ↗ Q73984 EXACT TITLE
buildingconcentratedcontactdifferentformformshistoricallymedicalphysicalprocessreducesectorsimultaneouslytreatmentwork
SHARED TOKENS (15): "building", "concentrated", "contact", "different", "form", "forms", "historically", "medical", "physical", "process", "reduce", "sector", "simultaneously", "treatment", "work". | EXACT TITLE in beauty_salon: "Disinfectant".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
associationcannotcostsequityexistingfeefeesfuturelawlegalmakingoperationownerpaymentprocedureprocesspropertyrealresidentialsale
SHARED TOKENS (25): "association", "cannot", "costs", "equity", "existing", "fee", "fees", "future", "law", "legal", "making", "operation", "owner", "payment", "procedure", "process", "property", "real", "residential", "sale".... | EXACT TITLE in mortgage_lending: "Foreclosure".
0.500
actbecomingchaptercodecostsdisclosuresestatefeeslawpracticepracticesproceduresprocessproviderealreferralrequirestitle
SHARED TOKENS (18): "act", "becoming", "chapter", "code", "costs", "disclosures", "estate", "fees", "law", "practice", "practices", "procedures", "process", "provide", "real", "referral", "requires", "title". | EXACT TITLE in mortgage_lending: "Real Estate Settlement Procedures Act".
0.500
authorityestategoverningimprovementsjurisdictionnationalpropertyrealregionrentalrequiressystemtaxtransactionwhose
SHARED TOKENS (15): "authority", "estate", "governing", "improvements", "jurisdiction", "national", "property", "real", "region", "rental", "requires", "system", "tax", "transaction", "whose". | EXACT TITLE in mortgage_lending: "Property tax".
0.500
againstbusinesscommercialcostsestatefeefinancialformgeneralindependentinstitutionalinsuranceinsurerslargelawlegallossobtainoutsideowner
SHARED TOKENS (35): "against", "business", "commercial", "costs", "estate", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "insurers", "large", "law", "legal", "loss", "obtain", "outside", "owner".... | EXACT TITLE in mortgage_lending: "Title insurance".
0.500
agencybureauconditionscurrentdatadepartmenteconomicsfederallaborlocalmanagementprocessespublicqualityresearchresourcescheduledstatisticssubjectsystem
SHARED TOKENS (20): "agency", "bureau", "conditions", "current", "data", "department", "economics", "federal", "labor", "local", "management", "processes", "public", "quality", "research", "resource", "scheduled", "statistics", "subject", "system". | EXACT TITLE in beauty_salon: "Bureau of Labor Statistics".
0.500
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmentexpansionfeefeesgrowthimpactimprovementslocalpopulationprojectpublicreduce
SHARED TOKENS (15): "capital", "construction", "costs", "development", "expansion", "fee", "fees", "growth", "impact", "improvements", "local", "population", "project", "public", "reduce". | EXACT TITLE in mortgage_lending: "Impact fee".
0.500
againstapprovedassociationevaluationindependentnationalprimaryprovidequalityregionregionalrelevantsouthspecificstandardssubjectsystem
SHARED TOKENS (17): "against", "approved", "association", "evaluation", "independent", "national", "primary", "provide", "quality", "region", "regional", "relevant", "south", "specific", "standards", "subject", "system". | EXACT TITLE in beauty_salon: "Accreditation".
0.500
actactivityagencyauthorizedbureauconsumerconsumerscreditdataenforcementfederalfeesfinancialindependentindustryinstitutionsjunejurisdictionlawmechanism
SHARED TOKENS (35): "act", "activity", "agency", "authorized", "bureau", "consumer", "consumers", "credit", "data", "enforcement", "federal", "fees", "financial", "independent", "industry", "institutions", "june", "jurisdiction", "law", "mechanism".... | EXACT TITLE in mortgage_lending: "Consumer Financial Protection Bureau".
0.500
bookkeepingbooksbusinesscreatecreditdocumentdocumentseventsfinancialfunctionsgeneralindividualinformationoccuroperationsprocessrealrecordrecordedrecording
SHARED TOKENS (29): "bookkeeping", "books", "business", "create", "credit", "document", "documents", "events", "financial", "functions", "general", "individual", "information", "occur", "operations", "process", "real", "record", "recorded", "recording".... | EXACT TITLE in beauty_salon: "Bookkeeping". | EXACT TITLE in mortgage_lending: "Bookkeeping".
0.500
additionalaroundclosediscoveryfeefinancialfutureinstrumentlaterlossmarketmarketsmechanismotherwiseparticularpaymentphysicalportfoliopracticeprice
SHARED TOKENS (28): "additional", "around", "close", "discovery", "fee", "financial", "future", "instrument", "later", "loss", "market", "markets", "mechanism", "otherwise", "particular", "payment", "physical", "portfolio", "practice", "price".... | EXACT TITLE in mortgage_lending: "Short (finance)".
0.500
Freddie Mac ↗ Q935969 EXACT TITLE
actionagencyassociationdepartmentdescribedfederalfinancialhomeinvestmentjunemakingmanagementmarketmarketsnationalpricesprivateseniorsharesupply
SHARED TOKENS (20): "action", "agency", "association", "department", "described", "federal", "financial", "home", "investment", "june", "making", "management", "market", "markets", "national", "prices", "private", "senior", "share", "supply". | EXACT TITLE in mortgage_lending: "Freddie Mac".
0.500
businesscapacityclosecommercialfamilyhomeofficesoperateoperatedoperatesownerprohibitedregulationsresidentialsecuresmalltaxworkzoning
SHARED TOKENS (19): "business", "capacity", "close", "commercial", "family", "home", "offices", "operate", "operated", "operates", "owner", "prohibited", "regulations", "residential", "secure", "small", "tax", "work", "zoning". | EXACT TITLE in beauty_salon: "Home business".
0.500
Retail ↗ Q126793 EXACT TITLE
accessadvisoryaffectingalongsideanalysisbroaderbusinesschaincombineconsumerscorecostscreditdecisionsdeliverydescribeddirectlyeconomicallyexperiencehistory
SHARED TOKENS (53): "access", "advisory", "affecting", "alongside", "analysis", "broader", "business", "chain", "combine", "consumers", "core", "costs", "credit", "decisions", "delivery", "described", "directly", "economically", "experience", "history".... | EXACT TITLE in beauty_salon: "Retail". | EXACT TITLE in mortgage_lending: "Retail".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
buildingbusinesscapitalcommercialcreditdemanddescribeddevelopeddirectlyestateeventexistingfinancialformhomeinstitutioninvestmentlawlegalmarkets
SHARED TOKENS (32): "building", "business", "capital", "commercial", "credit", "demand", "described", "developed", "directly", "estate", "event", "existing", "financial", "form", "home", "institution", "investment", "law", "legal", "markets".... | EXACT TITLE in mortgage_lending: "Mortgage".
0.500
accordingactadministrationagencyamongapprovalbuildingcareclosecompensationcontroldepartmentdisabilitydistinctdivisionevaluationexposurefederalfunctionshazard
SHARED TOKENS (45): "according", "act", "administration", "agency", "among", "approval", "building", "care", "close", "compensation", "control", "department", "disability", "distinct", "division", "evaluation", "exposure", "federal", "functions", "hazard".... | EXACT TITLE in beauty_salon: "National Institute for Occupational Safety and Health".
0.500
additionalanotherbusinesscapitalcommercialconsumerconsumerscreditdirectlydiscoveryenterentityequityfederalfeefeesframeworkinstitutionslargelaw
SHARED TOKENS (40): "additional", "another", "business", "capital", "commercial", "consumer", "consumers", "credit", "directly", "discovery", "enter", "entity", "equity", "federal", "fee", "fees", "framework", "institutions", "large", "law".... | EXACT TITLE in mortgage_lending: "Mortgage bank".
0.500
actactscomparecompensationconnectedconnectionconsumerconsumerscreditdisclosuresfederalfeeslawmakingplanspracticesproceduresprohibitsregulatesregulation
SHARED TOKENS (23): "act", "acts", "compare", "compensation", "connected", "connection", "consumer", "consumers", "credit", "disclosures", "federal", "fees", "law", "making", "plans", "practices", "procedures", "prohibits", "regulates", "regulation".... | EXACT TITLE in mortgage_lending: "Truth in Lending Act".
0.500
businesscompensationconsumerconsumerscreatesformgeneralgrowthindividualinspectionslawleastlicenselicensedlicensinglicensuremarketoccupationaloccupationsparticular
SHARED TOKENS (39): "business", "compensation", "consumer", "consumers", "creates", "form", "general", "growth", "individual", "inspections", "law", "least", "license", "licensed", "licensing", "licensure", "market", "occupational", "occupations", "particular".... | EXACT TITLE in beauty_salon: "Occupational licensing".
0.500
accordingactadministrationannualauthorizationbusinesshomeindustrylargelicensemedicaloperateoperationspolicyprofessionalsprogramsregulatedregulatoryrequireretail
SHARED TOKENS (26): "according", "act", "administration", "annual", "authorization", "business", "home", "industry", "large", "license", "medical", "operate", "operations", "policy", "professionals", "programs", "regulated", "regulatory", "require", "retail".... | EXACT TITLE in beauty_salon: "Small business".
0.500
accordingadditionalcarecreatedutiesestimatesexposuregeneraljurisdictionlawoccupationalofficialpowersproductprogramspublicrelatedrequiredspecificstatute
SHARED TOKENS (21): "according", "additional", "care", "create", "duties", "estimates", "exposure", "general", "jurisdiction", "law", "occupational", "official", "powers", "product", "programs", "public", "related", "required", "specific", "statute".... | EXACT TITLE in beauty_salon: "Occupational safety and health".
0.500
Cosmetics ↗ Q131207 EXACT TITLE
alterapplicationapprovalaroundcarechangecommercialdifferentleadmarketedmodernpersonalproductsregulationsregulatoryrequiresourcesvisible
SHARED TOKENS (18): "alter", "application", "approval", "around", "care", "change", "commercial", "different", "lead", "marketed", "modern", "personal", "products", "regulations", "regulatory", "require", "sources", "visible". | EXACT TITLE in beauty_salon: "Cosmetics".
0.500
activitybusinesscontractorcontractualemployeremploymentevenindependentindividualissueoperateplacingprovisionratherrealself-employmenttaxthereforetradework
SHARED TOKENS (20): "activity", "business", "contractor", "contractual", "employer", "employment", "even", "independent", "individual", "issue", "operate", "placing", "provision", "rather", "real", "self-employment", "tax", "therefore", "trade", "work". | EXACT TITLE in beauty_salon: "Self-employment". | EXACT TITLE in mortgage_lending: "Self-employment".
0.500
academicboisecollegecommunitycreditdevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicstudentstreasurevalleywesternworkforce
SHARED TOKENS (20): "academic", "boise", "college", "community", "credit", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "students", "treasure", "valley", "western", "workforce". | EXACT TITLE in mortgage_lending: "College of Western Idaho".
0.500
Credit risk ↗ Q162714 EXACT TITLE
againstanotherassociatedbusinesscollectionconsumercostscreditfinancialgeneralinsurancelossmarketobligationspaymentpolicyprotectionreducerequiretrade
SHARED TOKENS (20): "against", "another", "associated", "business", "collection", "consumer", "costs", "credit", "financial", "general", "insurance", "loss", "market", "obligations", "payment", "policy", "protection", "reduce", "require", "trade". | EXACT TITLE in mortgage_lending: "Credit risk".
0.500
additionalagainstapprovedassociationassociationsauthorizationcreditfederalfinancialhistoryinformationissueoperationpaymentprocessorsreceivedsupplysystemtransactionverified
SHARED TOKENS (20): "additional", "against", "approved", "association", "associations", "authorization", "credit", "federal", "financial", "history", "information", "issue", "operation", "payment", "processors", "received", "supply", "system", "transaction", "verified". | EXACT TITLE in beauty_salon: "Payment processor".
0.500
accessadditionalapprovedbureauclaimsconsumerconsumersequityestatefinancialhomeindependentinsurancelegalmarketpatternspaymentproductspropertyprotection
SHARED TOKENS (24): "access", "additional", "approved", "bureau", "claims", "consumer", "consumers", "equity", "estate", "financial", "home", "independent", "insurance", "legal", "market", "patterns", "payment", "products", "property", "protection".... | EXACT TITLE in mortgage_lending: "Reverse mortgage".
0.500
Reddit ↗ Q1136 EXACT TITLE
accordingacquiredamongappearcommunitiescontentcreatecurrentdataindependentjulyjunelinksmarketmedianewsnicheoperatedorganizedpage
SHARED TOKENS (27): "according", "acquired", "among", "appear", "communities", "content", "create", "current", "data", "independent", "july", "june", "links", "market", "media", "news", "niche", "operated", "organized", "page".... | EXACT TITLE in mortgage_lending: "Reddit".
0.500
authoritybuildingbusinesscapitalcombinecommercialcontainingestatefunctionsinvestmentleastlocalmedicalofficespropertyrealregulationsrentalresidentialretail
SHARED TOKENS (23): "authority", "building", "business", "capital", "combine", "commercial", "containing", "estate", "functions", "investment", "least", "local", "medical", "offices", "property", "real", "regulations", "rental", "residential", "retail".... | EXACT TITLE in beauty_salon: "Commercial property".
0.480
aroundassociatedbuildingconstructiondevelopmentendfacilitiesindustryinfrastructurepercentplanningprocessproductswork
SHARED TOKENS (14): "around", "associated", "building", "construction", "development", "end", "facilities", "industry", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in beauty_salon: "Construction". | EXACT TITLE in mortgage_lending: "Construction".
0.480
Laundry ↗ Q852100 EXACT TITLE
buildingbusinesscarecommercialdifferenthistoryhomeindividualitselflateroutsideresidencesharedwork
SHARED TOKENS (14): "building", "business", "care", "commercial", "different", "history", "home", "individual", "itself", "later", "outside", "residence", "shared", "work". | EXACT TITLE in beauty_salon: "Laundry".
0.480
boundariesemployerlaborlicenseoutsidepotentialpracticepractitionersprofessionalregulatedstudysystemtradetraining
SHARED TOKENS (14): "boundaries", "employer", "labor", "license", "outside", "potential", "practice", "practitioners", "professional", "regulated", "study", "system", "trade", "training". | EXACT TITLE in beauty_salon: "Apprenticeship".
0.480
applicationcarecertificatehourslicensemakingmedianoccupationalprocessesrequiredschoolstudytreatmentwage
SHARED TOKENS (14): "application", "care", "certificate", "hours", "license", "making", "median", "occupational", "processes", "required", "school", "study", "treatment", "wage". | EXACT TITLE in beauty_salon: "Cosmetology".
0.480
associateddemandformshomeindexinformallocalmarketsmediannationalownershiprentalsetsupply
SHARED TOKENS (14): "associated", "demand", "forms", "home", "index", "informal", "local", "markets", "median", "national", "ownership", "rental", "set", "supply". | EXACT TITLE in mortgage_lending: "Affordable housing".
0.460
chaindocumentdocumentshistoricallawmaintainedownerownershippresentpropertyrecordsequencetitle
SHARED TOKENS (13): "chain", "document", "documents", "historical", "law", "maintained", "owner", "ownership", "present", "property", "record", "sequence", "title". | EXACT TITLE in mortgage_lending: "Chain of title".
0.440
Employment ↗ EXACT TITLE
annualconditionsdisabilityemployeremploymententityhourlyinsurancepaymentprovisionsectorwork
SHARED TOKENS (12): "annual", "conditions", "disability", "employer", "employment", "entity", "hourly", "insurance", "payment", "provision", "sector", "work". | EXACT TITLE in beauty_salon: "Employment". | EXACT TITLE in mortgage_lending: "Employment".
0.440
capacitycreatecreditevenlargermanagementmodelsparticularprocessprovidequalityuses
SHARED TOKENS (12): "capacity", "create", "credit", "even", "larger", "management", "models", "particular", "process", "provide", "quality", "uses". | EXACT TITLE in mortgage_lending: "Mortgage underwriting".
0.440
actsagainsteventsformshomeinsurancelosspolicypropertyprotectionrequirespecialized
SHARED TOKENS (12): "acts", "against", "events", "forms", "home", "insurance", "loss", "policy", "property", "protection", "require", "specialized". | EXACT TITLE in mortgage_lending: "Property insurance".
0.440
annualapproximatelybureaubusinessdocumentedemploymentlaboroccupationalofficesregionalstatisticswage
SHARED TOKENS (12): "annual", "approximately", "bureau", "business", "documented", "employment", "labor", "occupational", "offices", "regional", "statistics", "wage". | EXACT TITLE in beauty_salon: "Occupational Employment and Wage Statistics".
0.440
analysisbureauclassificationcorporatecreditfinanciallabormanagementmeanpotentialstatisticswage
SHARED TOKENS (12): "analysis", "bureau", "classification", "corporate", "credit", "financial", "labor", "management", "mean", "potential", "statistics", "wage". | EXACT TITLE in mortgage_lending: "Credit analyst".
0.440
Plumbing ↗ Q3241671 EXACT TITLE
amongapplicationsdeliverydevelopedinfrastructureleadpublicsystemsystemstradeuseswork
SHARED TOKENS (12): "among", "applications", "delivery", "developed", "infrastructure", "lead", "public", "system", "systems", "trade", "uses", "work". | EXACT TITLE in beauty_salon: "Plumbing".
0.440
Fannie Mae ↗ Q621096 EXACT TITLE
additionalassociationassociationsfederalfinancialhomelocalmakingmarketnationalprocessrankings
SHARED TOKENS (12): "additional", "association", "associations", "federal", "financial", "home", "local", "making", "market", "national", "process", "rankings". | EXACT TITLE in mortgage_lending: "Fannie Mae".
0.420
Oncology ↗ Q162555 EXACT TITLE
amongcaredescribedformmedicalpracticesprofessionalquestionsresearchstudytreatment
SHARED TOKENS (11): "among", "care", "described", "form", "medical", "practices", "professional", "questions", "research", "study", "treatment". | EXACT TITLE in beauty_salon: "Oncology".
0.400
Acetone ↗ Q49546 EXACT TITLE
buildinghomeindustrylargermedicalpresentprocessesproductssmallstatus
SHARED TOKENS (10): "building", "home", "industry", "larger", "medical", "present", "processes", "products", "small", "status". | EXACT TITLE in beauty_salon: "Acetone".
0.400
boisehomeidahooperationspopulationprimaryprovidesupporttrainingwestern
SHARED TOKENS (10): "boise", "home", "idaho", "operations", "population", "primary", "provide", "support", "training", "western". | EXACT TITLE in mortgage_lending: "Mountain Home Air Force Base".
0.400
acquisitionanalysisclassificationlawprocessprohibitedpropertysystemtaxzoning
SHARED TOKENS (10): "acquisition", "analysis", "classification", "law", "process", "prohibited", "property", "system", "tax", "zoning". | EXACT TITLE in mortgage_lending: "Amortization".
0.400
Dermatology ↗ Q171171 EXACT TITLE
beyondconditionslossmedicalphysicalpopulationrelatedrequiringschooltraining
SHARED TOKENS (10): "beyond", "conditions", "loss", "medical", "physical", "population", "related", "requiring", "school", "training". | EXACT TITLE in beauty_salon: "Dermatology".
0.400
Beauty ↗ Q7242 EXACT TITLE
connectiondescribedintegratedpropertyrathersidestandardsstudysubjecttoward
SHARED TOKENS (10): "connection", "described", "integrated", "property", "rather", "side", "standards", "study", "subject", "toward". | EXACT TITLE in beauty_salon: "Beauty".
0.380
Escrow ↗ Q338451 EXACT TITLE
accountconditionscontractualinsurancemeaningobligationsprimarypropertytransaction
SHARED TOKENS (9): "account", "conditions", "contractual", "insurance", "meaning", "obligations", "primary", "property", "transaction". | EXACT TITLE in mortgage_lending: "Escrow".
0.380
Manicure ↗ Q747493 EXACT TITLE
applicationedgehomelicensedregulationssmallthereforetogethertreatment
SHARED TOKENS (9): "application", "edge", "home", "licensed", "regulations", "small", "therefore", "together", "treatment". | EXACT TITLE in beauty_salon: "Manicure".
0.380
applicationsapprovalcommercialcreditevaluatefinancialinstitutionslicensedrelated
SHARED TOKENS (9): "applications", "approval", "commercial", "credit", "evaluate", "financial", "institutions", "licensed", "related". | EXACT TITLE in mortgage_lending: "Loan officer".
0.380
Easement ↗ Q448405 EXACT TITLE
accessamonganotherenteritselflawpropertypublicreal
SHARED TOKENS (9): "access", "among", "another", "enter", "itself", "law", "property", "public", "real". | EXACT TITLE in mortgage_lending: "Easement".
0.380
anotherconditionsdocumentfinancialinstrumentlegalpaymentspecifiedsubject
SHARED TOKENS (9): "another", "conditions", "document", "financial", "instrument", "legal", "payment", "specified", "subject". | EXACT TITLE in mortgage_lending: "Promissory note".
0.380
Lien ↗ Q4469383 EXACT TITLE
applicationformformsmeaningownerpaymentpropertysecurespecific
SHARED TOKENS (9): "application", "form", "forms", "meaning", "owner", "payment", "property", "secure", "specific". | EXACT TITLE in beauty_salon: "Lien". | EXACT TITLE in mortgage_lending: "Lien".
0.380
alterchangecreatehomeindependentlypracticeprocessessalesspecific
SHARED TOKENS (9): "alter", "change", "create", "home", "independently", "practice", "processes", "sales", "specific". | EXACT TITLE in beauty_salon: "Hair coloring".
0.360
differentformsgrowthleastmeaningmedicalprocessvisible
SHARED TOKENS (8): "different", "forms", "growth", "least", "meaning", "medical", "process", "visible". | EXACT TITLE in beauty_salon: "Hair removal".
0.360
distinctformspresentprocessratherreducespecificvolume
SHARED TOKENS (8): "distinct", "forms", "present", "process", "rather", "reduce", "specific", "volume". | EXACT TITLE in beauty_salon: "Sterilization (microbiology)".
0.360
codefederalhomelawleastmobileregulatedregulations
SHARED TOKENS (8): "code", "federal", "home", "law", "least", "mobile", "regulated", "regulations". | EXACT TITLE in mortgage_lending: "Manufactured housing".
0.360
Facial ↗ Q2667974 EXACT TITLE
conditionsfamilygeneralinvolvingphysicalprocedurespecifictreatment
SHARED TOKENS (8): "conditions", "family", "general", "involving", "physical", "procedure", "specific", "treatment". | EXACT TITLE in beauty_salon: "Facial".
0.360
Shampoo ↗ Q180204 EXACT TITLE
actscarecombiningconditionsformmarketedproductseparate
SHARED TOKENS (8): "acts", "care", "combining", "conditions", "form", "marketed", "product", "separate". | EXACT TITLE in beauty_salon: "Shampoo".
0.360
Hair loss ↗ Q181391 EXACT TITLE
combinationeventexperienceleastlosspresentsmalltreatment
SHARED TOKENS (8): "combination", "event", "experience", "least", "loss", "present", "small", "treatment". | EXACT TITLE in beauty_salon: "Hair loss".
0.360
alongsidecapitalcentraleventfederalfutureinvestmentpolicy
SHARED TOKENS (8): "alongside", "capital", "central", "event", "federal", "future", "investment", "policy". | EXACT TITLE in mortgage_lending: "Interest rate".
0.340
Trust deed ↗ Q7848150 EXACT TITLE
estategeneralinstrumentlawlegalrealsystems
SHARED TOKENS (7): "estate", "general", "instrument", "law", "legal", "real", "systems". | EXACT TITLE in mortgage_lending: "Trust deed".
0.340
Zillow ↗ Q8071921 EXACT TITLE
comcurrentestateformerrealreal-estatetechnology
SHARED TOKENS (7): "com", "current", "estate", "former", "real", "real-estate", "technology". | EXACT TITLE in mortgage_lending: "Zillow".
0.340
Balayage ↗ Q4850161 EXACT TITLE
boundarydisciplinemodernoperatoroutsidepotentialprocedure
SHARED TOKENS (7): "boundary", "discipline", "modern", "operator", "outside", "potential", "procedure". | EXACT TITLE in beauty_salon: "Balayage".
0.340
costsestatefeespropertyrealtitletransaction
SHARED TOKENS (7): "costs", "estate", "fees", "property", "real", "title", "transaction". | EXACT TITLE in mortgage_lending: "Closing costs".
0.320
Day spa ↗ Q11290050 EXACT TITLE
accordingassociationbusinesscareitselfpersonal
SHARED TOKENS (6): "according", "association", "business", "care", "itself", "personal". | EXACT TITLE in beauty_salon: "Day spa".
0.320
Barber ↗ Q107198 EXACT TITLE
developmentleastplacespublicwhosework
SHARED TOKENS (6): "development", "least", "places", "public", "whose", "work". | EXACT TITLE in beauty_salon: "Barber".
0.320
Electrician ↗ Q165029 EXACT TITLE
dataexistinginfrastructuremobileplatformsrelated
SHARED TOKENS (6): "data", "existing", "infrastructure", "mobile", "platforms", "related". | EXACT TITLE in beauty_salon: "Electrician".
0.320
differentlawlegalphysicalsourcesystems
SHARED TOKENS (6): "different", "law", "legal", "physical", "source", "systems". | EXACT TITLE in mortgage_lending: "Water right".
0.320
divisionfinanciallossprocessreducesale
SHARED TOKENS (6): "division", "financial", "loss", "process", "reduce", "sale". | EXACT TITLE in mortgage_lending: "Loss mitigation".
0.300
administrationaffectingaloneamongassociationcreditestateevenfederalhistoryhomeimpactindexinstitutionallargelargermarketmarketsnationalpotential
SHARED TOKENS (34): "administration", "affecting", "alone", "among", "association", "credit", "estate", "even", "federal", "history", "home", "impact", "index", "institutional", "large", "larger", "market", "markets", "national", "potential"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbuildingcommercialcorecostsdescribeddevelopmentexistingexpansionformgeographicgrowthinfrastructurelargelossmaintainingmodernplanningpopulation
SHARED TOKENS (32): "agency", "associated", "building", "commercial", "core", "costs", "described", "development", "existing", "expansion", "form", "geographic", "growth", "infrastructure", "large", "loss", "maintaining", "modern", "planning", "population"....
0.300
accordingagainstcommunitydirectdistrictestatefinancialgeographicidentifiedprojectpublicratherrealreceivedspecifictax
SHARED TOKENS (16): "according", "against", "community", "direct", "district", "estate", "financial", "geographic", "identified", "project", "public", "rather", "real", "received", "specific", "tax".
0.300
commercialentityestateinvestmentlawpropertyprotectionprovisionsratherrealresidentialstructuresubjecttaxunderlying
SHARED TOKENS (15): "commercial", "entity", "estate", "investment", "law", "property", "protection", "provisions", "rather", "real", "residential", "structure", "subject", "tax", "underlying".
0.300
accordingactsamongassociatedbookschangedcommercialdifferentestatefinancialgeneralindividualinstrumentinvestmentlargelongermakingmarketobligationspayment
SHARED TOKENS (32): "according", "acts", "among", "associated", "books", "changed", "commercial", "different", "estate", "financial", "general", "individual", "instrument", "investment", "large", "longer", "making", "market", "obligations", "payment"....
0.300
accordingactivityadditionalapproximatelychangeclosecollectioncommercialdevelopeddifferentexistinginvolvingitselflargeleastmanagementmaterialmaterialsmunicipalpractice
SHARED TOKENS (35): "according", "activity", "additional", "approximately", "change", "close", "collection", "commercial", "developed", "different", "existing", "involving", "itself", "large", "least", "management", "material", "materials", "municipal", "practice"....
0.300
Bleach ↗ Q11587 KW CROSS HIGH
activeconditionscontactcontainingcontrolmakingmaterialsnicheplacesprocessprocessesproductproductsrequireduseswork
SHARED TOKENS (16): "active", "conditions", "contact", "containing", "control", "making", "materials", "niche", "places", "process", "processes", "product", "products", "required", "uses", "work".
0.300
accordingamongchangechangedchangescreditdirectdistinctfederalformsindexlegallylinklowmarketmarketsobtainoutsidepaymentplaces
SHARED TOKENS (29): "according", "among", "change", "changed", "changes", "credit", "direct", "distinct", "federal", "forms", "index", "legally", "link", "low", "market", "markets", "obtain", "outside", "payment", "places"....
0.300
accessactadministrationagainstagencycarecommunitiesconstructioncreditdepartmentdevelopmentdifferentfacilitiesfederalinsurancelowmarketnationalownerprivate
SHARED TOKENS (24): "access", "act", "administration", "against", "agency", "care", "communities", "construction", "credit", "department", "development", "different", "facilities", "federal", "insurance", "low", "market", "national", "owner", "private"....
0.300
Groundwater ↗ Q161598 KW CROSS HIGH
capacitycentralchangeforminfluencelosslowmunicipaloperatingpercentpresentprimaryprocessprovidepublicrelysolelysourcesourcesstudy
SHARED TOKENS (26): "capacity", "central", "change", "form", "influence", "loss", "low", "municipal", "operating", "percent", "present", "primary", "process", "provide", "public", "rely", "solely", "source", "sources", "study"....
0.300
accessadditionalapplicationassociatedconventionalcostscreditequityestateevaluationeventfeegeneralhomepermitprimaryprocessingpropertyrealrelated
SHARED TOKENS (28): "access", "additional", "application", "associated", "conventional", "costs", "credit", "equity", "estate", "evaluation", "event", "fee", "general", "home", "permit", "primary", "processing", "property", "real", "related"....
0.300
applicationassistanceawardedcostscoveringeducationeducationalfederalfinancialinstitutioninstitutionsmanagementprivateprocessstudents
SHARED TOKENS (15): "application", "assistance", "awarded", "costs", "covering", "education", "educational", "federal", "financial", "institution", "institutions", "management", "private", "process", "students".
0.300
activityadministrationanotherchangescontroldecisionsdivisioneducationenforcementgoverninginfluenceitselflawlegalmodelpublicregulationsreviewrulessector
SHARED TOKENS (24): "activity", "administration", "another", "changes", "control", "decisions", "division", "education", "enforcement", "governing", "influence", "itself", "law", "legal", "model", "public", "regulations", "review", "rules", "sector"....
0.300
availabilityconsumerconsumersfeegeneralinformationoperatorparticularprimaryprocessproductproductsprovidersregisterretailsinglesitespecificwebsites
SHARED TOKENS (19): "availability", "consumer", "consumers", "fee", "general", "information", "operator", "particular", "primary", "process", "product", "products", "providers", "register", "retail", "single", "site", "specific", "websites".
0.300
Federal Reserve ↗ Q53536 KW CROSS HIGH
accountactactivityadvisoryamongannualapprovedapproximatelycapitalcentralcommercialcommitteecontroldecisionsdepartmentdutiesemploymententityeventsexpansion
SHARED TOKENS (45): "account", "act", "activity", "advisory", "among", "annual", "approved", "approximately", "capital", "central", "commercial", "committee", "control", "decisions", "department", "duties", "employment", "entity", "events", "expansion"....
0.300
administrationcommercialdepartmentestatefederalfeefeesinstrumentsinsuranceprivateprocessrealreportingrequiredrequirementsresidentialsourcesspecifiedtax
SHARED TOKENS (19): "administration", "commercial", "department", "estate", "federal", "fee", "fees", "instruments", "insurance", "private", "process", "real", "reporting", "required", "requirements", "residential", "sources", "specified", "tax".
0.300
actaroundcapitalcentralcommercialconsumercreatecreditdemanddepartmentdevelopmentestateestimatesexistingfederalfinancialgrowthhistoryhomeimpact
SHARED TOKENS (42): "act", "around", "capital", "central", "commercial", "consumer", "create", "credit", "demand", "department", "development", "estate", "estimates", "existing", "federal", "financial", "growth", "history", "home", "impact"....
0.300
actadministrationagainstauthoritybureaubusinesschangescollectioncomplianceconsumerconsumerscostscreditdataendfederalfinancialgrowthinstitutionsjuly
SHARED TOKENS (33): "act", "administration", "against", "authority", "bureau", "business", "changes", "collection", "compliance", "consumer", "consumers", "costs", "credit", "data", "end", "federal", "financial", "growth", "institutions", "july"....
0.300
availabilitycentralcombinationcreditdescribedestatefuturelocallossmarketmarketsnationalpolicypricepricespropertypublicrealregional
SHARED TOKENS (19): "availability", "central", "combination", "credit", "described", "estate", "future", "local", "loss", "market", "markets", "national", "policy", "price", "prices", "property", "public", "real", "regional".
0.300
accessanotherapplicationapprovedassociatedcapitalchangesclassificationdescribeddevelopmentdifferentdirectfamilyformformsgeographichomeindividuallargelegal
SHARED TOKENS (25): "access", "another", "application", "approved", "associated", "capital", "changes", "classification", "described", "development", "different", "direct", "family", "form", "forms", "geographic", "home", "individual", "large", "legal"....
0.300
againstconsumercreditdirectlyeducationequityfinancialhomeimprovementsindustryinvestmentitselfmedicalproductspropertyrequirerequirementsuses
SHARED TOKENS (18): "against", "consumer", "credit", "directly", "education", "equity", "financial", "home", "improvements", "industry", "investment", "itself", "medical", "products", "property", "require", "requirements", "uses".
0.300
actapplicableassociationauthoritycentralchangechangescommunitiescommunitycomparableconditionscostscreatingdependdevelopmentendexposurefacilitiesfutureland-use
SHARED TOKENS (35): "act", "applicable", "association", "authority", "central", "change", "changes", "communities", "community", "comparable", "conditions", "costs", "creating", "depend", "development", "end", "exposure", "facilities", "future", "land-use"....
0.300
accessaddressaddressingamongcapacitychangescommunitydevelopmenteducationequityformformshistoricallyhistoryhomeindustryinformalleastneighborhoodnetwork
SHARED TOKENS (38): "access", "address", "addressing", "among", "capacity", "changes", "community", "development", "education", "equity", "form", "forms", "historically", "history", "home", "industry", "informal", "least", "neighborhood", "network"....
0.300
analysisconnectionconsumerconsumerscontactdatadedicateddifferentdirectgrowthinformationmanagementmarketmaterialsmediaoperationspatternspotentialpresentprocedures
SHARED TOKENS (25): "analysis", "connection", "consumer", "consumers", "contact", "data", "dedicated", "different", "direct", "growth", "information", "management", "market", "materials", "media", "operations", "patterns", "potential", "present", "procedures"....
0.300
actbureaucollectionconsumerconsumerscreditdataendfederalfinancialinformationprivateprotectionregulatesreportingreportstrade
SHARED TOKENS (17): "act", "bureau", "collection", "consumer", "consumers", "credit", "data", "end", "federal", "financial", "information", "private", "protection", "regulates", "reporting", "reports", "trade".
0.300
applicationapprovalchapterclaimscodeconsolidationcreditfinancialformgeneralgoverningindividualpersonalplansplatformpropertyprotectionproviderequirementssection
SHARED TOKENS (24): "application", "approval", "chapter", "claims", "code", "consolidation", "credit", "financial", "form", "general", "governing", "individual", "personal", "plans", "platform", "property", "protection", "provide", "requirements", "section"....
0.300
assistancebroaderbusinesscannotcarecommunityexpansionfacilitiesfederalfragmentedgeographichomeindependentlyindustryinformationmedicalmodeloutsidepersonalpopulation
SHARED TOKENS (37): "assistance", "broader", "business", "cannot", "care", "community", "expansion", "facilities", "federal", "fragmented", "geographic", "home", "independently", "industry", "information", "medical", "model", "outside", "personal", "population"....
0.300
academicbroaderdirectlydisciplineeducationeducationalenterinstitutionoccupationsparticularpreparationprofessionalprovideratherrequiredschoolschoolsspecificstudentstoward
SHARED TOKENS (23): "academic", "broader", "directly", "discipline", "education", "educational", "enter", "institution", "occupations", "particular", "preparation", "professional", "provide", "rather", "required", "school", "schools", "specific", "students", "toward"....
0.300
applicationscentraldemonstratingformformslatermedicalmodernpotentialpreparationprocessprocessesproductssharesystem
SHARED TOKENS (15): "applications", "central", "demonstrating", "form", "forms", "later", "medical", "modern", "potential", "preparation", "process", "processes", "products", "share", "system".
0.300
accountapplicationappliescreditdifferentfinancialhomeindustrymarketmarketsnetworkplanningpolicyprocessprocessesresearchspecializedspecific
SHARED TOKENS (18): "account", "application", "applies", "credit", "different", "financial", "home", "industry", "market", "markets", "network", "planning", "policy", "process", "processes", "research", "specialized", "specific".
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
accordingacquiredadditionalapplicationaroundassistanceconditionsconsumerdatadedicateddevelopedendlocalmobileplanningplatformprogrampublicreporttherefore
SHARED TOKENS (21): "according", "acquired", "additional", "application", "around", "assistance", "conditions", "consumer", "data", "dedicated", "developed", "end", "local", "mobile", "planning", "platform", "program", "public", "report", "therefore"....
0.300
accordingaccountactagainstagencycapitalcommercialconditionsconsumerconsumerscreditfederalfinancialfunctionsinstitutionsinsuranceissueownershipplacesprimary
SHARED TOKENS (28): "according", "account", "act", "against", "agency", "capital", "commercial", "conditions", "consumer", "consumers", "credit", "federal", "financial", "functions", "institutions", "insurance", "issue", "ownership", "places", "primary"....
0.300
acquisitionactactivityanotherbusinesscapitalcentralcombineconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteconomicallyentityequityfederal
SHARED TOKENS (41): "acquisition", "act", "activity", "another", "business", "capital", "central", "combine", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "economically", "entity", "equity", "federal"....
0.300
actagainstagencyamongauthoritycombinationcombiningcommercialfederalfinancialforminstitutioninsuranceinvestmentlargelaterlawmarketpdfprohibited
SHARED TOKENS (22): "act", "against", "agency", "among", "authority", "combination", "combining", "commercial", "federal", "financial", "form", "institution", "insurance", "investment", "large", "later", "law", "market", "pdf", "prohibited"....
0.300
actanalysisanotherapplicationauthoritycannotchangecreatedatadecisionsdescribesdifferententerevenexistingformsgeneralhealthcarehistoricalidentified
SHARED TOKENS (42): "act", "analysis", "another", "application", "authority", "cannot", "change", "create", "data", "decisions", "describes", "different", "enter", "even", "existing", "forms", "general", "healthcare", "historical", "identified"....
0.300
communitiescomplaintsconnectedcontroldatafeesindividualinfluencemanagementmarketsnetworkspotentialproductproductsrelatedreviewsystemswebsites
SHARED TOKENS (18): "communities", "complaints", "connected", "control", "data", "fees", "individual", "influence", "management", "markets", "networks", "potential", "product", "products", "related", "review", "systems", "websites".
0.300
agencyanothercollectioncommercialdifferentestateinstrumentinvestmentissuemarketobligationspaymentratherrealremainsresidentialseparatesetsinglespecific
SHARED TOKENS (26): "agency", "another", "collection", "commercial", "different", "estate", "instrument", "investment", "issue", "market", "obligations", "payment", "rather", "real", "remains", "residential", "separate", "set", "single", "specific"....
0.300
againstcommercialcurrentdescribingendestatelargelongermarketmeanownerparticularpaymentpropertyprovisionsrealresidentialresourcesscheduleuses
SHARED TOKENS (20): "against", "commercial", "current", "describing", "end", "estate", "large", "longer", "market", "mean", "owner", "particular", "payment", "property", "provisions", "real", "residential", "resources", "schedule", "uses".
0.300
affectinganalysisapplicationbusinesschangesdemandeconomicsestateindustrymarketspatternsrealrelatedresearchresidentialscopesupplyurban
SHARED TOKENS (18): "affecting", "analysis", "application", "business", "changes", "demand", "economics", "estate", "industry", "markets", "patterns", "real", "related", "research", "residential", "scope", "supply", "urban".
0.300
assistancebusinesscommunitiescommunitydevelopmentdistrictimpactindependentlocalnationalneighborhoodnetworkprofessionalprogramresearchresidentservingsuburbansupporttraining
SHARED TOKENS (21): "assistance", "business", "communities", "community", "development", "district", "impact", "independent", "local", "national", "neighborhood", "network", "professional", "program", "research", "resident", "serving", "suburban", "support", "training"....
0.300
Waxing ↗ Q269107 EXACT TITLE
coveringdifferentformgrowthprocess
SHARED TOKENS (5): "covering", "different", "form", "growth", "process". | EXACT TITLE in beauty_salon: "Waxing".
0.300
VA loan ↗ Q7906577 KW CROSS HIGH
additionalapplicationapprovedconstructioncreditdepartmentdirectlyfeehomeimprovementsinsurancelargerlowpaymentpercentpriceprivateprogrampropertyreceived
SHARED TOKENS (27): "additional", "application", "approved", "construction", "credit", "department", "directly", "fee", "home", "improvements", "insurance", "larger", "low", "payment", "percent", "price", "private", "program", "property", "received"....
0.300
acquisitionagainstavailabilityclaimsconsumerfeesformerinstitutionsinsurerslargelawlegalnationalprocedurespropertypublicreceivedrecordrequiresale
SHARED TOKENS (24): "acquisition", "against", "availability", "claims", "consumer", "fees", "former", "institutions", "insurers", "large", "law", "legal", "national", "procedures", "property", "public", "received", "record", "require", "sale"....
0.300
administrationagencyassistancecompensationcostsdepartmentdisabilityeducationfacilitiesfamilyfederalfuturehealthcarehomeinsurancejuneleadlong-termmedicalnational
SHARED TOKENS (22): "administration", "agency", "assistance", "compensation", "costs", "department", "disability", "education", "facilities", "family", "federal", "future", "healthcare", "home", "insurance", "june", "lead", "long-term", "medical", "national"....
0.300
agencybuildingclassificationcombinationcommercialconstructiondevelopmentexistingfunctionsinstitutionalintegratedmixed-useneighborhoodplanningpolicyprivateresidentialsinglesiteurban
SHARED TOKENS (22): "agency", "building", "classification", "combination", "commercial", "construction", "development", "existing", "functions", "institutional", "integrated", "mixed-use", "neighborhood", "planning", "policy", "private", "residential", "single", "site", "urban"....
0.300
alonebusinessentityentrepreneurshipindividualleastlegallegallyownerprocessresidenceseparatespecificsubjecttradework
SHARED TOKENS (16): "alone", "business", "entity", "entrepreneurship", "individual", "least", "legal", "legally", "owner", "process", "residence", "separate", "specific", "subject", "trade", "work".
0.300
arounddistinguishformsprocessset
SHARED TOKENS (5): "around", "distinguish", "forms", "process", "set". | EXACT TITLE in beauty_salon: "Perm (hairstyle)". | EXACT TITLE in mortgage_lending: "Perm (hairstyle)".
0.300
administrationagencyauthoritydepartmentdevelopmentfederalhomeindependentinsurancelegalpowersregulatesregulatoryseparatestructuresystemurban
SHARED TOKENS (17): "administration", "agency", "authority", "department", "development", "federal", "home", "independent", "insurance", "legal", "powers", "regulates", "regulatory", "separate", "structure", "system", "urban".
0.300
actactsapplicableappliescodedevelopmentdifferentenforcementfamilyfederallawnationalorganizedparticipateprivateprogramsprohibitedprovisionprovisionsrental
SHARED TOKENS (25): "act", "acts", "applicable", "applies", "code", "development", "different", "enforcement", "family", "federal", "law", "national", "organized", "participate", "private", "programs", "prohibited", "provision", "provisions", "rental"....
0.300
actagainstbusinesschangescostsdisabilityidentityjulylaterlawnationalprohibitsprotectionprovidepublicrequirementsrequires
SHARED TOKENS (17): "act", "against", "business", "changes", "costs", "disability", "identity", "july", "later", "law", "national", "prohibits", "protection", "provide", "public", "requirements", "requires".
0.300
aloneanalysisannualaroundbuildingcollectioncontrolestimatesexposureformhazardinfluenceinsidemaintainingphysicalprimaryqualityschoolssourcestructures
SHARED TOKENS (22): "alone", "analysis", "annual", "around", "building", "collection", "control", "estimates", "exposure", "form", "hazard", "influence", "inside", "maintaining", "physical", "primary", "quality", "schools", "source", "structures"....
0.300
academicappliesauthoritybrandbroadercontentinformationinfrastructurenewspracticeproductsqualityrankingsratherwebsites
SHARED TOKENS (15): "academic", "applies", "authority", "brand", "broader", "content", "information", "infrastructure", "news", "practice", "products", "quality", "rankings", "rather", "websites".
0.300
buildingconditionscontainingcreatesevenhazardmaterialsphysicalpropertypublicregulationsspecificsubjectsystemteams
SHARED TOKENS (15): "building", "conditions", "containing", "creates", "even", "hazard", "materials", "physical", "property", "public", "regulations", "specific", "subject", "system", "teams".
0.300
accountadministrationagencycentralcommercialcommunitycreditdevelopmentfederalindependentinstitutionsinsurancenationaloperatesoperatingoperationsprovideshare
SHARED TOKENS (18): "account", "administration", "agency", "central", "commercial", "community", "credit", "development", "federal", "independent", "institutions", "insurance", "national", "operates", "operating", "operations", "provide", "share".
0.300
academicamongcareconnectscontroldeliverydepartmentdisciplinehealthcareinfrastructurelocalmedicalparticularpracticalpracticeprotectionpublicpublishesratherrelated
SHARED TOKENS (22): "academic", "among", "care", "connects", "control", "delivery", "department", "discipline", "healthcare", "infrastructure", "local", "medical", "particular", "practical", "practice", "protection", "public", "publishes", "rather", "related"....
0.300
Financial literacy ↗ KW CROSS HIGH
authoritycannotcostsdecisionsdevelopmenteducationfinancialfutureindividualinformationknowledgenationalpersonalprogramsprojectprovideresearchstandardssystemtraining
SHARED TOKENS (20): "authority", "cannot", "costs", "decisions", "development", "education", "financial", "future", "individual", "information", "knowledge", "national", "personal", "programs", "project", "provide", "research", "standards", "system", "training".
0.300
Home equity loan ↗ KW CROSS HIGH
againstcannotcollegecreatescrediteducationendequityhistoryhomeinstitutionlawlongerlowmedicalpaymentpersonalpropertyrequirespecific
SHARED TOKENS (21): "against", "cannot", "college", "creates", "credit", "education", "end", "equity", "history", "home", "institution", "law", "longer", "low", "medical", "payment", "personal", "property", "require", "specific"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
businesschaincollectioncommercialdataindustryinventorymanagementmobileplatformsprocessingproductsretailsupplysystemstransaction
SHARED TOKENS (16): "business", "chain", "collection", "commercial", "data", "industry", "inventory", "management", "mobile", "platforms", "processing", "products", "retail", "supply", "systems", "transaction".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
approvedauthoritybuildingcodecodescomplianceconstructioncontroldistrictestategeneralinsurancejurisdictionlawlocalmaterialsmodelnationalobtainoccupancy
SHARED TOKENS (36): "approved", "authority", "building", "code", "codes", "compliance", "construction", "control", "district", "estate", "general", "insurance", "jurisdiction", "law", "local", "materials", "model", "national", "obtain", "occupancy"....
0.300
Nursing home ↗ Q837142 KW CROSS HIGH
accordingassociationcaredifferentfacilitieshomehoursinstitutionsinsurancelong-termmedicaloccupationalphysicalprivateprovidepublicrequireresidentialsenior
SHARED TOKENS (19): "according", "association", "care", "different", "facilities", "home", "hours", "institutions", "insurance", "long-term", "medical", "occupational", "physical", "private", "provide", "public", "require", "residential", "senior".
0.300
Pollution ↗ Q58734 KW CROSS HIGH
alongsideapproximatelyaroundboundariescommunitiesconcentratedconstructioncoredevelopmenteventsformformshistoricallyimpactlaterlocalmanagementnationalpolicyprogram
SHARED TOKENS (31): "alongside", "approximately", "around", "boundaries", "communities", "concentrated", "construction", "core", "development", "events", "form", "forms", "historically", "impact", "later", "local", "management", "national", "policy", "program"....
0.300
administrationassociationcostscreditdepartmentdevelopmentevenfederalfinancialhomenationalpaymentpublicunderlyingurban
SHARED TOKENS (15): "administration", "association", "costs", "credit", "department", "development", "even", "federal", "financial", "home", "national", "payment", "public", "underlying", "urban".
0.300
actamonganotherapproximatelybecomingbroaderchangesconsumerscreditdifferentevenfinancialinstitutionsinstrumentsleastmarketnumbersobligationspricesproduct
SHARED TOKENS (27): "act", "among", "another", "approximately", "becoming", "broader", "changes", "consumers", "credit", "different", "even", "financial", "institutions", "instruments", "least", "market", "numbers", "obligations", "prices", "product"....
0.300
H-1B visa ↗ Q974595 KW CROSS HIGH
additionaladministrationagencyapplicantsapplicationapprovedbeyondchangeclassificationconditionsconsumerdefinesdepartmentemployeremploymentexemptionsfeegrowthinstitutionknowledge
SHARED TOKENS (39): "additional", "administration", "agency", "applicants", "application", "approved", "beyond", "change", "classification", "conditions", "consumer", "defines", "department", "employer", "employment", "exemptions", "fee", "growth", "institution", "knowledge"....
0.300
academicanotherbookscontentcostsdedicateddevelopeddevelopmentdiscoveryfinancialformshomeinformationlargemediamobilenewsoperateoperatorsparticular
SHARED TOKENS (35): "academic", "another", "books", "content", "costs", "dedicated", "developed", "development", "discovery", "financial", "forms", "home", "information", "large", "media", "mobile", "news", "operate", "operators", "particular"....
0.300
associatedcommercialequityestatefinancialfuturehomelatermakingmarketpriceprocesspropertyrealremainresidentialsubstantial
SHARED TOKENS (17): "associated", "commercial", "equity", "estate", "financial", "future", "home", "later", "making", "market", "price", "process", "property", "real", "remain", "residential", "substantial".
0.300
Bankruptcy ↗ Q152074 EXACT TITLE
cannotlegalmeaningprocessstatus
SHARED TOKENS (5): "cannot", "legal", "meaning", "process", "status". | EXACT TITLE in mortgage_lending: "Bankruptcy".
0.300
administrationbuildingconditionsdepartmentdirectlyemploymentfederalgoverninghistorylaboroccupationalregulationsreportsstandardsstatisticswageworkers
SHARED TOKENS (17): "administration", "building", "conditions", "department", "directly", "employment", "federal", "governing", "history", "labor", "occupational", "regulations", "reports", "standards", "statistics", "wage", "workers".
0.300
activityanothercompensationeducationalemployerestimateseventsexposuregeneralhoursidentifiedlawlegalmaterialnationaloccupationalpopulationreportreportingspecific
SHARED TOKENS (24): "activity", "another", "compensation", "educational", "employer", "estimates", "events", "exposure", "general", "hours", "identified", "law", "legal", "material", "national", "occupational", "population", "report", "reporting", "specific"....
0.300
actapprovalapprovalsapprovedbuildingcommercialconstructioncostscreatesdevelopmentdifferentestateexistingfinancialgrowthmixed-useobtainpermitsplanningplans
SHARED TOKENS (36): "act", "approval", "approvals", "approved", "building", "commercial", "construction", "costs", "creates", "development", "different", "estate", "existing", "financial", "growth", "mixed-use", "obtain", "permits", "planning", "plans"....
0.300
associatedcommunitiescommunityconsumerscontrolevaluationexposurehazardindividualmanagementmodelsoccupationalphysicalprotectionworkworkers
SHARED TOKENS (16): "associated", "communities", "community", "consumers", "control", "evaluation", "exposure", "hazard", "individual", "management", "models", "occupational", "physical", "protection", "work", "workers".
0.300
amongassociatedcareconsumerconsumerscontainingdifferentformindustrymarketmarketedmodernpersonalproductsprotectionremain
SHARED TOKENS (16): "among", "associated", "care", "consumer", "consumers", "containing", "different", "form", "industry", "market", "marketed", "modern", "personal", "products", "protection", "remain".
🫐 BERRY72 edges
0.280
careproductsschoolssystems
SHARED TOKENS (4): "care", "products", "schools", "systems". | EXACT TITLE in beauty_salon: "Paul Mitchell (hairdresser)".
0.280
Wig ↗ Q105507 EXACT TITLE
accessoryaltercoveringprofessional
SHARED TOKENS (4): "accessory", "alter", "covering", "professional". | EXACT TITLE in beauty_salon: "Wig".
0.280
analysiscommercialcostsdevelopeddevelopmentdifferentleadpolicypresentrequirerequiressitespecializedstudy
SHARED TOKENS (14): "analysis", "commercial", "costs", "developed", "development", "different", "lead", "policy", "present", "require", "requires", "site", "specialized", "study".
0.280
medicalprocessprovidertreatment
SHARED TOKENS (4): "medical", "process", "provider", "treatment". | EXACT TITLE in beauty_salon: "Chemical peel".
0.280
Scalp ↗ Q9622 EXACT TITLE
collectioncoveringstructuresstudy
SHARED TOKENS (4): "collection", "covering", "structures", "study". | EXACT TITLE in beauty_salon: "Scalp".
0.280
amongestatefinancialinvolvinglargelargermakingmarketoccurparticipatepricepricesrealreal-estate
SHARED TOKENS (14): "among", "estate", "financial", "involving", "large", "larger", "making", "market", "occur", "participate", "price", "prices", "real", "real-estate".
0.260
businessmedicaltreatment
SHARED TOKENS (3): "business", "medical", "treatment". | EXACT TITLE in beauty_salon: "Beauty salon".
0.260
accessoryadditionalfamilyhomeobtainpersonalpropertyprovideresidentialseparatesmallsuitesupport
SHARED TOKENS (13): "accessory", "additional", "family", "home", "obtain", "personal", "property", "provide", "residential", "separate", "small", "suite", "support".
0.260
practiceprocessprofessional
SHARED TOKENS (3): "practice", "process", "professional". | EXACT TITLE in beauty_salon: "Electrology".
0.260
Parcel ↗ Q7136418 EXACT TITLE
deliveryindividualmodern
SHARED TOKENS (3): "delivery", "individual", "modern". | EXACT TITLE in mortgage_lending: "Parcel".
0.260
Nail salon ↗ Q8007048 EXACT TITLE
caregeneralwork
SHARED TOKENS (3): "care", "general", "work". | EXACT TITLE in beauty_salon: "Nail salon".
0.260
Toluene ↗ Q15779 EXACT TITLE
contactpotentialsingle
SHARED TOKENS (3): "contact", "potential", "single". | EXACT TITLE in beauty_salon: "Toluene".
0.260
authorityboundariesdistrictentitygeographiclargelocalobtainorganizedpublicsetstatutetax
SHARED TOKENS (13): "authority", "boundaries", "district", "entity", "geographic", "large", "local", "obtain", "organized", "public", "set", "statute", "tax".
0.260
Make-up artist ↗ Q935666 KW CROSS HIGH
accessappliescommunityindustrylargelicensespayrollprofessionalprojectremainrequiredwhosework
SHARED TOKENS (13): "access", "applies", "community", "industry", "large", "licenses", "payroll", "professional", "project", "remain", "required", "whose", "work".
0.260
largeprocessscale
SHARED TOKENS (3): "large", "process", "scale". | EXACT TITLE in beauty_salon: "Ethyl acetate".
0.260
accesscombinationdifferenteducationeducationalhistoricallynetworkparticipationpresentprocessprogramschoolstudents
SHARED TOKENS (13): "access", "combination", "different", "education", "educational", "historically", "network", "participation", "present", "process", "program", "school", "students".
0.260
Hairdresser ↗ Q55187 EXACT TITLE
changecombinationwhose
SHARED TOKENS (3): "change", "combination", "whose". | EXACT TITLE in beauty_salon: "Hairdresser".
0.260
Aveda ↗ Q4827965 EXACT TITLE
careproductsstudents
SHARED TOKENS (3): "care", "products", "students". | EXACT TITLE in beauty_salon: "Aveda".
0.260
accessagainstcreditextendsfinancialmaintainingmarketotherwisepaymentpracticeprovisionqualityschedule
SHARED TOKENS (13): "access", "against", "credit", "extends", "financial", "maintaining", "market", "otherwise", "payment", "practice", "provision", "quality", "schedule".
0.260
Bridge loan ↗ Q2079582 KW CROSS HIGH
additionalapplicationsbusinessconventionalcostsequityfeesindividuallargerparticipationpendingrequiresouth
SHARED TOKENS (13): "additional", "applications", "business", "conventional", "costs", "equity", "fees", "individual", "larger", "participation", "pending", "require", "south".
0.260
annualapprovalcollectiondevelopmentevenformspermittedpresentproducingrequirerequiresrequiringzoning
SHARED TOKENS (13): "annual", "approval", "collection", "development", "even", "forms", "permitted", "present", "producing", "require", "requires", "requiring", "zoning".
0.240
compareconsumersdecisionsdedicatedevaluationexperienceformproductproductsprofessionalreviewreviews
SHARED TOKENS (12): "compare", "consumers", "decisions", "dedicated", "evaluation", "experience", "form", "product", "products", "professional", "review", "reviews".
0.240
broadercreditdetailedfinancialinstitutionslargeprivatepropertyreal-estaterequirestatussufficient
SHARED TOKENS (12): "broader", "credit", "detailed", "financial", "institutions", "large", "private", "property", "real-estate", "require", "status", "sufficient".
0.240
establishestateformhomemarketpriceprocesspropertyrealreportreportssale
SHARED TOKENS (12): "establish", "estate", "form", "home", "market", "price", "process", "property", "real", "report", "reports", "sale".
0.240
Credit score ↗ Q1787103 KW CROSS HIGH
analysisconsumerscreditdataevaluateindividualinformationinsurancemobilepotentialreportsources
SHARED TOKENS (12): "analysis", "consumers", "credit", "data", "evaluate", "individual", "information", "insurance", "mobile", "potential", "report", "sources".
0.220
Wedding ↗ Q49836 EXACT TITLE
authoritypublic
SHARED TOKENS (2): "authority", "public". | EXACT TITLE in beauty_salon: "Wedding".
0.220
actagencybureaudepartmentfederalindependentinstitutionsjulylicensednationalregulatory
SHARED TOKENS (11): "act", "agency", "bureau", "department", "federal", "independent", "institutions", "july", "licensed", "national", "regulatory".
0.220
Dermabrasion ↗ Q1200226 KW CROSS HIGH
conditionslocalmedicaloperatorprocedureproceduresprocessprofessionalproviderequiresmall
SHARED TOKENS (11): "conditions", "local", "medical", "operator", "procedure", "procedures", "process", "professional", "provide", "require", "small".
0.220
realrequire
SHARED TOKENS (2): "real", "require". | EXACT TITLE in beauty_salon: "Artificial nails".
0.220
actamongchangeschaptercodeconsumerconsumerslawpdfprotectionprovisions
SHARED TOKENS (11): "act", "among", "changes", "chapter", "code", "consumer", "consumers", "law", "pdf", "protection", "provisions".
0.220
Trailer park ↗ Q1426493 KW CROSS HIGH
communityconstructioncoursehomelowmobilemodernstatementstatusstructurestechnology
SHARED TOKENS (11): "community", "construction", "course", "home", "low", "mobile", "modern", "statement", "status", "structures", "technology".
0.220
annualcompareconsumercreditfeeformlegalprotectionratherrequiredstandardized
SHARED TOKENS (11): "annual", "compare", "consumer", "credit", "fee", "form", "legal", "protection", "rather", "required", "standardized".
0.220
Pedicure ↗ Q1161133 EXACT TITLE
caretreatment
SHARED TOKENS (2): "care", "treatment". | EXACT TITLE in beauty_salon: "Pedicure".
0.220
boundariesdescribedinstrumentlawlegalpropertyrealrequiredspecificstatementwritten
SHARED TOKENS (11): "boundaries", "described", "instrument", "law", "legal", "property", "real", "required", "specific", "statement", "written".
0.220
constructionitselflaborlinkmaterialsmeaningnamespersonalpropertyrealtitle
SHARED TOKENS (11): "construction", "itself", "labor", "link", "materials", "meaning", "names", "personal", "property", "real", "title".
0.210
Barbershop ↗ Q4345168 EXACT TITLE
work
SHARED TOKENS (1): "work". | EXACT TITLE in beauty_salon: "Barbershop".
0.210
Spa ↗ Q1341387 EXACT TITLE
powers
SHARED TOKENS (1): "powers". | EXACT TITLE in beauty_salon: "Spa". | EXACT TITLE in mortgage_lending: "Spa".
0.200
accordingendformslowpaymentpresentrealremainssingleunless
SHARED TOKENS (10): "according", "end", "forms", "low", "payment", "present", "real", "remains", "single", "unless".
0.200
EXACT TITLE in mortgage_lending: "Subdivision".
0.200
conventionalcreditfeesindividuallargelargerqualityresidentialsetstandard
SHARED TOKENS (10): "conventional", "credit", "fees", "individual", "large", "larger", "quality", "residential", "set", "standard".
0.200
Appraisal ↗ Q4781689 EXACT TITLE
EXACT TITLE in mortgage_lending: "Appraisal".
0.200
capitalcommercialconventionalestateinstrumentprivatepropertyrealresidentialspecific
SHARED TOKENS (10): "capital", "commercial", "conventional", "estate", "instrument", "private", "property", "real", "residential", "specific".
0.200
buildingcontrolcostsevaluateimpactoperatingprovidequalitysystemstechnology
SHARED TOKENS (10): "building", "control", "costs", "evaluate", "impact", "operating", "provide", "quality", "systems", "technology".
0.200
acetatebutylchemicalfoundorganic
EXACT TITLE in beauty_salon: "Butyl acetate".
0.180
Mobile home ↗ Q1434998 KW CROSS HIGH
differenthomelegalmobilerequiredsharesitestructurework
SHARED TOKENS (9): "different", "home", "legal", "mobile", "required", "share", "site", "structure", "work".
0.180
approximatelyboisedatadistrictevenidahopopulationsinglesouth
SHARED TOKENS (9): "approximately", "boise", "data", "district", "even", "idaho", "population", "single", "south".
0.180
businessdifferenteconomicsestatemarketrealreal-estateresidentialsingle
SHARED TOKENS (9): "business", "different", "economics", "estate", "market", "real", "real-estate", "residential", "single".
0.180
Coworking ↗ Q869457 KW CROSS HIGH
differentexperiencehomeimpactindependentofficesprovideshareworkers
SHARED TOKENS (9): "different", "experience", "home", "impact", "independent", "offices", "provide", "share", "workers".
0.180
agencydepartmentdevelopmentdirectlyfederalhomeprogramreportsurban
SHARED TOKENS (9): "agency", "department", "development", "directly", "federal", "home", "program", "reports", "urban".
0.170
currentidaho
SHARED TOKENS (2): "current", "idaho". | URL->B (1): https://sos.idaho.gov/.
0.160
becomingchangescommunitiesdepartmentlargemixed-useretailspecialized
SHARED TOKENS (8): "becoming", "changes", "communities", "department", "large", "mixed-use", "retail", "specialized".
0.160
actaddressauthorizedcapitallargemarketpracticesregulations
SHARED TOKENS (8): "act", "address", "authorized", "capital", "large", "market", "practices", "regulations".
0.160
estateformfunctionshomeinvestmentownerrealstatus
SHARED TOKENS (8): "estate", "form", "functions", "home", "investment", "owner", "real", "status".
0.160
chaptercodefederalformprocesssectionstatutetitle
SHARED TOKENS (8): "chapter", "code", "federal", "form", "process", "section", "statute", "title".
0.160
buildingequityestatefinancialpricepropertyrealtransaction
SHARED TOKENS (8): "building", "equity", "estate", "financial", "price", "property", "real", "transaction".
0.160
differenteventsexposuremakingstructuressupportsystemsystems
SHARED TOKENS (8): "different", "events", "exposure", "making", "structures", "support", "system", "systems".
0.140
agencyboisebureaudepartmentidahonationalpotential
SHARED TOKENS (7): "agency", "boise", "bureau", "department", "idaho", "national", "potential".
0.120
boiseidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (6): "boise", "idaho", "metropolitan", "municipal", "population", "separate".
0.120
Acrylic paint ↗ Q207849 KW CROSS HIGH
combinationcostsdifferentevenmarketmedia
SHARED TOKENS (6): "combination", "costs", "different", "even", "market", "media".
0.120
boiseidahometropolitanregiontreasurevalley
SHARED TOKENS (6): "boise", "idaho", "metropolitan", "region", "treasure", "valley".
0.120
agencyestateeventindustryplanningreal
SHARED TOKENS (6): "agency", "estate", "event", "industry", "planning", "real".
0.120
agencyeducationalprofessionalpublicqualificationtrade
SHARED TOKENS (6): "agency", "educational", "professional", "public", "qualification", "trade".
0.120
costsinsuranceprivatepropertyrequiredsale
SHARED TOKENS (6): "costs", "insurance", "private", "property", "required", "sale".
0.120
applicableauthorizesdistrictpermituseszoning
SHARED TOKENS (6): "applicable", "authorizes", "district", "permit", "uses", "zoning".
0.120
differentdocumenteventslaterofficialprovide
SHARED TOKENS (6): "different", "document", "events", "later", "official", "provide".
0.120
againstinsuranceinsurerslosspropertyspecific
SHARED TOKENS (6): "against", "insurance", "insurers", "loss", "property", "specific".
0.120
appeardifferentformsgrowthpracticetherefore
SHARED TOKENS (6): "appear", "different", "forms", "growth", "practice", "therefore".
0.120
Hairstyle ↗ Q327496 KW CROSS HIGH
homeinfluenceoutsidepersonalpracticalshape
SHARED TOKENS (6): "home", "influence", "outside", "personal", "practical", "shape".
0.120
Negative equity ↗ KW CROSS HIGH
equityestateownerrealsecurewhose
SHARED TOKENS (6): "equity", "estate", "owner", "real", "secure", "whose".
0.100
USDA home loan ↗ KW CROSS HIGH
departmentdevelopmenthomeprogramproperty
SHARED TOKENS (5): "department", "development", "home", "program", "property".
0.100
affectinggenerallegaloutsideprocess
SHARED TOKENS (5): "affecting", "general", "legal", "outside", "process".
0.100
contactdirectexposurephysicalrepresents
SHARED TOKENS (5): "contact", "direct", "exposure", "physical", "represents".
◈ Frequently Asked Questions
Beauty Salon × Mortgage Lending — Treasure Valley
HAIKU · HIGH GATE
Why would a beauty salon owner in Boise need mortgage lending before opening a franchise location?
Beauty salon franchises in the Treasure Valley typically require real estate acquisition or long-term leases in commercial zones, which necessitates mortgage lending or commercial financing. Ada County and Canyon County zoning regulations often require salon operators to demonstrate property ownership or secured financing as part of their business licensing application in cities like Nampa and Eagle.
How do planning permission timelines in Caldwell affect mortgage lending approval for new beauty salon buildouts?
Lenders in the Boise metropolitan area require proof of planning permission and zoning compliance before releasing funds for beauty salon construction or renovation projects. Canyon County planning departments typically require 6-12 weeks for approval, meaning mortgage lending institutions in Caldwell condition their loan disbursement schedules around these local planning permission milestones.
What role does property valuation play in mortgage lending decisions for beauty salon real estate in the Treasure Valley?
Mortgage lenders assess property values in Ada County and Canyon County based on comparable commercial real estate sales, and beauty salon locations in Boise and Nampa command different valuations depending on zoning classification and proximity to residential areas. Private equity firms investing in beauty salon franchises across the Treasure Valley use these mortgage lending valuations to determine equity requirements and loan-to-value ratios.
How do franchising agreements affect mortgage lending terms for beauty salons expanding across Ada County and Canyon County?
Mortgage lenders in the Boise metropolitan area require franchisees to disclose franchise agreements before approving real estate loans, as these contracts affect the borrower's cash flow projections and property use restrictions. Beauty salon franchises operating in Eagle, Kuna, and Caldwell must provide franchise disclosure documents to lenders, which then adjust interest rates and terms based on franchise brand strength and proven local performance.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Beauty Salon × Mortgage Lending 17 QID bridges 252 edges 6,494 ext links 2026-07-17 19:40:46 UTC 87a08196455ee570
Beauty Salon corridor ↗ Mortgage Lending corridor ↗ Mortgage Lending × Beauty Salon ↗ boisestandard.org/standard ↗
Parent Corridors
Beauty Salon × All Other Verticals