—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Beauty Salon ↔ relates to ↔ Manufacturing Food Processing

15 Wikipedia bridge articles confirmed in both vertical ledgers. 250 deterministic cross-vertical edges. 7,084 external source links harvested. Every edge provenance-stamped. Every claim auditable.

15 QID Bridge Articles
250 Cross Edges
7,084 External Sources
294 Wikipedia Articles
15 🌲 Evergreen
166 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Beauty Salon
× Manufacturing Food Processing
QID Bridge Articles
15
confirmed Wikipedia overlap
Total Cross Edges
250
External Sources Harvested
7,084
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Zoning
score: 1.0000  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (15)
ZoningRetailBoise, IdahoTreasure ValleyBuilding codePrivate equityBoise RiverHeating, ventilation, and air conditioningNampa, IdahoAda County, IdahoMeridian, IdahoCaldwell, IdahoKuna, IdahoCanyon County, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahometropolitanlocalcapitalbuildingplanningdesignhomewesterncontrolprivatesecondcombinedevelopmentregulationsresidentialrulessystemsbusiness
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:40:19 UTC
Content Hash
3f8092ead60b8723
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
15 BRIDGES
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in beauty_salon (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (25): "allowed", "building", "combine", "developed", "development", "different", "form", "guide", "land-use", "local", "outright", "places", "planning", "policy", "property", "question", "regulations", "regulatory", "residential", "rules".... | EXACT TITLE in beauty_salon: "Zoning". | EXACT TITLE in manufacturing_food_processing: "Zoning".
allowedbuildingcombinedevelopeddevelopmentdifferentformguideland-uselocaloutrightplacesplanningpolicypropertyquestionregulationsregulatoryresidentialrulesscalesinglesystemsuseszoning
gle use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Types There are a great variety of zoning types, some of which focus on regulating building form and the relation of buildings to the street with mixed uses, known as form-based, others with separating land uses, known as use-based, or a combination thereof. Use-based zoning systems can comprise single-use zones, mixed-use zones - where a compatible group of uses are allowed to co-exist - or a combination of both single and mixed-use zones in one system. The main approaches include use-based, form-based, performance and incentive zoning.
The primary purpose of single-use zoning is to geographically separate uses that are thought to be incompatible. In practice, zoning is also used to prevent new development from interfering with existing uses and/or to preserve the character of a community. Single-use zoning is where only one kind of use is allowed per zone, or district. It is also known as exclusionary zoning or, in the United States, as Euclidean zoning because of a court case in Euclid, Ohio, Village of Euclid, Ohio v. Ambler Realty Co. 272 U.S. 365 (1926), which established its constitutionality. It has been the dominant system of zoning in North America, especially the United States, since its first implementation. Commonly defined single-use districts include: residential, commercial, and industrial. Each category can have a number of sub-categories, for example, within the commercial category there may be separate districts for small retail, large retail, office use, lodging and others, while industrial may be subdivided into heavy manufacturing, light assembly and warehouse uses. Special districts may also be created for purposes like public facilities, recreational amenities, and green space. The application of single-use zoning has led to the distinctive form of many cities in the United States, Canada, Australia, and New Zealand, in which a very dense urban core, often containing skyscrapers, is surrounded by low density residential suburbs, characterised by large gardens and leafy streets.
Retail
Q126793 EXACT TITLE 1.000
QID OVERLAP: Q126793 in beauty_salon (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (49): "access", "alongside", "analysis", "broader", "business", "chain", "combine", "consumers", "core", "costs", "credit", "customer", "customers", "decisions", "described", "design", "directly", "economically", "experience", "firms".... | EXACT TITLE in beauty_salon: "Retail". | EXACT TITLE in manufacturing_food_processing: "Retail".
accessalongsideanalysisbroaderbusinesschaincombineconsumerscorecostscreditcustomercustomersdecisionsdescribeddesigndirectlyeconomicallyexperiencefirmshandlinghistoryinstitutionallaborlargelinkmanagementmarketmarketsmix+19
ng the retail marketing mix, commonly summarized as six “Ps”: product, place, promotion, price, personnel, and presentation (physical evidence). Place decisions include location, operating hours, and access, and many retailers have expanded into multichannel models that combine physical and online retail. Pricing strategy and tactics can include discounts, everyday low pricing, high-low pricing, loss leaders, bundling, and psychological pricing, alongside planning for customer payment modes that carry handling costs. Retail labor needs often vary by time and season, which has supported flexible scheduling; one cited estimate is that in 2012, about 70% of United States retail workers were part-time. Over time, many retailers have emphasized longer-term customer relationships rather than one-time transactions, while also investing in store design (layout, lighting, music, signage, and “decompression” areas) to shape the shopping experience. In the digital age, an increasing number of retailers are seeking to reach broader markets by selling through multiple channels, including both brick and mortar and online retailing. Digital technologies are also affecting the way that consumers pay for goods and services. Retailing support services may also include the provision of credit, delivery services, advisory services, stylist services and a range of other supporting services. Retail workers are the employees of such stores. The retail sector is economically significant and employs large workforces. Most modern retailers typically make a variety of strategic level decisions including the type of store, the market to be served, the optimal product assortment, customer service, supporting services, and the store's overall market positioning.
Legal definition and explanation Retail refers to the activity of selling goods or services directly to consumers or end-users. Some retailers may sell to business customers, and such sales are termed non-retail activity. In some jurisdictions or regions, legal definitions of retail specify that at least 80 percent of sales activity must be to end-users. In the banking industry "wholesale" usually refers to wholesale banking, providing tailored services to large customers, in contrast with retail banking, providing standardized services to large numbers of smaller customers. Retailing often occurs in retail stores or service establishments, but may also occur through direct selling, such as through vending machines, door-to-door sales or electronic channels. Although the idea of retail is often associated with the purchase of goods, the term may be applied to service providers that sell to consumers. Retail service providers include retail banking, tourism, insurance, private healthcare, private education, private security firms, legal firms, publishers, public transport, and others. For example, a tourism provider might have a retail division that books travel and accommodation for consumers, plus a wholesale division that purchases blocks of accommodation, hospitality, transport, and sightseeing, which are subsequently packaged into a holiday tour for sale to retail travel agents. Some retailers badge their stores as "wholesale outlets" offering "wholesale prices". While this practice may encourage consumers to imagine that they have access to lower prices, while being prepared to trade off reduced prices for cramped in-store environments, in a strictly legal sense, a store that sells the majority of its merchandise directly to consumers is defined as a retailer rather than a wholesaler. Different jurisdictions set parameters for the ratio of consumer to business sales that define a retail business.
A retail mix is devised for the purpose of coordinating day-to-day tactical decisions. The retail marketing mix typically consists of six broad decision layers, including product decisions, place decisions, promotion, price, personnel and presentation (also known as physical evidence). The retail mix is loosely based on the marketing mix, but has been expanded and modified in line with the unique needs of the retail context. Several scholars have argued for an expanded marketing mix with the inclusion of two new Ps, namely, Personnel and Presentation since these contribute to the customer's unique retail experience and are the principal basis for retail differentiation. Yet other scholars argue that the Retail Format (i.e. retail formula) should be included. The modified retail marketing mix that is most commonly cited in textbooks is often called the 4 (place, price, product, and promotion) or 6 Ps of retailing (see diagram at right).The primary product-related decisions facing the retailer are the product assortment (what product lines, how many lines and which brands to carry); the type of customer service (high contact through to self-service) and the availability of support services (e.g. credit terms, delivery services, after sales care). These decisions depend on careful analysis of the market, demand, competition, as well as the retailer's skills and expertise. Customer service is the "sum of acts and elements that allow consumers to receive what they need or desire from [the] retail establishment." Retailers must decide whether to provide a full service outlet or a minimal service outlet, such as no service in the case of vending machines; self-service with only basic sales assistance or a full service operation as in many boutiques and speciality stores. In addition, the retailer needs to make decisions about sales support, such as customer delivery and after-sales customer care. Place decisions are primarily concerned with consumer access and may involve location, space utilisation and operating hours. Retailers may consider a range of both qualitative and quantitative factors to evaluate the potential sites under consideration. Macro factors include market characteristics (demographic, economic and socio-cultural), demand, competition and infrastructure (e.g. the availability of power, roads, public transport systems). Micro factors include the size of the site (e.g. availability of parking), access for delivery vehicles. A major retail trend has been the shift to multi-channel retailing. To counter the disruption caused by online retail, many brick-and-mortar retailers have entered the online retail space by setting up online catalogue sales and e-commerce websites. However, many retailers have noticed that consumers behave differently when shopping online. For instance, in terms of choice of online platform, shoppers tend to choose the online site of their preferred retailer initially, but as they gain more experience in online shopping, they become less loyal and more likely to switch to other retail sites.
Boise, Idaho
Q35775 EXACT TITLE 0.960
QID OVERLAP: Q35775 in beauty_salon (tier:evergreen) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (13): "annual", "boise", "capital", "feet", "home", "idaho", "locally", "major", "metropolitan", "north", "technology", "treasure", "valley". | EXACT TITLE in beauty_salon: "Boise, Idaho".
annualboisecapitalfeethomeidaholocallymajormetropolitannorthtechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in beauty_salon (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (10): "boise", "historically", "idaho", "local", "metropolitan", "owyhee", "region", "treasure", "valley", "western". | EXACT TITLE in beauty_salon: "Treasure Valley". | EXACT TITLE in manufacturing_food_processing: "Treasure Valley".
boisehistoricallyidaholocalmetropolitanowyheeregiontreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Building code
Q2333573 QID OVERLAP 0.800
QID OVERLAP: Q2333573 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (40): "architects", "authority", "building", "code", "codes", "compliance", "construction", "control", "design", "district", "effects", "electrical", "estate", "facility", "general", "health", "jurisdiction", "law", "local", "materials"....
architectsauthoritybuildingcodecodescomplianceconstructioncontroldesigndistricteffectselectricalestatefacilitygeneralhealthjurisdictionlawlocalmaterialsmodelnationalobtainoccupancyplanningplumbingprivateproductspublicreal+10
uildings. The building code becomes law of a particular jurisdiction when formally enacted by the appropriate governmental or private authority. Building codes are generally intended to be applied by architects, engineers, interior designers, constructors and regulators but are also used for various purposes by safety inspectors, environmental scientists, real estate developers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
odes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments. Building Control regularisation charges apply in case work is undertaken which should have had been inspected at the time of the work if this was not done. Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (25): "active", "business", "capital", "category", "control", "described", "development", "expansion", "financial", "firms", "general", "investment", "limited", "management", "operational", "otherwise", "ownership", "private", "product", "products"....
activebusinesscapitalcategorycontroldescribeddevelopmentexpansionfinancialfirmsgeneralinvestmentlimitedmanagementoperationalotherwiseownershipprivateproductproductsprovidepublicratherspecializedspecific
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Boise River
Q891080 EXACT TITLE 0.800
QID OVERLAP: Q891080 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (5): "approximately", "boise", "idaho", "square", "western". | EXACT TITLE in manufacturing_food_processing: "Boise River".
approximatelyboiseidahosquarewestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Heating, ventilation, and air conditioning
Q1798773 QID OVERLAP 0.780
QID OVERLAP: Q1798773 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (14): "building", "control", "costs", "design", "electrical", "hvac", "maintenance", "operating", "plumbing", "provide", "quality", "systems", "technology", "ventilation".
buildingcontrolcostsdesignelectricalhvacmaintenanceoperatingplumbingprovidequalitysystemstechnologyventilation
Heating, ventilation, and air conditioning (HVAC ) systems regulate temperature, humidity, and indoor air quality in vehicles and buildings. They are designed to provide thermal comfort and to control airborne contaminants through heating, cooling, ventilation, filtration, and humidity control. HVAC design considerations include energy efficiency, indoor air quality, maintenance, and environmental impact, particularly in green building projects. In building design, mechanical, electrical, and plumbing engineers may integrate HVAC systems with other building systems (i.e.
heating, cooling, ventilation, filtration, and humidity control. HVAC design considerations include energy efficiency, indoor air quality, maintenance, and environmental impact, particularly in green building projects. In building design, mechanical, electrical, and plumbing engineers may integrate HVAC systems with other building systems (i.e.
Summary The three major functions of heating, ventilation, and air conditioning are intertwined. HVAC systems can provide ventilation and maintain pressure relationships between spaces. The means of air delivery and removal from spaces is known as room air distribution. Individual systems In modern buildings, the design, installation, and control systems of these functions are integrated into one or more HVAC systems. For very small buildings, contractors normally estimate the capacity and type of system needed and then design the system, selecting the appropriate refrigerant and various components needed. For larger buildings, building service designers, mechanical engineers, or building services engineers analyze, design, and specify the HVAC systems. Specialty mechanical contractors and suppliers then fabricate, install, and commission the systems.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (11): "boise", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "second", "west", "western".
boisecollegehomeidahomeaningmeridianmetropolitannampasecondwestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot". The city has a prominent student population, home to the College of Western Idaho and Northwest Nazarene University. History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (10): "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "private", "second".
boisecapitaldistricthomeidahojurisdictionlocalmetropolitanprivatesecond
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (8): "among", "boise", "capital", "fastest-growing", "idaho", "making", "meridian", "second".
amongboisecapitalfastest-growingidahomakingmeridiansecond
population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (8): "approximately", "boise", "caldwell", "college", "idaho", "locally", "metropolitan", "west".
approximatelyboisecaldwellcollegeidaholocallymetropolitanwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
QID OVERLAP 0.640
QID OVERLAP: Q1515177 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (7): "additional", "boise", "fastest-growing", "idaho", "kuna", "metropolitan", "percent".
additionalboisefastest-growingidahokunametropolitanpercent
metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020. History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (6): "boise", "caldwell", "idaho", "making", "metropolitan", "nampa".
boisecaldwellidahomakingmetropolitannampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.560
QID OVERLAP: Q1516870 in beauty_salon (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (3): "boise", "eagle", "idaho".
boiseeagleidaho
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District. The portion in the Boise School District is zoned to: Shadow Hills Elementary School, Riverglen Middle School, and Capital High School. In popular culture The 2008 show The Baby Borrowers was filmed in Eagle.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
235 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP235 edges
🌲 EVERGREEN1 edges
0.650
applicationapplicationsclientscoursefeetidentifyinglicensedlistproductsprofessionalsanitationspecifictrainingtreatmentwhosework
SHARED TOKENS (16): "application", "applications", "clients", "course", "feet", "identifying", "licensed", "list", "products", "professional", "sanitation", "specific", "training", "treatment", "whose", "work". | URL->A (1): https://www.cdc.gov/niosh/nail-technicians/about/index.html. | EXACT TITLE in beauty_salon: "Nail technician".
🌿 BRANCH165 edges
0.500
amongapproximatelyboisecampusdivisionextensionfallsidahoofficesoperatesprofessionalpublicresearchschoolsstatewidestudents
SHARED TOKENS (16): "among", "approximately", "boise", "campus", "division", "extension", "falls", "idaho", "offices", "operates", "professional", "public", "research", "schools", "statewide", "students". | EXACT TITLE in manufacturing_food_processing: "University of Idaho".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbusinesscontactcreatedevelopeddirectelectricalexposureforminsidematerialmeansoperatespracticeprocessedprocessingrealstudentsuses
SHARED TOKENS (19): "application", "business", "contact", "create", "developed", "direct", "electrical", "exposure", "form", "inside", "material", "means", "operates", "practice", "processed", "processing", "real", "students", "uses". | EXACT TITLE in beauty_salon: "Photography".
0.500
Idaho ↗ Q1221 EXACT TITLE
approximatelyassociatedbecomingboisecapitaldistincteconomyidahojulylinkednationalnorthofficialproductsregionssectorseparatesignificantsmallsquare
SHARED TOKENS (25): "approximately", "associated", "becoming", "boise", "capital", "distinct", "economy", "idaho", "july", "linked", "national", "north", "official", "products", "regions", "sector", "separate", "significant", "small", "square".... | EXACT TITLE in beauty_salon: "Idaho". | EXACT TITLE in manufacturing_food_processing: "Idaho".
0.500
additionalappliesapprovalauthoritybeyondcategoryconsumerconventionalexistingfunctionshealthpracticesprocessprocessingratherrelatedsafetyspecific
SHARED TOKENS (18): "additional", "applies", "approval", "authority", "beyond", "category", "consumer", "conventional", "existing", "functions", "health", "practices", "process", "processing", "rather", "related", "safety", "specific". | EXACT TITLE in manufacturing_food_processing: "Functional food".
0.500
Kitchen ↗ Q43164 EXACT TITLE
closecommercialconstructiondesigndevelopedestablishmentestablishmentsfacilitiesfoundfunctionshealthlargelargerlawmarketmeetpreparationpublicrelatedrequirements
SHARED TOKENS (26): "close", "commercial", "construction", "design", "developed", "establishment", "establishments", "facilities", "found", "functions", "health", "large", "larger", "law", "market", "meet", "preparation", "public", "related", "requirements".... | EXACT TITLE in manufacturing_food_processing: "Kitchen".
0.500
activityadditionalapproximatelycenterschemicalclosecommercialconsumptioncontrolleddevelopeddifferenteconomiceffectsexistinghealthinvolvinglargemanagementmaterialmaterials
SHARED TOKENS (36): "activity", "additional", "approximately", "centers", "chemical", "close", "commercial", "consumption", "controlled", "developed", "different", "economic", "effects", "existing", "health", "involving", "large", "management", "material", "materials".... | EXACT TITLE in manufacturing_food_processing: "Waste management".
0.500
alonebeyondbuildingcodecodesconditionsconsumptioncontroldemanddescribeddesigndirectdirectlyexposurehazardhealthimpactsissuemeansoperation
SHARED TOKENS (38): "alone", "beyond", "building", "code", "codes", "conditions", "consumption", "control", "demand", "described", "design", "direct", "directly", "exposure", "hazard", "health", "impacts", "issue", "means", "operation".... | EXACT TITLE in beauty_salon: "Ventilation (architecture)". | EXACT TITLE in manufacturing_food_processing: "Ventilation (architecture)".
0.500
actactsadministrationauthoritycontrolcosmeticfederalformlawnationalproductprovisionsregulationsrequirementssafetysciences
SHARED TOKENS (16): "act", "acts", "administration", "authority", "control", "cosmetic", "federal", "form", "law", "national", "product", "provisions", "regulations", "requirements", "safety", "sciences". | EXACT TITLE in manufacturing_food_processing: "Federal Food, Drug, and Cosmetic Act".
0.500
advancedbusinessesconvertingcostsdirecteffectsindustrymanagementmeaningmeetmunicipalnorthpracticeprocessprocessedregionregionsremainrequiresafe
SHARED TOKENS (27): "advanced", "businesses", "converting", "costs", "direct", "effects", "industry", "management", "meaning", "meet", "municipal", "north", "practice", "process", "processed", "region", "regions", "remain", "require", "safe".... | EXACT TITLE in manufacturing_food_processing: "Reclaimed water".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotcertificationchainchemicalconsumerconsumerscreatesdescribingdevelopedenforcementhandlinghazardshealthhygieneindustryinspectionmanagementmarketpersonsphysical
SHARED TOKENS (30): "cannot", "certification", "chain", "chemical", "consumer", "consumers", "creates", "describing", "developed", "enforcement", "handling", "hazards", "health", "hygiene", "industry", "inspection", "management", "market", "persons", "physical".... | EXACT TITLE in manufacturing_food_processing: "Food safety".
0.500
addressassociatedcannotconditionsexpertisefacilitieshomemeetmultipleneedpreparationprovidequalityrequiressafe
SHARED TOKENS (15): "address", "associated", "cannot", "conditions", "expertise", "facilities", "home", "meet", "multiple", "need", "preparation", "provide", "quality", "requires", "safe". | EXACT TITLE in beauty_salon: "Long-term care".
0.500
activityadministrativeassociatedconsumerscontrolcorecustomercustomersdefinesdefiningdescribeddesigndevelopmentdifferentengineeringhistoricallyinspectionmakingmanagementmaterials
SHARED TOKENS (36): "activity", "administrative", "associated", "consumers", "control", "core", "customer", "customers", "defines", "defining", "described", "design", "development", "different", "engineering", "historically", "inspection", "making", "management", "materials".... | EXACT TITLE in manufacturing_food_processing: "Quality assurance".
0.500
Fashion ↗ Q12684 EXACT TITLE
alongsideamongannualbrandingbrandscentersconsumersdescribesdifferentdistrictgeneralheadquartersindustryinfluenceissuemajormeansmetropolitanmixpatterns
SHARED TOKENS (24): "alongside", "among", "annual", "branding", "brands", "centers", "consumers", "describes", "different", "district", "general", "headquarters", "industry", "influence", "issue", "major", "means", "metropolitan", "mix", "patterns".... | EXACT TITLE in beauty_salon: "Fashion".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialdefinesdevelopmenteconomiceffectsimpactslimitedlocalmarketsoutsideplacespracticesprogramsrealsecondsignificantsource
SHARED TOKENS (21): "activity", "beyond", "business", "commercial", "defines", "development", "economic", "effects", "impacts", "limited", "local", "markets", "outside", "places", "practices", "programs", "real", "second", "significant", "source".... | EXACT TITLE in beauty_salon: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
acquiredannualapproximatelybusinessbusinessescomdirectoryexternalformerfoundedinformationmobileoperatespracticepracticespublicpublishesreviewreviewssales
SHARED TOKENS (26): "acquired", "annual", "approximately", "business", "businesses", "com", "directory", "external", "former", "founded", "information", "mobile", "operates", "practice", "practices", "public", "publishes", "review", "reviews", "sales".... | EXACT TITLE in beauty_salon: "Yelp". | EXACT TITLE in manufacturing_food_processing: "Yelp".
0.500
careercollegeeconomiceducationformalformsgeneralinstitutionknowledgenamesoccupationsproviderelatedschoolsskillsspecializedspecifictechnicaltechnologytrade
SHARED TOKENS (22): "career", "college", "economic", "education", "formal", "forms", "general", "institution", "knowledge", "names", "occupations", "provide", "related", "schools", "skills", "specialized", "specific", "technical", "technology", "trade".... | EXACT TITLE in beauty_salon: "Vocational education".
0.500
Private label ↗ EXACT TITLE
allowedamongbrandbrandschainclientsdirectlydistinctmanufacturermultiplenationalownedprivateproductpubliclyspecifications
SHARED TOKENS (16): "allowed", "among", "brand", "brands", "chain", "clients", "directly", "distinct", "manufacturer", "multiple", "national", "owned", "private", "product", "publicly", "specifications". | EXACT TITLE in manufacturing_food_processing: "Private label".
0.500
Disinfectant ↗ Q73984 EXACT TITLE
buildingchemicalcleanconcentratedcontactdifferentformformshistoricallyphysicalpremisesprocessremovesanitationsectorsimultaneouslytreatmentwastework
SHARED TOKENS (19): "building", "chemical", "clean", "concentrated", "contact", "different", "form", "forms", "historically", "physical", "premises", "process", "remove", "sanitation", "sector", "simultaneously", "treatment", "waste", "work". | EXACT TITLE in beauty_salon: "Disinfectant".
0.500
activityconditionscontroldevelopedelectricalgeneralindustrylargelimitedoperationoperationsprocessprocessesprogramsproviderangesrequiressmallsystemsystems
SHARED TOKENS (20): "activity", "conditions", "control", "developed", "electrical", "general", "industry", "large", "limited", "operation", "operations", "process", "processes", "programs", "provide", "ranges", "requires", "small", "system", "systems". | EXACT TITLE in manufacturing_food_processing: "Programmable logic controller".
0.500
apprenticeshipcertificationemployerexperiencedformalfoundjoblaborlicenseoutsidepracticeprofessionalregulatedsystemtradetraining
SHARED TOKENS (16): "apprenticeship", "certification", "employer", "experienced", "formal", "found", "job", "labor", "license", "outside", "practice", "professional", "regulated", "system", "trade", "training". | EXACT TITLE in beauty_salon: "Apprenticeship". | EXACT TITLE in manufacturing_food_processing: "Apprenticeship".
0.500
chainchainsconsumerconsumerscustomersdirectdirectlyfacilitiesindependentlinkedlogisticsmanagementmaterialsnetworkproductproductsstructuresupplysystemsystems
SHARED TOKENS (20): "chain", "chains", "consumer", "consumers", "customers", "direct", "directly", "facilities", "independent", "linked", "logistics", "management", "materials", "network", "product", "products", "structure", "supply", "system", "systems". | EXACT TITLE in beauty_salon: "Supply chain".
0.500
additionalauthorizationcontrolcurrentdocumentedindustrylicensingmanagementmanufacturermeetpracticepracticesproductproductsprovidequalityregulatoryrelevantrequirementsrules
SHARED TOKENS (22): "additional", "authorization", "control", "current", "documented", "industry", "licensing", "management", "manufacturer", "meet", "practice", "practices", "product", "products", "provide", "quality", "regulatory", "relevant", "requirements", "rules".... | EXACT TITLE in manufacturing_food_processing: "Good manufacturing practice".
0.500
agencybureaubusinessesconditionscurrentdatadepartmenteconomiceconomicsfederallaborlocalmajormanagementneedprocessespublicqualityresearchsubject
SHARED TOKENS (21): "agency", "bureau", "businesses", "conditions", "current", "data", "department", "economic", "economics", "federal", "labor", "local", "major", "management", "need", "processes", "public", "quality", "research", "subject".... | EXACT TITLE in beauty_salon: "Bureau of Labor Statistics".
0.500
Logistics ↗ Q177777 EXACT TITLE
chainconsumptioncostscustomersdedicatedfacilityinformationlogisticsmanagementmaterialmaterialsmodeloperationalphysicalplanningproductsprofessionalprovidepublicrelated
SHARED TOKENS (24): "chain", "consumption", "costs", "customers", "dedicated", "facility", "information", "logistics", "management", "material", "materials", "model", "operational", "physical", "planning", "products", "professional", "provide", "public", "related".... | EXACT TITLE in beauty_salon: "Logistics". | EXACT TITLE in manufacturing_food_processing: "Logistics".
0.500
Packaging ↗ Q207822 EXACT TITLE
associatedbrandingbusinessdescribedgoverninginstitutionalintegratedlogisticspreservesprocessproducingproductsprotectionregionsregulationsseparatestoragesystemtechnologywritten
SHARED TOKENS (20): "associated", "branding", "business", "described", "governing", "institutional", "integrated", "logistics", "preserves", "process", "producing", "products", "protection", "regions", "regulations", "separate", "storage", "system", "technology", "written". | EXACT TITLE in manufacturing_food_processing: "Packaging".
0.500
againstcertificationdemonstrateformalindependentinspectionnationalprimaryprovidequalityregionregionalrelevantspecificstandardssubjectsystem
SHARED TOKENS (17): "against", "certification", "demonstrate", "formal", "independent", "inspection", "national", "primary", "provide", "quality", "region", "regional", "relevant", "specific", "standards", "subject", "system". | EXACT TITLE in beauty_salon: "Accreditation".
0.500
chemicalclassificationclassificationscontainingdifferentformformshomemakingotherwisephysicalprimaryprocessedprocessingproductproductstotalwaste
SHARED TOKENS (18): "chemical", "classification", "classifications", "containing", "different", "form", "forms", "home", "making", "otherwise", "physical", "primary", "processed", "processing", "product", "products", "total", "waste". | EXACT TITLE in manufacturing_food_processing: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestategenerallawlegalmeansownedownershipprivatepropertypublicquestionrealresidentialstatus
SHARED TOKENS (19): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "law", "legal", "means", "owned", "ownership", "private", "property", "public", "question", "real", "residential", "status". | EXACT TITLE in beauty_salon: "Real estate". | EXACT TITLE in manufacturing_food_processing: "Real estate".
0.500
centralchemicalconsumersdesigndevelopmentdirectlyextendslinkedmaterialspracticesprocessesprocessingproductssafetyscopetechnology
SHARED TOKENS (16): "central", "chemical", "consumers", "design", "development", "directly", "extends", "linked", "materials", "practices", "processes", "processing", "products", "safety", "scope", "technology". | EXACT TITLE in manufacturing_food_processing: "Food science".
0.500
academicappliesbroaderchemicalcombinescontroldesigndevelopmentelectricalengineeringhandlingknowledgematerialsoperationsphysicalprocessingproductsprofessionalsafesciences
SHARED TOKENS (23): "academic", "applies", "broader", "chemical", "combines", "control", "design", "development", "electrical", "engineering", "handling", "knowledge", "materials", "operations", "physical", "processing", "products", "professional", "safe", "sciences".... | EXACT TITLE in manufacturing_food_processing: "Food engineering".
0.500
Snake River ↗ Q272074 EXACT TITLE
beginningcentralcommercialconstructioncontroldevelopedfallshistoryidaholargelimitedmajornationalnorthpolicyprivateproductprogramspublicregion
SHARED TOKENS (25): "beginning", "central", "commercial", "construction", "control", "developed", "falls", "history", "idaho", "large", "limited", "major", "national", "north", "policy", "private", "product", "programs", "public", "region".... | EXACT TITLE in manufacturing_food_processing: "Snake River".
0.500
businessbusinessescapacityclosecommercialconvertingcustomerfamilyfloorhomeofficesoperateoperatedoperatesparkingprohibitedregulationsresidentialsecondsmall
SHARED TOKENS (22): "business", "businesses", "capacity", "close", "commercial", "converting", "customer", "family", "floor", "home", "offices", "operate", "operated", "operates", "parking", "prohibited", "regulations", "residential", "second", "small".... | EXACT TITLE in beauty_salon: "Home business".
0.500
activityamongboisebusinesscollegedivisioneconomicseducationengineeringfoundedhealthidahoindependentinstitutionprogramprogramspublicreportedresearchsciences
SHARED TOKENS (22): "activity", "among", "boise", "business", "college", "division", "economics", "education", "engineering", "founded", "health", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research", "sciences".... | EXACT TITLE in manufacturing_food_processing: "Boise State University".
0.500
actadministrationagencyamongapprovalbuildingcampuscenterschemicalsclosecontroldepartmentdistinctdivisionengineeringexposurefederalfoundedfunctionshazard
SHARED TOKENS (48): "act", "administration", "agency", "among", "approval", "building", "campus", "centers", "chemicals", "close", "control", "department", "distinct", "division", "engineering", "exposure", "federal", "founded", "functions", "hazard".... | EXACT TITLE in beauty_salon: "National Institute for Occupational Safety and Health".
0.500
boisecommercialdepartmentfacilityfallsfirefunctionsgeneralidahonationaloperatedoperatesprotectionrequiringsupportuseswestern
SHARED TOKENS (17): "boise", "commercial", "department", "facility", "falls", "fire", "functions", "general", "idaho", "national", "operated", "operates", "protection", "requiring", "support", "uses", "western". | EXACT TITLE in manufacturing_food_processing: "Boise Airport".
0.500
actaddressaddressingagencyassistancechemicalcleancontroldirectlyfederalformgoverninginvolvinglawmajorownedphysicalprimaryprotectionprovisions
SHARED TOKENS (27): "act", "address", "addressing", "agency", "assistance", "chemical", "clean", "control", "directly", "federal", "form", "governing", "involving", "law", "major", "owned", "physical", "primary", "protection", "provisions".... | EXACT TITLE in manufacturing_food_processing: "Clean Water Act".
0.500
businesscertificationconsumerconsumerscreatescustomercustomerseconomicentryformgeneralhealthlawlicenselicensedlicensingmarketoccupationaloccupationspermitting
SHARED TOKENS (38): "business", "certification", "consumer", "consumers", "creates", "customer", "customers", "economic", "entry", "form", "general", "health", "law", "license", "licensed", "licensing", "market", "occupational", "occupations", "permitting".... | EXACT TITLE in beauty_salon: "Occupational licensing".
0.500
Albertsons ↗ EXACT TITLE
acquiredacquisitionboisecapitalchainchainscloseconsumerscorporatecustomerdifferentfederalformerfoundedgeneralidaholistmanagementnorthregional
SHARED TOKENS (24): "acquired", "acquisition", "boise", "capital", "chain", "chains", "close", "consumers", "corporate", "customer", "different", "federal", "former", "founded", "general", "idaho", "list", "management", "north", "regional".... | EXACT TITLE in manufacturing_food_processing: "Albertsons".
0.500
applicationconsumptiondevelopeddirectlyfoundlargemajormunicipalobtainoperateoperationspercentpowerprocessessafetysystemworkers
SHARED TOKENS (17): "application", "consumption", "developed", "directly", "found", "large", "major", "municipal", "obtain", "operate", "operations", "percent", "power", "processes", "safety", "system", "workers". | EXACT TITLE in manufacturing_food_processing: "Compressed air".
0.500
actadministrationannualauthorizationbusinessbusinessescertificationhomeindustryinspectionlargelicensemeasuresoperateoperationspolicyprofessionalsprogramsregulatedregulatory
SHARED TOKENS (26): "act", "administration", "annual", "authorization", "business", "businesses", "certification", "home", "industry", "inspection", "large", "license", "measures", "operate", "operations", "policy", "professionals", "programs", "regulated", "regulatory".... | EXACT TITLE in beauty_salon: "Small business".
0.500
Franchising ↗ Q171947 EXACT TITLE
brandbrandedbusinesscapitalchainconditionscorporatedirecteconomicentityexpansionexplicitlyfeesfinancialinvestmentlargelegallicenseslicensingmarket
SHARED TOKENS (34): "brand", "branded", "business", "capital", "chain", "conditions", "corporate", "direct", "economic", "entity", "expansion", "explicitly", "fees", "financial", "investment", "large", "legal", "licenses", "licensing", "market".... | EXACT TITLE in beauty_salon: "Franchising".
0.500
additionalcreateeconomicexposuregeneralhealthhygieneinjuryjurisdictionlawoccupationalofficialproductprogramspublicrelatedsafetyspecificwelfarework
SHARED TOKENS (20): "additional", "create", "economic", "exposure", "general", "health", "hygiene", "injury", "jurisdiction", "law", "occupational", "official", "product", "programs", "public", "related", "safety", "specific", "welfare", "work". | EXACT TITLE in beauty_salon: "Occupational safety and health".
0.500
activeagainstapplicationsbuildingchainchainsconditionsconsumerconsumptioncontrolleddevelopeddevelopmentformsindustryinfrastructureinvolvinglargelargerlimitedmarket
SHARED TOKENS (41): "active", "against", "applications", "building", "chain", "chains", "conditions", "consumer", "consumption", "controlled", "developed", "development", "forms", "industry", "infrastructure", "involving", "large", "larger", "limited", "market".... | EXACT TITLE in manufacturing_food_processing: "Refrigeration".
0.500
actadministrationagencyauthoritycommercialdepartmentfederalhealthinspectionjurisdictionproductspublicregulatorysafesafetysubjectsupply
SHARED TOKENS (17): "act", "administration", "agency", "authority", "commercial", "department", "federal", "health", "inspection", "jurisdiction", "products", "public", "regulatory", "safe", "safety", "subject", "supply". | EXACT TITLE in manufacturing_food_processing: "Food Safety and Inspection Service".
0.500
activitybusinesseconomicemployeremploymentevenindependentissueoperateplacingratherrealthereforetradeviewwork
SHARED TOKENS (16): "activity", "business", "economic", "employer", "employment", "even", "independent", "issue", "operate", "placing", "rather", "real", "therefore", "trade", "view", "work". | EXACT TITLE in beauty_salon: "Self-employment".
0.500
academicboisecampuscareercollegecreditdevelopmenteducationgovernedidaholargenampanorthprimaryprogramspublicreportedstudentstechnicalthroughout
SHARED TOKENS (24): "academic", "boise", "campus", "career", "college", "credit", "development", "education", "governed", "idaho", "large", "nampa", "north", "primary", "programs", "public", "reported", "students", "technical", "throughout".... | EXACT TITLE in manufacturing_food_processing: "College of Western Idaho".
0.500
Plumbing ↗ Q3241671 EXACT TITLE
amongapplicationsdevelopedhealthhvacinfrastructurelimitedplumbersplumbingpublicsanitationsystemsystemstradeuseswastework
SHARED TOKENS (17): "among", "applications", "developed", "health", "hvac", "infrastructure", "limited", "plumbers", "plumbing", "public", "sanitation", "system", "systems", "trade", "uses", "waste", "work". | EXACT TITLE in beauty_salon: "Plumbing". | EXACT TITLE in manufacturing_food_processing: "Plumbing".
0.500
actadministrationagencyassociatedauthoritycontrolcosmeticcurrentdepartmentdirectlyfederalformerheadquartershealthofficesprimaryproductspublicregulatedregulations
SHARED TOKENS (26): "act", "administration", "agency", "associated", "authority", "control", "cosmetic", "current", "department", "directly", "federal", "former", "headquarters", "health", "offices", "primary", "products", "public", "regulated", "regulations".... | EXACT TITLE in manufacturing_food_processing: "Food and Drug Administration".
0.500
additionalagainstauthorizationcreditcustomersenablesfederalfinancialhistoryinformationissuemeasuresoperationprocessorsreceivedsupplysystemtransactionverified
SHARED TOKENS (19): "additional", "against", "authorization", "credit", "customers", "enables", "federal", "financial", "history", "information", "issue", "measures", "operation", "processors", "received", "supply", "system", "transaction", "verified". | EXACT TITLE in beauty_salon: "Payment processor".
0.500
analysisapplicationcontrolcreatedatadistinguisheffectsengineeringestablisheventformgraphhealthcareidentifyingindustryoperationsprocessrecurringunderlying
SHARED TOKENS (19): "analysis", "application", "control", "create", "data", "distinguish", "effects", "engineering", "establish", "event", "form", "graph", "healthcare", "identifying", "industry", "operations", "process", "recurring", "underlying". | EXACT TITLE in manufacturing_food_processing: "Root-cause analysis".
0.500
analysisapplicationscontroldistinctengineeringexistingexpertiseformfunctionsguidanceindustryinformationinspectionintegratedplanningprocessproductsproviderealrequirements
SHARED TOKENS (22): "analysis", "applications", "control", "distinct", "engineering", "existing", "expertise", "form", "functions", "guidance", "industry", "information", "inspection", "integrated", "planning", "process", "products", "provide", "real", "requirements".... | EXACT TITLE in manufacturing_food_processing: "Machine vision".
0.500
aloneavailabilitycoursedemandeconomiceffectsimpactslargemakingneedotherwisepracticesproducingsystemswaste
SHARED TOKENS (15): "alone", "availability", "course", "demand", "economic", "effects", "impacts", "large", "making", "need", "otherwise", "practices", "producing", "systems", "waste". | EXACT TITLE in manufacturing_food_processing: "Animal feed".
0.500
accessactiveactsadditionalcategorieschemicaleconomicencompassingoperationalphysicalproductsprotectionqualitysafetysystem
SHARED TOKENS (15): "access", "active", "acts", "additional", "categories", "chemical", "economic", "encompassing", "operational", "physical", "products", "protection", "quality", "safety", "system". | EXACT TITLE in manufacturing_food_processing: "Food defense".
0.500
activityaddressauthorizationbusinessclosejurisdictionlicenselicenseslocalmultipleoperateoperatingpermitsphysicalrequiressingle
SHARED TOKENS (16): "activity", "address", "authorization", "business", "close", "jurisdiction", "license", "licenses", "local", "multiple", "operate", "operating", "permits", "physical", "requires", "single". | EXACT TITLE in beauty_salon: "Business license". | EXACT TITLE in manufacturing_food_processing: "Business license".
0.500
authoritybuildingbusinesscapitalcenterscombinecommercialcontainingestatefloorfunctionsinvestmentlocalmultipleofficespropertyrealregulationsresidentialretail
SHARED TOKENS (23): "authority", "building", "business", "capital", "centers", "combine", "commercial", "containing", "estate", "floor", "functions", "investment", "local", "multiple", "offices", "property", "real", "regulations", "residential", "retail".... | EXACT TITLE in beauty_salon: "Commercial property".
0.480
Laundry ↗ Q852100 EXACT TITLE
buildingbusinesscommercialdifferentestablishmentsfacilityhistoryhomeneednorthoutsideroomwashingwork
SHARED TOKENS (14): "building", "business", "commercial", "different", "establishments", "facility", "history", "home", "need", "north", "outside", "room", "washing", "work". | EXACT TITLE in beauty_salon: "Laundry".
0.480
activeapplicationconditionseconomiclinkmanagementneedpathwayspracticepracticesqualitysitesourcespecific
SHARED TOKENS (14): "active", "application", "conditions", "economic", "link", "management", "need", "pathways", "practice", "practices", "quality", "site", "source", "specific". | EXACT TITLE in manufacturing_food_processing: "Nutrient management".
0.480
businessbusinessescommercialcreatedecisionsfamilyfirmsidentifiedinfluencemanagementmultipleownershiprelatedrelationships
SHARED TOKENS (14): "business", "businesses", "commercial", "create", "decisions", "family", "firms", "identified", "influence", "management", "multiple", "ownership", "related", "relationships". | EXACT TITLE in beauty_salon: "Family business".
0.460
applicableapplicationchaindevelopmentdocumentedhealthcarehistoryidentificationinformationmeansrecordedsupplyverify
SHARED TOKENS (13): "applicable", "application", "chain", "development", "documented", "healthcare", "history", "identification", "information", "means", "recorded", "supply", "verify". | EXACT TITLE in manufacturing_food_processing: "Traceability".
0.460
Skin care ↗ Q1294114 EXACT TITLE
chemicalsconditionsexposurehealthmanagementpracticepracticesprocessproductsprofessionalsregulatedsupportwashing
SHARED TOKENS (13): "chemicals", "conditions", "exposure", "health", "management", "practice", "practices", "process", "products", "professionals", "regulated", "support", "washing". | EXACT TITLE in beauty_salon: "Skin care".
0.460
Frozen food ↗ Q751728 EXACT TITLE
agencyindustrymaintainspreservesprocessesproductqualityreportedstandardsstructuresupportingtechnologywaste
SHARED TOKENS (13): "agency", "industry", "maintains", "preserves", "processes", "product", "quality", "reported", "standards", "structure", "supporting", "technology", "waste". | EXACT TITLE in manufacturing_food_processing: "Frozen food".
0.460
annualapproximatelybureaubusinessbusinessesdocumentedemploymentestablishmentslaboroccupationalofficesregionalwage
SHARED TOKENS (13): "annual", "approximately", "bureau", "business", "businesses", "documented", "employment", "establishments", "labor", "occupational", "offices", "regional", "wage". | EXACT TITLE in beauty_salon: "Occupational Employment and Wage Statistics".
0.460
Cosmetics ↗ Q131207 EXACT TITLE
applicationapprovalchemicalcommercialcompoundscosmeticdifferenthealthproductsregulationsregulatoryrequiresafety
SHARED TOKENS (13): "application", "approval", "chemical", "commercial", "compounds", "cosmetic", "different", "health", "products", "regulations", "regulatory", "require", "safety". | EXACT TITLE in beauty_salon: "Cosmetics".
0.440
Manicure ↗ Q747493 EXACT TITLE
applicationcosmeticedgefeethomelicensedregulationssanitationsmalltechniciansthereforetreatment
SHARED TOKENS (12): "application", "cosmetic", "edge", "feet", "home", "licensed", "regulations", "sanitation", "small", "technicians", "therefore", "treatment". | EXACT TITLE in beauty_salon: "Manicure".
0.440
analysischemicalcompoundsdemandmaterialmeasuresorganicratherreceivingremovespecifictreatment
SHARED TOKENS (12): "analysis", "chemical", "compounds", "demand", "material", "measures", "organic", "rather", "receiving", "remove", "specific", "treatment". | EXACT TITLE in manufacturing_food_processing: "Biochemical oxygen demand".
0.420
contactcontrolcoveringengineeringhazardsinjurymeansoperatingoperationsoperatorssafety
SHARED TOKENS (11): "contact", "control", "covering", "engineering", "hazards", "injury", "means", "operating", "operations", "operators", "safety". | EXACT TITLE in manufacturing_food_processing: "Machine guarding".
0.420
Onion ↗ Q23485 EXACT TITLE
annualcentralchemicalcloseformmultipleregionsscaleseparatestoragetreated
SHARED TOKENS (11): "annual", "central", "chemical", "close", "form", "multiple", "regions", "scale", "separate", "storage", "treated". | EXACT TITLE in manufacturing_food_processing: "Onion".
0.420
administrationclaimscompoundshealthinfluencejurisdictionlegalproductsregulatedregulatorytreatment
SHARED TOKENS (11): "administration", "claims", "compounds", "health", "influence", "jurisdiction", "legal", "products", "regulated", "regulatory", "treatment". | EXACT TITLE in manufacturing_food_processing: "Nutraceutical".
0.420
differentexposurefeetmakingmusculoskeletalrepetitivestrainstructuressupportsystemsystems
SHARED TOKENS (11): "different", "exposure", "feet", "making", "musculoskeletal", "repetitive", "strain", "structures", "support", "system", "systems". | EXACT TITLE in manufacturing_food_processing: "Musculoskeletal disorder".
0.400
Acetone ↗ Q49546 EXACT TITLE
buildinghomeindustrylargerorganicprocessesproductssmallstatusvolatile
SHARED TOKENS (10): "building", "home", "industry", "larger", "organic", "processes", "products", "small", "status", "volatile". | EXACT TITLE in beauty_salon: "Acetone".
0.400
Lactalis ↗ Q1799825 EXACT TITLE
approximatelybrandsbusinessfamilyformermarketsorganicownedproductssales
SHARED TOKENS (10): "approximately", "brands", "business", "family", "former", "markets", "organic", "owned", "products", "sales". | EXACT TITLE in manufacturing_food_processing: "Lactalis".
0.400
Employment ↗ EXACT TITLE
annualconditionsemployeeemployeremploymententityhealthpowersectorwork
SHARED TOKENS (10): "annual", "conditions", "employee", "employer", "employment", "entity", "health", "power", "sector", "work". | EXACT TITLE in beauty_salon: "Employment". | EXACT TITLE in manufacturing_food_processing: "Employment".
0.400
Stormwater ↗ Q1421263 EXACT TITLE
createdemanddevelopeddirectlyfallslargemajorrelatedtreatmentwritten
SHARED TOKENS (10): "create", "demand", "developed", "directly", "falls", "large", "major", "related", "treatment", "written". | EXACT TITLE in manufacturing_food_processing: "Stormwater".
0.400
boisecenterschaincomfoundedidaholistoperatedownedretail
SHARED TOKENS (10): "boise", "centers", "chain", "com", "founded", "idaho", "list", "operated", "owned", "retail". | EXACT TITLE in manufacturing_food_processing: "WinCo Foods".
0.400
buildingbusinessinfrastructuremaintenancemeaningoperationalpracticesresidentialsupportingtechnical
SHARED TOKENS (10): "building", "business", "infrastructure", "maintenance", "meaning", "operational", "practices", "residential", "supporting", "technical". | EXACT TITLE in beauty_salon: "Maintenance". | EXACT TITLE in manufacturing_food_processing: "Maintenance".
0.400
Beauty ↗ Q7242 EXACT TITLE
connectiondefiningdescribedintegratedpropertyrathersidestandardssubjecttoward
SHARED TOKENS (10): "connection", "defining", "described", "integrated", "property", "rather", "side", "standards", "subject", "toward". | EXACT TITLE in beauty_salon: "Beauty".
0.400
Oncology ↗ Q162555 EXACT TITLE
amongdescribedformfoundpracticesprofessionalquestionsresearchspecialtytreatment
SHARED TOKENS (10): "among", "described", "form", "found", "practices", "professional", "questions", "research", "specialty", "treatment". | EXACT TITLE in beauty_salon: "Oncology".
0.400
Potato ↗ Q10998 EXACT TITLE
differentexpansionfamilyfoundregionremainssecondshowsinglesupply
SHARED TOKENS (10): "different", "expansion", "family", "found", "region", "remains", "second", "show", "single", "supply". | EXACT TITLE in manufacturing_food_processing: "Potato".
0.400
Cheese ↗ Q10943 EXACT TITLE
activityexpertiseformslayermarketsprocessingproductreceivingstoragethroughout
SHARED TOKENS (10): "activity", "expertise", "forms", "layer", "markets", "processing", "product", "receiving", "storage", "throughout". | EXACT TITLE in manufacturing_food_processing: "Cheese".
0.380
agencyboisedepartmentfederalidahoofficesqualityregionalregulations
SHARED TOKENS (9): "agency", "boise", "department", "federal", "idaho", "offices", "quality", "regional", "regulations". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Environmental Quality".
0.380
Facial ↗ Q2667974 EXACT TITLE
chemicalconditionsfamilygeneralhealthinvolvingphysicalspecifictreatment
SHARED TOKENS (9): "chemical", "conditions", "family", "general", "health", "involving", "physical", "specific", "treatment". | EXACT TITLE in beauty_salon: "Facial".
0.380
Dermatology ↗ Q171171 EXACT TITLE
advancedbeyondconditionscosmeticphysicalrelatedrequiringspecialtytraining
SHARED TOKENS (9): "advanced", "beyond", "conditions", "cosmetic", "physical", "related", "requiring", "specialty", "training". | EXACT TITLE in beauty_salon: "Dermatology".
0.380
agencydepartmentdevelopmenteconomicidaholaborprocessestechnologyworkforce
SHARED TOKENS (9): "agency", "department", "development", "economic", "idaho", "labor", "processes", "technology", "workforce". | EXACT TITLE in beauty_salon: "Idaho Department of Labor". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Labor".
0.380
controldesignelectricalengineeringproductstandardsystemstechnicaltechnology
SHARED TOKENS (9): "control", "design", "electrical", "engineering", "product", "standard", "systems", "technical", "technology". | EXACT TITLE in manufacturing_food_processing: "Mechatronics".
0.380
Cattle ↗ Q830 EXACT TITLE
centraldistributedeventfoundlargeproductsseparatesmallwestern
SHARED TOKENS (9): "central", "distributed", "event", "found", "large", "products", "separate", "small", "western". | EXACT TITLE in manufacturing_food_processing: "Cattle".
0.370
Simplot ↗ Q3484788 EXACT TITLE
boiseidaho
SHARED TOKENS (2): "boise", "idaho". | URL->B (1): https://www.simplot.com/company. | EXACT TITLE in manufacturing_food_processing: "Simplot".
0.360
Nail salon ↗ Q8007048 EXACT TITLE
establishmentformalgeneralholdspecialtytechniciansthroughoutwork
SHARED TOKENS (8): "establishment", "formal", "general", "hold", "specialty", "technicians", "throughout", "work". | EXACT TITLE in beauty_salon: "Nail salon".
0.360
Electrician ↗ Q165029 EXACT TITLE
dataelectricalexistinginfrastructuremaintenancemobileplatformsrelated
SHARED TOKENS (8): "data", "electrical", "existing", "infrastructure", "maintenance", "mobile", "platforms", "related". | EXACT TITLE in beauty_salon: "Electrician".
0.360
Shampoo ↗ Q180204 EXACT TITLE
actscombiningconditionsformproductremoveseparateusers
SHARED TOKENS (8): "acts", "combining", "conditions", "form", "product", "remove", "separate", "users". | EXACT TITLE in beauty_salon: "Shampoo".
0.360
controlfoundinvolvingmakingphysicalprocessrelatedsystems
SHARED TOKENS (8): "control", "found", "involving", "making", "physical", "process", "related", "systems". | EXACT TITLE in manufacturing_food_processing: "Instrumentation".
0.360
cosmeticcreatehomepracticeprocessesreportedsalesspecific
SHARED TOKENS (8): "cosmetic", "create", "home", "practice", "processes", "reported", "sales", "specific". | EXACT TITLE in beauty_salon: "Hair coloring".
0.360
applicationlicensemakingoccupationalprocessesspecialtytreatmentwage
SHARED TOKENS (8): "application", "license", "making", "occupational", "processes", "specialty", "treatment", "wage". | EXACT TITLE in beauty_salon: "Cosmetology".
0.360
chemicalcontrolledinjuryprocessproviderremovetreatedtreatment
SHARED TOKENS (8): "chemical", "controlled", "injury", "process", "provider", "remove", "treated", "treatment". | EXACT TITLE in beauty_salon: "Chemical peel".
0.360
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingbusinessesdirectlyfacilitylargematerialsstandard
SHARED TOKENS (8): "associated", "building", "businesses", "directly", "facility", "large", "materials", "standard". | EXACT TITLE in manufacturing_food_processing: "Warehouse".
0.340
differentfeetformsmeaningprocessregionsremove
SHARED TOKENS (7): "different", "feet", "forms", "meaning", "process", "regions", "remove". | EXACT TITLE in beauty_salon: "Hair removal".
0.340
Barber ↗ Q107198 EXACT TITLE
cuttingdevelopmentplacespublicsafetywhosework
SHARED TOKENS (7): "cutting", "development", "places", "public", "safety", "whose", "work". | EXACT TITLE in beauty_salon: "Barber".
0.340
chemicalsdistinctformsmeansprocessratherspecific
SHARED TOKENS (7): "chemicals", "distinct", "forms", "means", "process", "rather", "specific". | EXACT TITLE in beauty_salon: "Sterilization (microbiology)".
0.340
boiseidahometropolitanowyheeregiontreasurevalley
SHARED TOKENS (7): "boise", "idaho", "metropolitan", "owyhee", "region", "treasure", "valley". | EXACT TITLE in manufacturing_food_processing: "Southwestern Idaho".
0.340
Chorizo ↗ Q23374 EXACT TITLE
differentnamesnationalproductsquestionregionalrequiring
SHARED TOKENS (7): "different", "names", "national", "products", "question", "regional", "requiring". | EXACT TITLE in manufacturing_food_processing: "Chorizo".
0.340
Sausage ↗ Q131419 EXACT TITLE
makingmaterialsnationalpreparationprocessingproductregional
SHARED TOKENS (7): "making", "materials", "national", "preparation", "processing", "product", "regional". | EXACT TITLE in manufacturing_food_processing: "Sausage".
0.320
Salami ↗ Q188655 EXACT TITLE
amongcentralhistoricallyregionsroomsupply
SHARED TOKENS (6): "among", "central", "historically", "regions", "room", "supply". | EXACT TITLE in manufacturing_food_processing: "Salami".
0.320
Anthocyanin ↗ Q262547 EXACT TITLE
amongappearchemicalpathwaysafeverified
SHARED TOKENS (6): "among", "appear", "chemical", "pathway", "safe", "verified". | EXACT TITLE in manufacturing_food_processing: "Anthocyanin".
0.320
Butcher ↗ Q329737 EXACT TITLE
establishmentsmarketspreparationretailstandardwholesale
SHARED TOKENS (6): "establishments", "markets", "preparation", "retail", "standard", "wholesale". | EXACT TITLE in manufacturing_food_processing: "Butcher".
0.320
Hair loss ↗ Q181391 EXACT TITLE
eventexperienceneedsmalltreatedtreatment
SHARED TOKENS (6): "event", "experience", "need", "small", "treated", "treatment". | EXACT TITLE in beauty_salon: "Hair loss".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in beauty_salon: "Idaho Department of Health and Welfare". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Health and Welfare".
0.320
Purée ↗ Q636056 EXACT TITLE
broadernamesprocessesratherremovespecific
SHARED TOKENS (6): "broader", "names", "processes", "rather", "remove", "specific". | EXACT TITLE in manufacturing_food_processing: "Purée".
0.320
Milk ↗ Q8495 EXACT TITLE
againstprimaryproductproductssourcesystem
SHARED TOKENS (6): "against", "primary", "product", "products", "source", "system". | EXACT TITLE in manufacturing_food_processing: "Milk".
0.320
chemicalchemicalsdistinguishformsmeansprocess
SHARED TOKENS (6): "chemical", "chemicals", "distinguish", "forms", "means", "process". | EXACT TITLE in beauty_salon: "Perm (hairstyle)". | EXACT TITLE in manufacturing_food_processing: "Perm (hairstyle)".
0.320
Allergen ↗ Q186752 EXACT TITLE
againsthealthmaintainsotherwisesignificanttechnical
SHARED TOKENS (6): "against", "health", "maintains", "otherwise", "significant", "technical". | EXACT TITLE in manufacturing_food_processing: "Allergen".
0.320
boiseeagleidahoprocessingprocessorsproducts
SHARED TOKENS (6): "boise", "eagle", "idaho", "processing", "processors", "products". | EXACT TITLE in manufacturing_food_processing: "Lamb Weston".
0.320
businessdevelopmentestateindustryofficesrather
SHARED TOKENS (6): "business", "development", "estate", "industry", "offices", "rather". | EXACT TITLE in manufacturing_food_processing: "Industrial park".
0.300
allowedbeginningcontroldevelopeddirectexpansiongeneralhealthhistoryindustrylargemeasurespipelineprocessedproductregionsscalesmallsubstantialsystems
SHARED TOKENS (24): "allowed", "beginning", "control", "developed", "direct", "expansion", "general", "health", "history", "industry", "large", "measures", "pipeline", "processed", "product", "regions", "scale", "small", "substantial", "systems"....
0.300
Fire safety ↗ Q2997557 KW CROSS HIGH
alreadybuildingcodesconstructiondepartmentdivisioneventfirehazardhazardsmeasurespracticessafetyschoolsstructures
SHARED TOKENS (15): "already", "building", "codes", "construction", "department", "division", "event", "fire", "hazard", "hazards", "measures", "practices", "safety", "schools", "structures".
0.300
electricalpracticeprocessprofessionalremove
SHARED TOKENS (5): "electrical", "practice", "process", "professional", "remove". | EXACT TITLE in beauty_salon: "Electrology".
0.300
Wheat ↗ Q15645384 KW CROSS HIGH
demandgeneralindustrylargermajormakingmultiplenorthqualityrecordregionssecondsmallsourcetradetrigger
SHARED TOKENS (16): "demand", "general", "industry", "larger", "major", "making", "multiple", "north", "quality", "record", "regions", "second", "small", "source", "trade", "trigger".
0.300
Bleach ↗ Q11587 KW CROSS HIGH
activechemicalchemicalscompoundsconditionscontactcontainingcontrolgenerichealthmakingmaterialsnicheorganicplacesprocessprocessesproductproductsremove
SHARED TOKENS (23): "active", "chemical", "chemicals", "compounds", "conditions", "contact", "containing", "control", "generic", "health", "making", "materials", "niche", "organic", "places", "process", "processes", "product", "products", "remove"....
0.300
actadministrationanalysischainchemicalcontrolcontrolsdepartmentdesigneffectsestablishingfirmshazardhazardshealthindustryinspectionmeasuresnationaloutside
SHARED TOKENS (38): "act", "administration", "analysis", "chain", "chemical", "control", "controls", "department", "design", "effects", "establishing", "firms", "hazard", "hazards", "health", "industry", "inspection", "measures", "national", "outside"....
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmenteconomyemploymentexpansionlawlocalmeetnationalobtainpermitpermitsplanplanning
SHARED TOKENS (24): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "economy", "employment", "expansion", "law", "local", "meet", "national", "obtain", "permit", "permits", "plan", "planning"....
0.300
Wastewater ↗ Q336191 EXACT TITLE
applicationscommercialmunicipalprocesseswaste
SHARED TOKENS (5): "applications", "commercial", "municipal", "processes", "waste". | EXACT TITLE in manufacturing_food_processing: "Wastewater".
0.300
activityadministrationadministrativecontroldecisionsdivisioneconomiceducationenforcementgoverninginfluencelawlegalmodelpublicregulationsreviewrulemakingrulessector
SHARED TOKENS (24): "activity", "administration", "administrative", "control", "decisions", "division", "economic", "education", "enforcement", "governing", "influence", "law", "legal", "model", "public", "regulations", "review", "rulemaking", "rules", "sector"....
0.300
availabilityconsumerconsumersfeegeneralinformationmultipleoperatorprimaryprocessprocessedproductproductsregisterretailretailerssinglesitespecificusers
SHARED TOKENS (20): "availability", "consumer", "consumers", "fee", "general", "information", "multiple", "operator", "primary", "process", "processed", "product", "products", "register", "retail", "retailers", "single", "site", "specific", "users".
0.300
chaincombineconsolidationconsumersdescribeddifferentdirectlyeconomyintegratedlargemakingmanagementmarketmeasuresneedownedownershipproductproductsrather
SHARED TOKENS (24): "chain", "combine", "consolidation", "consumers", "described", "different", "directly", "economy", "integrated", "large", "making", "management", "market", "measures", "need", "owned", "ownership", "product", "products", "rather"....
0.300
Slaughterhouse ↗ Q385557 KW CROSS HIGH
consumptiondifferentfacilityhealthindustrylargelogisticsmeetpreparationprocessprovidepublicrequirementsscalesignificantsupplywelfarework
SHARED TOKENS (18): "consumption", "different", "facility", "health", "industry", "large", "logistics", "meet", "preparation", "process", "provide", "public", "requirements", "scale", "significant", "supply", "welfare", "work".
0.300
Whey ↗ Q185009 EXACT TITLE
chaincommercialmakingproductsuses
SHARED TOKENS (5): "chain", "commercial", "making", "products", "uses". | EXACT TITLE in manufacturing_food_processing: "Whey".
0.300
Boiler ↗ EXACT TITLE
applicationscentralpowerprocessessanitation
SHARED TOKENS (5): "applications", "central", "power", "processes", "sanitation". | EXACT TITLE in manufacturing_food_processing: "Boiler".
0.300
accessaddressaddressingalreadyamongbusinessescapacitydevelopmenteconomiceducationformformalformsfoundedhistoricallyhistoryhomeindustryneedneighborhood
SHARED TOKENS (39): "access", "address", "addressing", "already", "among", "businesses", "capacity", "development", "economic", "education", "form", "formal", "forms", "founded", "historically", "history", "home", "industry", "need", "neighborhood"....
0.300
actaddressaddressingadministrationagencyauthorityfederalguidanceindustryissuelawlegalmajorprocessedreportedreportsrequiressafetysalesstandards
SHARED TOKENS (20): "act", "address", "addressing", "administration", "agency", "authority", "federal", "guidance", "industry", "issue", "law", "legal", "major", "processed", "reported", "reports", "requires", "safety", "sales", "standards".
0.300
analysisbusinessesconnectionconsumerconsumerscontactcustomercustomersdatadedicateddifferentdirectinformationmanagementmarketmaterialsmediaoperationspatternsprocedures
SHARED TOKENS (25): "analysis", "businesses", "connection", "consumer", "consumers", "contact", "customer", "customers", "data", "dedicated", "different", "direct", "information", "management", "market", "materials", "media", "operations", "patterns", "procedures"....
0.300
Raspberry ↗ Q13179 EXACT TITLE
appliesfamilynorthpreservestotal
SHARED TOKENS (5): "applies", "family", "north", "preserves", "total". | EXACT TITLE in manufacturing_food_processing: "Raspberry".
0.300
assistancebroaderbusinesscannotexpansionfacilitiesfacilityfederalhealthhomeindustryinformationlimitedmeansmodeloutsideownedprovideproviderpublicly
SHARED TOKENS (31): "assistance", "broader", "business", "cannot", "expansion", "facilities", "facility", "federal", "health", "home", "industry", "information", "limited", "means", "model", "outside", "owned", "provide", "provider", "publicly"....
0.300
businesscertificationcodecombinesconditionsconventionalconversioncreateeffectsformimpactsmultipleorganicpracticesprocessesprotectionsignificantsimultaneouslystandardssystems
SHARED TOKENS (21): "business", "certification", "code", "combines", "conditions", "conventional", "conversion", "create", "effects", "form", "impacts", "multiple", "organic", "practices", "processes", "protection", "significant", "simultaneously", "standards", "systems"....
0.300
academicbroaderdirectlyeducationenterinstitutionjoboccupationspreparationprofessionalprovideratherschoolsskillsspecificstudentstechnicaltowardtradetraining
SHARED TOKENS (21): "academic", "broader", "directly", "education", "enter", "institution", "job", "occupations", "preparation", "professional", "provide", "rather", "schools", "skills", "specific", "students", "technical", "toward", "trade", "training"....
0.300
applicationschainconsumercustomersdifferentfloorfoundhandlinginvolvingmaterialmaterialsmovespowersystemsystems
SHARED TOKENS (15): "applications", "chain", "consumer", "customers", "different", "floor", "found", "handling", "involving", "material", "materials", "moves", "power", "system", "systems".
0.300
actactivityamongconsumptioncontrolcontrolleddescribeseconomicevenfederalfoundjurisdictionpowersectionseparatesourcespecific
SHARED TOKENS (17): "act", "activity", "among", "consumption", "control", "controlled", "describes", "economic", "even", "federal", "found", "jurisdiction", "power", "section", "separate", "source", "specific".
0.300
applicationscentralchemicalcompoundsdemonstratingeffectsformformslinkedorganicpreparationprocessprocessesproductsresultingsafetysharesignificantsystem
SHARED TOKENS (19): "applications", "central", "chemical", "compounds", "demonstrating", "effects", "form", "forms", "linked", "organic", "preparation", "process", "processes", "products", "resulting", "safety", "share", "significant", "system".
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
acquiredadditionalallowedapplicationassistancebusinessesconditionsconsumerdatadedicateddevelopedfeetfoundlocalmobileownersparkingplanningplatformprogram
SHARED TOKENS (29): "acquired", "additional", "allowed", "application", "assistance", "businesses", "conditions", "consumer", "data", "dedicated", "developed", "feet", "found", "local", "mobile", "owners", "parking", "planning", "platform", "program"....
0.300
acquisitionactactivitybusinesscapitalcentralcombineconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteconomicallyeffectsenablesentityfederal
SHARED TOKENS (39): "acquisition", "act", "activity", "business", "capital", "central", "combine", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "economically", "effects", "enables", "entity", "federal"....
0.300
Water pollution ↗ KW CROSS HIGH
conditionscontrolformformsinfrastructuremanagementmixorganicpowerproductsrequiressanitationtechnologytreatmentwaste
SHARED TOKENS (15): "conditions", "control", "form", "forms", "infrastructure", "management", "mix", "organic", "power", "products", "requires", "sanitation", "technology", "treatment", "waste".
0.300
actanalysisapplicationauthoritycannotcategorycreatedatadecisionsdescribesdesigndifferententerevenexistingexpertiseformsgeneralhealthcarehistorical
SHARED TOKENS (42): "act", "analysis", "application", "authority", "cannot", "category", "create", "data", "decisions", "describes", "design", "different", "enter", "even", "existing", "expertise", "forms", "general", "healthcare", "historical"....
0.300
connectedcontrolcustomerdatafeesinfluencemanagementmarketsnodesproductproductsrelatedremovereputationreviewspacesystems
SHARED TOKENS (17): "connected", "control", "customer", "data", "fees", "influence", "management", "markets", "nodes", "product", "products", "related", "remove", "reputation", "review", "space", "systems".
0.300
agencydepartmenteducationemployeeenforcementestablishingestablishmentfederalfinancialheadquartersindependentinformationjulylegallocalmeasuresnationalofficesoperationpermitting
SHARED TOKENS (28): "agency", "department", "education", "employee", "enforcement", "establishing", "establishment", "federal", "financial", "headquarters", "independent", "information", "july", "legal", "local", "measures", "national", "offices", "operation", "permitting"....
0.300
Waxing ↗ Q269107 EXACT TITLE
coveringdifferentfeetformprocess
SHARED TOKENS (5): "covering", "different", "feet", "form", "process". | EXACT TITLE in beauty_salon: "Waxing".
0.300
acquisitionassociatedchemicalcontroldatadistributedfunctionslargelargerpowerprocessprocessingsmallsystemsystemsthough
SHARED TOKENS (16): "acquisition", "associated", "chemical", "control", "data", "distributed", "functions", "large", "larger", "power", "process", "processing", "small", "system", "systems", "though".
0.300
administrativeagencybuildingclassificationcommercialconstructiondesigndevelopmentexistingfunctionsinstitutionalintegratedmixed-usemultipleneighborhoodplanningpolicyprivateresidentialsingle
SHARED TOKENS (24): "administrative", "agency", "building", "classification", "commercial", "construction", "design", "development", "existing", "functions", "institutional", "integrated", "mixed-use", "multiple", "neighborhood", "planning", "policy", "private", "residential", "single"....
0.300
Food allergy ↗ KW CROSS HIGH
againstamongappearchemicalsconditionsdevelopeddevelopmentexposurefamilyhistorymanagementplanquestionseparatesystem
SHARED TOKENS (15): "against", "among", "appear", "chemicals", "conditions", "developed", "development", "exposure", "family", "history", "management", "plan", "question", "separate", "system".
0.300
aloneamongbusinessbusinessesconnectconsumptioncorecreatecurrentcustomersdefineseconomyexistingextensionfirmsidentifiedmarketmaterialmaterialsmodel
SHARED TOKENS (31): "alone", "among", "business", "businesses", "connect", "consumption", "core", "create", "current", "customers", "defines", "economy", "existing", "extension", "firms", "identified", "market", "material", "materials", "model"....
0.300
aloneanalysisannualbuildingcompoundscontrolexposureformhazardhealthinfluenceinsidelinkedmajororganicphysicalprimaryqualityschoolssource
SHARED TOKENS (25): "alone", "analysis", "annual", "building", "compounds", "control", "exposure", "form", "hazard", "health", "influence", "inside", "linked", "major", "organic", "physical", "primary", "quality", "schools", "source"....
0.300
academicappliesauthoritybrandbroaderinformationinfrastructuremultiplenewsorganicpracticeproductsqualityrathertechnicaltrafficusersverticalvisibility
SHARED TOKENS (19): "academic", "applies", "authority", "brand", "broader", "information", "infrastructure", "multiple", "news", "organic", "practice", "products", "quality", "rather", "technical", "traffic", "users", "vertical", "visibility".
0.300
academicamongconnectscontroldepartmenthealthhealthcareinfrastructurelocalmeasurespracticalpracticeprotectionpublicpublishesratherrelatedsafetysystemwashing
SHARED TOKENS (20): "academic", "among", "connects", "control", "department", "health", "healthcare", "infrastructure", "local", "measures", "practical", "practice", "protection", "public", "publishes", "rather", "related", "safety", "system", "washing".
0.300
Food industry ↗ Q540912 KW CROSS HIGH
academicagencybusinesseschemicalsconstructionconsumerscreditdescribesdevelopmentdirectlydominanteconomiceducationengineeringestablishmentsfinancialfirmsgenericindustrylarge
SHARED TOKENS (58): "academic", "agency", "businesses", "chemicals", "construction", "consumers", "credit", "describes", "development", "directly", "dominant", "economic", "education", "engineering", "establishments", "financial", "firms", "generic", "industry", "large"....
0.300
agencyapproximatelyassistancecommercialcurrentdepartmentdirectlyfederalmeetnationalprogramprogramsreportssafetytrade
SHARED TOKENS (15): "agency", "approximately", "assistance", "commercial", "current", "department", "directly", "federal", "meet", "national", "program", "programs", "reports", "safety", "trade".
0.300
accountadvancedapplicationapproximatelyavailabilitybusinessesconnectedconstructioncostsdemanddesigndevelopeddifferenteveninvolvinglargemanagementmunicipalneednetwork
SHARED TOKENS (35): "account", "advanced", "application", "approximately", "availability", "businesses", "connected", "construction", "costs", "demand", "design", "developed", "different", "even", "involving", "large", "management", "municipal", "need", "network"....
0.300
alongsideauthorityclaimsconsumerconsumersdevelopedevenhealthinformationlistlistingslocalmarketsnamesnorthproductprovidepublicqualityregions
SHARED TOKENS (28): "alongside", "authority", "claims", "consumer", "consumers", "developed", "even", "health", "information", "list", "listings", "local", "markets", "names", "north", "product", "provide", "public", "quality", "regions"....
0.300
analysisbusinesschaincombinescuttingdesigneducationengineeringhealthcareinformationintegratedknowledgelaborlogisticsmanagementmaterialsoperationsphysicalprocessprocesses
SHARED TOKENS (31): "analysis", "business", "chain", "combines", "cutting", "design", "education", "engineering", "healthcare", "information", "integrated", "knowledge", "labor", "logistics", "management", "materials", "operations", "physical", "process", "processes"....
0.300
applieschemicalcompoundsdescribesfacilitiesindustrymaterialsmunicipalorganicpowerprocessprocessesregulationsremovesanitaryspecializedsystemtreatedtreatmentvolatile
SHARED TOKENS (20): "applies", "chemical", "compounds", "describes", "facilities", "industry", "materials", "municipal", "organic", "power", "process", "processes", "regulations", "remove", "sanitary", "specialized", "system", "treated", "treatment", "volatile".
0.300
actadministrationagencyassistanceconditionscostscreditdepartmenteducationeffectsemploymentfederalhealthinjurylaborlawoccupationalregulationsregulatorysafe
SHARED TOKENS (25): "act", "administration", "agency", "assistance", "conditions", "costs", "credit", "department", "education", "effects", "employment", "federal", "health", "injury", "labor", "law", "occupational", "regulations", "regulatory", "safe"....
0.300
controlcontrolsdefinesexperienceidentificationinspectionjobknowledgelistsmajormanagementphysicalplacesprocessprocessesproductqualityrecordsrelationshipsrequirements
SHARED TOKENS (23): "control", "controls", "defines", "experience", "identification", "inspection", "job", "knowledge", "lists", "major", "management", "physical", "places", "process", "processes", "product", "quality", "records", "relationships", "requirements"....
0.300
Wholesaling ↗ Q220695 KW CROSS HIGH
businessbusinessescommercialconsumerconsumerscostsdirectlygeneralinstitutionalmanufacturermarketmarketsproductsprofessionalratherrelatedretailerssourcetransactionusers
SHARED TOKENS (21): "business", "businesses", "commercial", "consumer", "consumers", "costs", "directly", "general", "institutional", "manufacturer", "market", "markets", "products", "professional", "rather", "related", "retailers", "source", "transaction", "users"....
0.300
academiccostsdedicateddevelopeddevelopmentdiscoveryfinancialformshomeinformationlargemaintenancemajormediamobilemultiplenewsoperateoperatorsplatform
SHARED TOKENS (32): "academic", "costs", "dedicated", "developed", "development", "discovery", "financial", "forms", "home", "information", "large", "maintenance", "major", "media", "mobile", "multiple", "news", "operate", "operators", "platform"....
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
associatedchainchainschemicalsconsumptiondistributedlogisticsmanagementproductsqualityrequiressafetysequencestoragesupplyuseswaste
SHARED TOKENS (17): "associated", "chain", "chains", "chemicals", "consumption", "distributed", "logistics", "management", "products", "quality", "requires", "safety", "sequence", "storage", "supply", "uses", "waste".
0.300
administrationbuildingconditionsdepartmentdirectlyeconomicemploymentfederalgoverningheadquartershealthhistoryjoblaboroccupationalregulationsreportssafetystandardswage
SHARED TOKENS (21): "administration", "building", "conditions", "department", "directly", "economic", "employment", "federal", "governing", "headquarters", "health", "history", "job", "labor", "occupational", "regulations", "reports", "safety", "standards", "wage"....
0.300
applicationchemicalconcentrationcontroldesigndevelopmentengineeringlargelawmakingmaterialmaterialsoperationphysicalprocessprocessesprocessingproductswork
SHARED TOKENS (19): "application", "chemical", "concentration", "control", "design", "development", "engineering", "large", "law", "making", "material", "materials", "operation", "physical", "process", "processes", "processing", "products", "work".
0.300
activityemployerexposurefallsgeneralhazardshealthidentifiedlawlegalmaterialmusculoskeletalnationaloccupationalreportreportedreportingsafetyshowspecific
SHARED TOKENS (24): "activity", "employer", "exposure", "falls", "general", "hazards", "health", "identified", "law", "legal", "material", "musculoskeletal", "national", "occupational", "report", "reported", "reporting", "safety", "show", "specific"....
0.300
associatedcategorieschemicalchemicalsconsumerscontrolexpertiseexposurehazardhazardshealthhygieneinjuryjobmanagementoccupationalphysicalprotectionworkworkers
SHARED TOKENS (20): "associated", "categories", "chemical", "chemicals", "consumers", "control", "expertise", "exposure", "hazard", "hazards", "health", "hygiene", "injury", "job", "management", "occupational", "physical", "protection", "work", "workers".
0.300
amongassociatedcategoryconsumerconsumerscontainingcosmeticdifferentexternalformhygieneindustrymarketproductsprotectionremain
SHARED TOKENS (16): "among", "associated", "category", "consumer", "consumers", "containing", "cosmetic", "different", "external", "form", "hygiene", "industry", "market", "products", "protection", "remain".
🫐 BERRY69 edges
0.280
businesscosmeticestablishmenttreatment
SHARED TOKENS (4): "business", "cosmetic", "establishment", "treatment". | EXACT TITLE in beauty_salon: "Beauty salon".
0.280
appearcuttingevenpubs
SHARED TOKENS (4): "appear", "cutting", "even", "pubs". | EXACT TITLE in manufacturing_food_processing: "French fries".
0.280
containingfacilityproductproducts
SHARED TOKENS (4): "containing", "facility", "product", "products". | EXACT TITLE in manufacturing_food_processing: "Dairy product".
0.280
largeorganicprocessscale
SHARED TOKENS (4): "large", "organic", "process", "scale". | EXACT TITLE in beauty_salon: "Ethyl acetate".
0.280
Forklift ↗ Q41577 EXACT TITLE
developeddevelopmentmaterialssales
SHARED TOKENS (4): "developed", "development", "materials", "sales". | EXACT TITLE in manufacturing_food_processing: "Forklift".
0.280
foundpersonsrealrequire
SHARED TOKENS (4): "found", "persons", "real", "require". | EXACT TITLE in beauty_salon: "Artificial nails".
0.280
alonebusinessentityentrepreneurshiplegallegallyownedownersprocessseparatespecificsubjecttradework
SHARED TOKENS (14): "alone", "business", "entity", "entrepreneurship", "legal", "legally", "owned", "owners", "process", "separate", "specific", "subject", "trade", "work".
0.280
actagainstbusinesscostsidentityjulylawnationalprohibitsprotectionprovidepublicrequirementsrequires
SHARED TOKENS (14): "act", "against", "business", "costs", "identity", "july", "law", "national", "prohibits", "protection", "provide", "public", "requirements", "requires".
0.280
Aveda ↗ Q4827965 EXACT TITLE
foundedownedproductsstudents
SHARED TOKENS (4): "founded", "owned", "products", "students". | EXACT TITLE in beauty_salon: "Aveda".
0.280
E-commerce ↗ Q484847 KW CROSS HIGH
businesschaincommercialdataindustrymanagementmobileplatformsprocessingproductsretailsupplysystemstransaction
SHARED TOKENS (14): "business", "chain", "commercial", "data", "industry", "management", "mobile", "platforms", "processing", "products", "retail", "supply", "systems", "transaction".
0.280
Pedicure ↗ Q1161133 EXACT TITLE
cosmeticfeetmeanstreatment
SHARED TOKENS (4): "cosmetic", "feet", "means", "treatment". | EXACT TITLE in beauty_salon: "Pedicure".
0.260
Day spa ↗ Q11290050 EXACT TITLE
businessfacilityhealth
SHARED TOKENS (3): "business", "facility", "health". | EXACT TITLE in beauty_salon: "Day spa".
0.260
amongcommercialeducationfoundmakingplanprocessedproductsprovideremainsshowsmalltreatment
SHARED TOKENS (13): "among", "commercial", "education", "found", "making", "plan", "processed", "products", "provide", "remains", "show", "small", "treatment".
0.260
productsschoolssystems
SHARED TOKENS (3): "products", "schools", "systems". | EXACT TITLE in beauty_salon: "Paul Mitchell (hairdresser)".
0.260
boisehomeidaholargermeridianmetropolitannampaowyheepercentsectiontotaltreasurevalley
SHARED TOKENS (13): "boise", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "owyhee", "percent", "section", "total", "treasure", "valley".
0.260
Toluene ↗ Q15779 EXACT TITLE
chemicalcontactsingle
SHARED TOKENS (3): "chemical", "contact", "single". | EXACT TITLE in beauty_salon: "Toluene".
0.260
Balayage ↗ Q4850161 EXACT TITLE
boundaryoperatoroutside
SHARED TOKENS (3): "boundary", "operator", "outside". | EXACT TITLE in beauty_salon: "Balayage".
0.260
applicationassistancecostscoveringeducationfederalfinancialinstitutionmanagementneedprivateprocessstudents
SHARED TOKENS (13): "application", "assistance", "costs", "covering", "education", "federal", "financial", "institution", "management", "need", "private", "process", "students".
0.260
consumerscustomercustomersdecisionsdedicatedexperienceformproductproductsprofessionalreviewreviewsusers
SHARED TOKENS (13): "consumers", "customer", "customers", "decisions", "dedicated", "experience", "form", "product", "products", "professional", "review", "reviews", "users".
0.260
describesdevelopmenteconomiceconomicshistoricallyinfrastructurelocalmarketpolicyprocessqualityregionwest
SHARED TOKENS (13): "describes", "development", "economic", "economics", "historically", "infrastructure", "local", "market", "policy", "process", "quality", "region", "west".
0.260
Dermabrasion ↗ Q1200226 KW CROSS HIGH
centersconditionscontrolledlocalmeansoperatorproceduresprocessprofessionalprovideremoverequiresmall
SHARED TOKENS (13): "centers", "conditions", "controlled", "local", "means", "operator", "procedures", "process", "professional", "provide", "remove", "require", "small".
0.260
contactdirectidentifyinglawmaintenancepowerquestionremoverequiressafesafetyworkworker
SHARED TOKENS (13): "contact", "direct", "identifying", "law", "maintenance", "power", "question", "remove", "requires", "safe", "safety", "work", "worker".
0.260
Nursing home ↗ Q837142 KW CROSS HIGH
differentfacilitiesfacilityhomeinjuryneedoccupationalphysicalprivateprovidepublicrequireresidential
SHARED TOKENS (13): "different", "facilities", "facility", "home", "injury", "need", "occupational", "physical", "private", "provide", "public", "require", "residential".
0.260
chemicalfoundorganic
SHARED TOKENS (3): "chemical", "found", "organic". | EXACT TITLE in beauty_salon: "Butyl acetate".
0.260
idahonampaprivate
SHARED TOKENS (3): "idaho", "nampa", "private". | EXACT TITLE in manufacturing_food_processing: "Northwest Nazarene University".
0.240
branddesignindependentmanufactureroperationsphysicalprocessproductproductsrathersalessignificant
SHARED TOKENS (12): "brand", "design", "independent", "manufacturer", "operations", "physical", "process", "product", "products", "rather", "sales", "significant".
0.220
Wedding ↗ Q49836 EXACT TITLE
authoritypublic
SHARED TOKENS (2): "authority", "public". | EXACT TITLE in beauty_salon: "Wedding".
0.220
controlcontrolscorporatedistinguishfinancialhomeinvestmentmultipleoperatingportfoliopublicly
SHARED TOKENS (11): "control", "controls", "corporate", "distinguish", "financial", "home", "investment", "multiple", "operating", "portfolio", "publicly".
0.220
Mozzarella ↗ Q14088 EXACT TITLE
distinctresearch
SHARED TOKENS (2): "distinct", "research". | EXACT TITLE in manufacturing_food_processing: "Mozzarella".
0.220
idahomajor
SHARED TOKENS (2): "idaho", "major". | EXACT TITLE in manufacturing_food_processing: "Snake River Plain".
0.220
Wig ↗ Q105507 EXACT TITLE
coveringprofessional
SHARED TOKENS (2): "covering", "professional". | EXACT TITLE in beauty_salon: "Wig".
0.220
Make-up artist ↗ Q935666 KW CROSS HIGH
accessappliesfoundindustrylargelicensesprofessionalremainscheduleswhosework
SHARED TOKENS (11): "access", "applies", "found", "industry", "large", "licenses", "professional", "remain", "schedules", "whose", "work".
0.220
createproducing
SHARED TOKENS (2): "create", "producing". | EXACT TITLE in manufacturing_food_processing: "Food microbiology".
0.220
logisticsoperations
SHARED TOKENS (2): "logistics", "operations". | EXACT TITLE in manufacturing_food_processing: "Packaging Corporation of America".
0.220
accessdifferentdistributededucationhistoricallyinstructionmultiplenetworkprocessprogramstudents
SHARED TOKENS (11): "access", "different", "distributed", "education", "historically", "instruction", "multiple", "network", "process", "program", "students".
0.220
Coworking ↗ Q869457 KW CROSS HIGH
contractorsdifferentexperiencehomeindependentmajorofficesprovidesharespaceworkers
SHARED TOKENS (11): "contractors", "different", "experience", "home", "independent", "major", "offices", "provide", "share", "space", "workers".
0.220
differenteconomyidahoprocessingproductsrepresentssalessecondsectorsignificantsubstantial
SHARED TOKENS (11): "different", "economy", "idaho", "processing", "products", "represents", "sales", "second", "sector", "significant", "substantial".
0.220
createfoundednetworknorthoperatesoperatingreportingsystemtransportationwestwestern
SHARED TOKENS (11): "create", "founded", "network", "north", "operates", "operating", "reporting", "system", "transportation", "west", "western".
0.220
Scalp ↗ Q9622 EXACT TITLE
coveringstructures
SHARED TOKENS (2): "covering", "structures". | EXACT TITLE in beauty_salon: "Scalp".
0.220
historicallyretailers
SHARED TOKENS (2): "historically", "retailers". | EXACT TITLE in manufacturing_food_processing: "Summer sausage".
0.210
Barbershop ↗ Q4345168 EXACT TITLE
work
SHARED TOKENS (1): "work". | EXACT TITLE in beauty_salon: "Barbershop".
0.210
Hairdresser ↗ Q55187 EXACT TITLE
whose
SHARED TOKENS (1): "whose". | EXACT TITLE in beauty_salon: "Hairdresser".
0.210
storage
SHARED TOKENS (1): "storage". | EXACT TITLE in manufacturing_food_processing: "Cold storage".
0.210
Spa ↗ Q1341387 EXACT TITLE
health
SHARED TOKENS (1): "health". | EXACT TITLE in beauty_salon: "Spa". | EXACT TITLE in manufacturing_food_processing: "Spa".
0.200
acquiredactanalysiscleanconventionalqualityratherseparatetotaltreatment
SHARED TOKENS (10): "acquired", "act", "analysis", "clean", "conventional", "quality", "rather", "separate", "total", "treatment".
0.200
south
EXACT TITLE in manufacturing_food_processing: "Frozen dessert".
0.200
applicableapproximatelyconsumptiondirectlyeconomiceffectsevenexposurerequiringresulting
SHARED TOKENS (10): "applicable", "approximately", "consumption", "directly", "economic", "effects", "even", "exposure", "requiring", "resulting".
0.200
Bel Group ↗ Q491034 EXACT TITLE
EXACT TITLE in manufacturing_food_processing: "Bel Group".
0.180
consumercostslimitedproductsretailerssalessmallspacespecialty
SHARED TOKENS (9): "consumer", "costs", "limited", "products", "retailers", "sales", "small", "space", "specialty".
0.180
becomingcentersdepartmentgenericlargemixed-usepowerretailspecialized
SHARED TOKENS (9): "becoming", "centers", "department", "generic", "large", "mixed-use", "power", "retail", "specialized".
0.180
approximatelyboisedatadistrictevenfoundidahonorthsingle
SHARED TOKENS (9): "approximately", "boise", "data", "district", "even", "found", "idaho", "north", "single".
0.180
Sugar industry ↗ Q227870 KW CROSS HIGH
economicenterprisesindustrymarketprocessingproductssignificantsupportingtable
SHARED TOKENS (9): "economic", "enterprises", "industry", "market", "processing", "products", "significant", "supporting", "table".
0.180
centralconstructionconsumptionfacilityindustryprocessprocessingproducingproducts
SHARED TOKENS (9): "central", "construction", "consumption", "facility", "industry", "process", "processing", "producing", "products".
0.180
Barley ↗ Q11577 KW CROSS HIGH
amongfamilymajormakingmaterialnamespreparationsourcethroughout
SHARED TOKENS (9): "among", "family", "major", "making", "material", "names", "preparation", "source", "throughout".
0.160
associatedboiseextendsidahometropolitanowyheesidevalley
SHARED TOKENS (8): "associated", "boise", "extends", "idaho", "metropolitan", "owyhee", "side", "valley".
0.160
chemicalcontactdirectexposureinjuryphysicalrepresentsresulting
SHARED TOKENS (8): "chemical", "contact", "direct", "exposure", "injury", "physical", "represents", "resulting".
0.140
Acrylic paint ↗ Q207849 KW CROSS HIGH
costsdifferentevenmarketmediasuspensiontechnical
SHARED TOKENS (7): "costs", "different", "even", "market", "media", "suspension", "technical".
0.140
designlargemakingmaterialmeetproductsource
SHARED TOKENS (7): "design", "large", "making", "material", "meet", "product", "source".
0.140
agencycategoryestateeventindustryplanningreal
SHARED TOKENS (7): "agency", "category", "estate", "event", "industry", "planning", "real".
0.140
allowedapplicableauthorizesdistrictpermituseszoning
SHARED TOKENS (7): "allowed", "applicable", "authorizes", "district", "permit", "uses", "zoning".
0.140
By-product ↗ Q1128255 KW CROSS HIGH
chemicalcommercialprimaryprocessproductproductswaste
SHARED TOKENS (7): "chemical", "commercial", "primary", "process", "product", "products", "waste".
0.140
beginningboisefallshomeidahomajormetropolitan
SHARED TOKENS (7): "beginning", "boise", "falls", "home", "idaho", "major", "metropolitan".
0.120
boiseidahometropolitanmunicipalsecondseparate
SHARED TOKENS (6): "boise", "idaho", "metropolitan", "municipal", "second", "separate".
0.120
agencycertificationjobprofessionalpublictrade
SHARED TOKENS (6): "agency", "certification", "job", "professional", "public", "trade".
0.120
differentdocumentofficialprovidespecialtythroughout
SHARED TOKENS (6): "different", "document", "official", "provide", "specialty", "throughout".
0.120
appeardifferentformspracticeshowtherefore
SHARED TOKENS (6): "appear", "different", "forms", "practice", "show", "therefore".
0.100
amongchemicalchemicalsinvolvingprocess
SHARED TOKENS (5): "among", "chemical", "chemicals", "involving", "process".
0.100
Hairstyle ↗ Q327496 KW CROSS HIGH
homeinfluenceoutsidepracticalthough
SHARED TOKENS (5): "home", "influence", "outside", "practical", "though".
0.100
conditionscontrolledeffectshazardmaterial
SHARED TOKENS (5): "conditions", "controlled", "effects", "hazard", "material".
◈ Frequently Asked Questions
Beauty Salon × Manufacturing Food Processing — Treasure Valley
HAIKU · HIGH GATE
How do Ada County building codes differ between beauty salon operations and food manufacturing facilities?
Ada County enforces distinct ventilation requirements under building code standards, where beauty salons require HVAC systems for chemical vapor management while food processing plants in Boise and Nampa must meet federal sanitation standards alongside local codes. Private equity developers in the Treasure Valley often navigate these separate regulatory paths when designing mixed-use retail spaces in Meridian and Eagle.
What zoning restrictions apply to retail beauty salons versus manufacturing food processing in Canyon County?
Canyon County zoning designations place beauty salons in retail commercial zones throughout Caldwell and Nampa, while food processing manufacturing requires industrial zoning separate from downtown Boise retail districts. Building permits in Kuna and other Treasure Valley municipalities specify that beauty salon buildouts cannot occupy the same zoned parcels as food production facilities.
How do private equity investors evaluate beauty salon versus food manufacturing properties in Boise's commercial market?
Private equity firms analyzing Boise and Ada County commercial real estate consider beauty salon properties as lower-capital retail operations with faster permitting timelines, while food manufacturing in Nampa and Canyon County requires substantial HVAC and sanitation infrastructure investment. Planning and design costs for food processing facilities near the Boise River exceed beauty salon build-outs by multiples due to local health control requirements.
Why do beauty salons and food manufacturing plants require different HVAC system designs in the Treasure Valley?
Beauty salons in Boise, Meridian, and Eagle require HVAC systems that control airborne chemical fumes from styling products, while Nampa and Caldwell food processing operations need temperature and humidity control to prevent contamination. Ada County and Canyon County building codes mandate separate ventilation specifications for each industry based on occupant health and product safety standards.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Beauty Salon × Manufacturing Food Processing 15 QID bridges 250 edges 7,084 ext links 2026-07-17 19:40:19 UTC 3642c3834fcd894d
Beauty Salon corridor ↗ Manufacturing Food Processing corridor ↗ Manufacturing Food Processing × Beauty Salon ↗ boisestandard.org/standard ↗
Parent Corridors
Beauty Salon × All Other Verticals