—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Substance Use Recovery ↔ relates to ↔ Childcare Family

22 Wikipedia bridge articles confirmed in both vertical ledgers. 246 deterministic cross-vertical edges. 6,818 external source links harvested. Every edge provenance-stamped. Every claim auditable.

22 QID Bridge Articles
246 Cross Edges
6,818 External Sources
279 Wikipedia Articles
23 🌲 Evergreen
186 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Substance Use Recovery
× Childcare Family
QID Bridge Articles
22
confirmed Wikipedia overlap
Total Cross Edges
246
External Sources Harvested
6,818
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Family therapy
score: 1.0000  ·  type: exact_title_cross  ·  26 shared tokens
QID Bridge Titles (20)
Family therapyIdahoCase managementChild protectionHomelessnessMedicaidSocial workJuvenile courtContinuing educationBoise State UniversityTelehealthNonprofit organizationTreasure ValleyAmericans with Disabilities Act of 1990Boise, IdahoBoise metropolitan areaNampa, IdahoReferral marketingAda County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationhomepeoplehealthpublicdevelopmentfamilysupportindividualseducationadachildrenfamiliessystemsystemscapitalcommunitygeneral
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:23:58 UTC
Content Hash
679f33b4e7d013f9
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
22 BRIDGES
F
Q870449 EXACT TITLE 1.000
QID OVERLAP: Q870449 in substance_use_recovery (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (26): "children", "clients", "clinicians", "counseling", "defined", "development", "different", "direct", "early", "families", "family", "individual", "influence", "long-term", "parents", "participation", "people", "problem", "related", "relationships".... | EXACT TITLE in childcare_family: "Family therapy".
childrenclientsclinicianscounselingdefineddevelopmentdifferentdirectearlyfamiliesfamilyindividualinfluencelong-termparentsparticipationpeopleproblemrelatedrelationshipsschoolsstudysupportsystemsystemstherapy
way that catalyses the strengths, wisdom, and support of the wider system. In the field's early years, many clinicians defined the family in a narrow, traditional manner usually including parents and children.
erms of the systems of interaction between family members. The different schools of family therapy have in common a belief that, regardless of the origin of the problem, and regardless of whether the clients consider it an "individual" or "family" issue, involving families in solutions often benefits clients. This involvement of families is commonly accomplished by their direct participation in the therapy session. The skills of the family therapist thus include the ability to influence conversations in a way that catalyses the strengths, wisdom, and support of the wider system. In the field's early years, many clinicians defined the family in a narrow, traditional manner usually including parents and children.
History and theoretical frameworks Formal interventions with families to help individuals and families experiencing various kinds of problems have been a part of many cultures, probably throughout history. These interventions have sometimes involved formal procedures or rituals, and often included the extended family as well as non-kin members of the community (see, for example, Ho'oponopono). Following the emergence of specialization in various societies, these interventions were often conducted by particular members of a community—for example, a tribal chief, priest, physician, and so on—usually as an ancillary function. Family therapy as a distinct professional practice within Western cultures can be argued to have had its origins in the social work movements of the 19th century in the United Kingdom and the United States. As a branch of psychotherapy, its roots can be traced somewhat later to the early 20th century with the emergence of the child guidance movement and marriage counseling. The formal development of family therapy dates from the 1940s and early 1950s with the founding in 1942 of the American Association of Marriage Counselors (the precursor of the AAMFT), and through the work of various independent clinicians and groups—in the United Kingdom (John Bowlby at the Tavistock Clinic), the United States (Donald deAvila Jackson, John Elderkin Bell, Nathan Ackerman, Christian Midelfort, Theodore Lidz, Lyman Wynne, Murray Bowen, Carl Whitaker, Virginia Satir, Ivan Boszormenyi-Nagy), and in Hungary, D.L.P. Liebermann—who began seeing family members together for observation or therapy sessions. There was initially a strong influence from psychoanalysis (most of the early founders of the field had psychoanalytic backgrounds) and social psychiatry, and later from behaviorism and behavior therapy—and significantly, these clinicians began to articulate various theories about the nature and functioning of the family as an entity that was more than a mere aggregation of individuals. The movement received an important boost starting in the early 1950s through the work of anthropologist Gregory Bateson and colleagues—Jay Haley, Donald deAvila Jackson, John Weakland, William Fry, and later, Virginia Satir, Ivan Boszormenyi-Nagy, Paul Watzlawick and others—at Palo Alto in the United States, who introduced ideas from cybernetics and general systems theory into social psychology and psychotherapy, focusing in particular on the role of communication. This approach eschewed the traditional focus on individual psychology and historical factors—that involve so-called linear causation and content—and emphasized instead feedback and homeostatic mechanisms and "rules" in here-and-now interactions—so-called circular causation and process—that were thought to maintain or exacerbate problems, whatever the original cause(s). This group was also influenced significantly by the work of US psychiatrist, hypnotherapist, and brief therapist Milton H. Erickson—especially his innovative use of strategies for change, such as paradoxical directives. The members of the Bateson Project (like the founders of a number of other schools of family therapy, including Carl Whitaker, Murray Bowen, and Ivan Boszormenyi-Nagy) had a particular interest in the possible psychosocial causes and treatment of schizophrenia, especially in terms of the putative "meaning" and "function" of signs and symptoms within the family system. The research of psychiatrists and psychoanalysts Lyman Wynne and Theodore Lidz on communication deviance and roles (e.g., pseudo-mutuality, pseudo-hostility, schism, and skew) in families of people with schizophrenia also became influential with systems-communications-oriented theorists and therapists. A related theme—applying to dysfunction and psychopathology more generally—was that of the "identified patient" or "presenting problem" as a manifestation of or surrogate for the family's (or even society's) problems. By the mid-1960s, a number of distinct schools of family therapy had emerged. From the groups that were most strongly influenced by cybernetics and systems theory there came Mental Research Institute brief therapy, strategic therapy, Salvador Minuchin's structural family therapy and the model proposed by Mara Selvini Palazzoli (i.e., the Milan systems model). Partly in reaction to some aspects of these systemic models came the experiential approaches of Virginia Satir and Carl Whitaker, which downplayed theoretical constructs and emphasized subjective experience and unexpressed feelings (including the subconscious), authentic communication, spontaneity, creativity, total therapist engagement, and often included the extended family. Concurrently, intergenerational therapies by Murray Bowen, Ivan Boszormenyi-Nagy, James Framo, and Norman Paul emerged. They proposed different theories on the intergenerational transmission of health and dysfunction, usually involving three generations in therapy or through "homework" and "journeys home." Psychodynamic family therapy—which, more than any other school of family therapy, deals directly with individual psychology and the unconscious mind in the context of current relationships—continued to develop through a number of groups that were influenced by the ideas and methods of Nathan Ackerman, the British school of object relations theory, and John Bowlby's work on attachment theory. Multiple-family group therapy, a precursor of psychoeducational family intervention, emerged, in part, as a pragmatic alternative form of intervention—especially as an adjunct to the treatment of serious mental illnesses with significant biological underpinnings, such as schizophrenia—and represented something of a conceptual challenge to some of the systemic (and thus potentially "family-blaming") paradigms of pathogenesis that were implicit in many of the dominant models of family therapy. The late 1960s and early 1970s saw the development of network therapy (which bears some resemblance to traditional practices such as Ho'oponopono) by Ross Speck and Carolyn Attneave, and the emergence of behavioral marital therapy (renamed behavioral couples therapy in the 1990s) and behavioral family therapy as models in their own right. By the late 1970s, the weight of clinical experience—especially in the treatment of serious mental disorders—had led to revisions of several of the original models and a moderation of earlier stridency and theoretical purism. There were the beginnings of a general softening of the strict demarcations between schools, with moves toward rapprochement, integration, and eclecticism—although there was, nevertheless, some hardening of positions within some schools. These trends were reflected in and influenced by lively debates within the field and critiques from various sources, including feminism and post-modernism, that reflected in part the cultural and political tenor of the times, and which foreshadowed the emergence (in the 1980s and 1990s) of the various post-systems constructivist and social constructionist approaches. While there was still debate within the field about whether, or to what degree, the systemic-constructivist and medical-biological paradigms were necessarily antithetical to each other (see also anti-psychiatry; biopsychosocial model), there was a growing willingness and tendency on the part of family therapists to work in multi-modal clinical partnerships with other members of the helping and medical professions. From the mid-1980s to the present, the field has been marked by a diversity of approaches that partly reflect the original schools, but which also draw on other theories and methods from individual psychotherapy and elsewhere—these approaches and sources include: brief therapy, structural therapy, constructivist approaches (e.g., Milan systems, post-Milan/collaborative/conversational, and reflective), bringforthist approach (e.g., Karl Tomm's IPscope model and Interventive interviewing), solution focused brief therapy, narrative therapy, a range of cognitive behavioral therapy approaches, psychodynamic and object relations approaches, attachment and emotionally focused therapy, intergenerational approaches, network therapy, and multisystemic therapy (MST). Multicultural, intercultural, and integrative approaches are being developed, with Vincenzo Di Nicola weaving a synthesis of family therapy and transcultural psychiatry in his model of cultural family therapy, A Stranger in The Family: Culture, Families, and Therapy. Many practitioners claim to be eclectic, using techniques from several areas, depending upon their own inclinations and/or the needs of the client(s), and there is a growing movement toward a single "generic" family therapy that seeks to incorporate the best of the accumulated knowledge in the field and which can be adapted to many different contexts. Nonetheless, there are still a significant number of therapists who adhere more or less strictly to a particular, or limited number of, approach(es). The liberation-based healing framework for family therapy offers a complete paradigm shift for working with families while addressing the intersections of race, class, gender identity, sexual orientation, and other socio-political identity markers. This theoretical approach and praxis is informed by critical pedagogy, feminism, critical race theory, and decolonizing theory. It necessitates an understanding of the ways colonization, cisheteronormativity, patriarchy, white supremacy and other systems of domination impact individuals, families and communities and centers the need to disrupt the status quo in how power operates. Traditional Western models of family therapy have historically ignored these dimensions, and when white, male privilege has been critiqued, largely by feminist theory practitioners, it has often been to the benefit of middle-class, white women's experiences. While an understanding of intersectionality is of particular significance in working with families with violence, a liberatory framework examines how power, privilege and oppression operate within and across all relationships. Liberatory practices are based on the principles of critical consciousness, accountability, and empowerment. These principles guide not only the content of therapeutic work with clients but also the supervisory and training processes for therapists.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (22): "around", "boise", "capital", "contains", "distinct", "early", "idaho", "national", "official", "people", "population", "products", "sector", "separate", "significant", "small", "south", "supplies", "technology", "uses".... | EXACT TITLE in substance_use_recovery: "Idaho". | EXACT TITLE in childcare_family: "Idaho".
aroundboisecapitalcontainsdistinctearlyidahonationalofficialpeoplepopulationproductssectorseparatesignificantsmallsouthsuppliestechnologyuseswesternzone
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
h comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Ban on COVID-19 vaccines In October 2024, a health department in Idaho voted 4–3 to stop providing COVID-19 vaccines to residents in six counties. Opposite mainstream healthcare providers' and epidemiologists' pleas against the decision were more than 290 public comments, many of which called for an end to vaccine mandates or taxpayer funding of the vaccines, neither of which was happening in the district. Hantavirus In 2026, the irrigation system (irrigation canals) around Boise is causing rats from California to migrate into the state. There is an influx of rats in Idaho and there is a concern that the hantavirus could spread to the local population.
C
Q5048341 EXACT TITLE 1.000
QID OVERLAP: Q5048341 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (15): "care", "case", "community", "coordination", "courts", "general", "health", "individuals", "law", "legal", "management", "medical", "mental", "system", "treatment". | EXACT TITLE in substance_use_recovery: "Case management". | EXACT TITLE in childcare_family: "Case management".
carecasecommunitycoordinationcourtsgeneralhealthindividualslawlegalmanagementmedicalmentalsystemtreatment
ent may refer to: Case management (mental health), a specific approach for the coordination of community mental health services Case management (US health system), a specific term used in the health care system of the United States of America Medical case management, a general term referring to the facilitation of treatment plans to assure the appropriate medical care is provided to disabled, ill or
C
Q1029430 EXACT TITLE 1.000
QID OVERLAP: Q1029430 in substance_use_recovery (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (70): "abuse", "access", "affect", "agencies", "article", "beyond", "child", "children", "collaboration", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "even".... | EXACT TITLE in childcare_family: "Child protection".
abuseaccessaffectagenciesarticlebeyondchildchildrencollaborationcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationevenfamiliesfamilyfreefuturegroupshealthhealthcarehomeidentifyidentifying+40
Child protection (also called child welfare) is the safeguarding of children from violence, exploitation, abuse, abandonment, and neglect. It involves identifying signs of potential harm. This includes responding to allegations or suspicions of abuse, providing support and services to protect children, and holding those who have harmed them accountable. The primary goal of child protection is to ensure that all children are safe and free from harm or danger. Child protection also works to prevent future harm by creating policies and systems that identify and respond to risks before they lead to harm. In order to achieve these goals, research suggests that child protection services should be provided in a holistic way. This means taking into account the social, economic, cultural, psychological, and environmental factors that can contribute to the risk of harm for individual children and their families. Collaboration across sectors and disciplines to create a comprehensive system of support and safety for children is required. It is the responsibility of individuals, organizations, and governments to ensure that children are protected from harm and their rights are respected.
that children are protected from harm and their rights are respected. This includes providing a safe environment for children to grow and develop, protecting them from physical, emotional and sexual abuse, and ensuring they have access to education, healthcare, and resources to fulfill their basic needs. Child protection systems are a set of services, usually government-run, designed to protect children and young people who are underage and to encourage family stability. UNICEF defines a 'child protection system' as: "The set of laws, policies, regulations and services needed across all social sectors – especially social welfare, education, health, security and justice – to support prevention and response to protection-related risks. These systems are part of social protection, and extend beyond it. At the level of prevention, their aim includes supporting and strengthening families to reduce social exclusion, and to lower the risk of separation, violence and exploitation. Responsibilities are often spread across government agencies, with services delivered by local authorities, non-State providers, and community groups, making coordination between sectors and levels, including routine referral systems etc.., a necessary component of effective child protection systems."Under Article 19 of the UN Convention on the Rights of the Child, a 'child protection system' provides for the protection of children in and out of the home. One of the ways this can be enabled is through the provision of quality education, the fourth of the United Nations Sustainable Development Goals, in addition to other child protection systems.
Endangerment Child endangerment is the act of placing a child in a situation that neglects their health or life. Child endangerment can cause many negative physical and mental effects. This can stem from abusive parental care, child neglect, and a multitude of other reasons. Ways to prevent incidents of child endangerment include primary parents or caregivers spending ample time with their children and seeking out appropriate resources to assist in understanding early childhood development. A number of states in the US have laws put in place to prevent child abuse or neglect, with the majority of them focusing on arrest sentences up to five years and fines ranging from $5,000-$15,000. Infanticide (child murder) Infanticide is the intentional killing of infants and young children. This practice has been documented throughout history and still occurs in certain cultures today, usually as a result of poverty and/or other social pressures. Infanticide can be carried out by parents, relatives, or strangers and is often seen as a form of gender-based violence, since female babies are more likely to be killed than male ones. In some cases, infanticide may also be used to conceal evidence of incest or rape. It is most commonly practiced in cultures where there is a preference for male children, or where resources are scarce. In some countries, children can be imprisoned for common crimes. In some countries, like Iran or China, criminals can even be sentenced to capital punishment for crimes committed while they were children (the United States abandoned the practice in 2005). In contexts where military use of children is made, they also risk becoming prisoners of war. Other children are forced into prostitution, exploited by adults for illegal traffic in children, or endangered by poverty and hunger. Infanticide today continues at a much higher rate in areas of extremely high poverty and overpopulation, such as parts of China and India.
H
Q131327 EXACT TITLE 1.000
QID OVERLAP: Q131327 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (28): "changes", "consequently", "definition", "designed", "experience", "family", "form", "homelessness", "house", "housing", "identifying", "individuals", "legal", "live", "living", "needs", "people", "populations", "primary", "private".... | EXACT TITLE in substance_use_recovery: "Homelessness". | EXACT TITLE in childcare_family: "Homelessness".
changesconsequentlydefinitiondesignedexperiencefamilyformhomelessnesshousehousingidentifyingindividualslegallivelivingneedspeoplepopulationsprimaryprivatepublicsafeshelterstablestandardizedstatusworkyet
are living on the streets (primary homelessness); have no permanent house or place to live safely are moving between temporary shelters, including houses of friends, family, hotels, and emergency accommodation (secondary homelessness) The legal status of homeless people changes from place to place. Homeless enumeration studies conducted by the government of the United States also include people who sleep in a public or private place that is not designed for use as a regular sleeping accommodation for human beings. Homelessness and poverty are interrelated. There is no standardized method for counting homeless individuals and identifying their needs; consequently, most cities only have estimated figures for their homeless populations. In 2025, approximately 330 million people worldwide experience absolute homelessness, lacking any form of shelter. Homeless persons who travel have been termed vagrants in the past; of those, persons looking for work are hobos, whereas those who do not are tramps.
1. Everyone has the right to a standard of living adequate for the health and well-being of himself and of his family, including food, clothing, housing and medical care and necessary social services, and the right to security in the event of unemployment, sickness, disability, widowhood, old age or other lack of livelihood in circumstances beyond his control. 2. Motherhood and childhood are entitled to special care and assistance. All children, whether born in or out of wedlock, shall enjoy the same social protection. The ETHOS Typology of Homelessness and Housing Exclusion was developed as a means of improving the understanding and measurement of homelessness in Europe, and to provide a common "language" for transnational exchanges on homelessness. The ETHOS conceptualizes homelessness as a process (rather than a static phenomenon) that affects many vulnerable households at different points in their lives. The typology was launched in 2005 and is used for different purposes: as a framework for debate, for data collection purposes, policy purposes, monitoring purposes, and in the media. This typology is an open exercise that makes abstraction of existing legal definitions in the EU member states. It exists in 25 language versions, the translations being provided mainly by volunteer translators. Many countries and individuals do not consider housing as a human right. Former U.S. President Jimmy Carter addressed this issue in a 2017 interview, saying, "A lot of people don't look at housing as a human right, but it is".
The U.S. Great Depression of the 1930s caused an epidemic of poverty, hunger, and homelessness in the United States. When Franklin D. Roosevelt took over the presidency from Herbert Hoover in 1933, he signed the New Deal, which expanded social welfare, including providing funds to build public housing. How the Other Half Lives and Jack London's The People of the Abyss (1903) discussed homelessness and raised public awareness, which caused some changes in building codes and social conditions. In England, dormitory housing called "spikes" was provided by local boroughs. By the 1930s in England, 30,000 people were living in these facilities. In 1933, George Orwell wrote about poverty in London and Paris, in his book Down and Out in Paris and London. In general, in most countries, many towns and cities had an area that contained the poor, transients, and afflicted, such as a "skid row". In New York City, for example, there was "the Bowery" – traditionally, where people with an alcohol use disorder were to be found sleeping on the streets, bottle in hand. In the 1960s in the UK, the nature and growing problem of homelessness changed in England as public concern grew. The number of people living "rough" in the streets had increased dramatically. However, beginning with the Conservative administration's Rough Sleeper Initiative in 1990, the number of people sleeping rough in London fell dramatically. This initiative was supported further by the incoming Labour administration from 2009 onwards with the publication of the 'Coming in from the Cold' strategy published by the Rough Sleepers Unit, which proposed and delivered a massive increase in the number of hostel bed spaces in the capital and an increase in funding for street outreach teams, who work with rough sleepers to enable them to access services. Scotland saw a slightly different picture, with the impact of the right to buy ending in a significant drop in available social housing.
Medicaid
Q1141363 EXACT TITLE 1.000
QID OVERLAP: Q1141363 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (55): "access", "act", "adult", "adults", "affordable", "annual", "care", "children", "cost", "costs", "covered", "economic", "eligibility", "established", "expanded", "families", "federal", "financial", "funding", "general".... | EXACT TITLE in substance_use_recovery: "Medicaid". | EXACT TITLE in childcare_family: "Medicaid".
accessactadultadultsaffordableannualcarechildrencostcostscoveredeconomiceligibilityestablishedexpandedfamiliesfederalfinancialfundinggeneralhealthhealthcarehomehourshouseholdinsurancelevelslimitedlong-termmedical+25
Medicaid is the largest source of funding for medical and health-related services for people with low income in the United States, providing taxpayer-funded health insurance to 85 million low-income and disabled people as of 2022; in 2019, the program paid for half of all U.S. births. In 2023, the total (federal and state) annual cost of Medicaid was $870 billion, with an average cost per enrollee of $7,600 for 2021. 37% of enrollees were children, but they only accounted for 15% of the spending, ($3,000 per person) while seniors and disabled persons accounted for 21% of enrollees and 52% of spending (more than $18,000 per person). In general, Medicaid recipients must be U.S. citizens or qualified non-citizens, and may include low-income adults, their children, and people with certain disabilities. Medicaid also covers long-term services and supports, including both nursing home care and home- and community-based services, for those with low incomes and minimal assets. Of the 7.7 million Americans who used long-term services and supports in 2020, about 5.6 million were covered by Medicaid. Along with Medicare, Tricare, ChampVA, and CHIP, Medicaid is one of the several Federal Government-sponsored medical insurance programs in the United States. Medicaid covers healthcare costs for people with low incomes; Medicare is a universal program providing health coverage for the elderly; and the CHIP program covers uninsured children in families with incomes that are too high to be covered by Medicaid. Medicaid offers elder care benefits not normally covered by Medicare, including nursing home care and personal care services. There are also dual health plans for people who have both Medicaid and Medicare. Research shows that existence of the Medicaid program improves health outcomes, health insurance coverage, access to health care, and recipients' financial security and provides economic benefits to states and health providers.
2025 Medicaid cuts in the second Trump administration In 2025, Republican Congressional leaders John Thune and Mike Johnson announced goals of cutting 1.5 to 2 trillion dollars of the US federal budget, with President Donald Trump stating that cuts to Medicaid would only include "abuse or waste". The 2025 budget resolution, which was passed by the House of Representatives with only Republicans votes, proposed cutting $880 billion from the Standing Committee for Energy and Commerce, which includes many areas, such as Medicaid and Medicare. On July 4, 2025, President Donald Trump signed the One Big Beautiful Bill Act, intended in part to implement this resolution. The act cut Medicaid in a number of ways: while it did not repeal the ACA's Medicaid expansion, it mandated work requirements for able-bodied Medicaid recipients. It also requires Medicaid recipients above the federal poverty line to pay more fees for coverage; adds new verification requirements; increases the number of times states need to check the eligibility of their Medicaid expansion recipients; prohibits Medicaid from funding nonprofits that provide abortion care; makes it harder for illegal immigrants to use Medicaid; bans pharmacy benefit managers from using spread pricing; and puts limits on so-called "provider taxes" that states impose on healthcare providers to fund their portion of Medicaid spending. The non-partisan Congressional Budget Office (CBO) estimated that it will reduce the number of people on Medicaid by several million.; the CBO estimates that the work requirements in particular will lead 11 million to lose their Medicaid coverage, many of whom already work or qualify for exemptions but will not be able to get through the red tape. The bill prompted claims that undocumented immigrants are on Medicaid. Undocumented immigrants are already ineligible for full Medicaid benefits, and many undocumented immigrants access state-funded health programs rather than federal Medicaid. According to a CBO analysis, the bill's provisions could lead some states to cut back those state-funded health programs, potentially causing an estimated 1.4 million people to lose state-level health coverage, including undocumented immigrants. When commenting on the Trump administration's One Big Beautiful Bill Act and the impact of the Medicaid provisions on the economy, USDA Secretary Brooke Rollins stated that 34 million able-bodied adults on Medicaid should be working.
Arizona: AHCCCS California: Medi-Cal Connecticut: HUSKY D Illinois: HealthChoice Illinois Iowa: Hawk-i Healthy and Well-Kids in Iowa Maine: MaineCare Massachusetts: MassHealth New Jersey: NJ FamilyCare Oregon: Oregon Health Plan Oklahoma: Soonercare Tennessee: TennCare Washington: Washington Apple Health Wisconsin: BadgerCare As of January 2012, Medicaid and/or CHIP funds could be obtained to help pay employer health care premiums in Alabama, Alaska, Arizona, Colorado, Florida, and Georgia. Differences by state While states have significant autonomy in implementing the Medicaid program, their flexibility is bounded by federal requirements designed to ensure a baseline of coverage and access. For example, federal law mandates that certain services, such as inpatient and outpatient hospital services, laboratory and X-ray services, and physician services, must be covered by all state Medicaid programs. Additionally, states must adhere to federal guidelines regarding beneficiary protections and quality standards.
S
Q205398 EXACT TITLE 1.000
QID OVERLAP: Q205398 in substance_use_recovery (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (45): "administration", "advocacy", "agencies", "began", "child", "communities", "community", "conducting", "counseling", "defined", "development", "directly", "education", "families", "family", "functioning", "group", "groups", "health", "individual".... | EXACT TITLE in substance_use_recovery: "Social work".
administrationadvocacyagenciesbeganchildcommunitiescommunityconductingcounselingdefineddevelopmentdirectlyeducationfamiliesfamilyfunctioninggroupgroupshealthindividualindividualslaborlawlevelsmanagementneedsorganizationspeoplepolicypractice+15
group therapy or providing services for community agencies. Macro-work involves fostering change on a larger scale through advocacy, social policy, research development, non-profit and public service administration, or working with government agencies. Starting in the 1960s, a few universities began social work management programmes, to prepare students for the management of social and human service organizations, in addition to classical social work education. The social work profession developed in the 19th century, with some of its roots in voluntary philanthropy and in grassroots organizing. However, responses to social needs had existed long before then, primarily from public almshouses, private charities and religious organizations.
The practice and profession of social work has a relatively modern and scientific origin, and is generally considered to have developed out of three strands. The first was individual casework, a strategy pioneered by the Charity Organization Society in the mid-19th century, which was founded by Helen Bosanquet and Octavia Hill in London, England. Most historians identify COS as the pioneering organization of the social theory that led to the emergence of social work as a professional occupation. COS had its main focus on individual casework. The second was social administration, which included various forms of poverty relief – 'relief of paupers'. Statewide poverty relief could be said to have its roots in the English Poor Laws of the 17th century but was first systematized through the efforts of the Charity Organization Society. The third consisted of social action – rather than engaging in the resolution of immediate individual requirements, the emphasis was placed on political action working through the community and the group to improve their social conditions and thereby alleviate poverty. This approach was developed originally by the Settlement House Movement. This was accompanied by a less easily defined movement; the development of institutions to deal with the entire range of social problems. All had their most rapid growth during the nineteenth century, and laid the foundation basis for modern social work, both in theory and in practice. Professional social work originated in 19th century England, and had its roots in the social and economic upheaval wrought by the Industrial Revolution, in particular, the societal struggle to deal with the resultant mass urban-based poverty and its related problems.
Engagement — social worker must first engage the client in early meetings to promote a collaborative relationship Assessment — data gathered must be specifically aimed at guiding and directing a plan of action to help the client Planning — negotiate and formulate an action plan Implementation — promote resource acquisition and enhance role performance Monitoring/Evaluation — ongoing documentation for assessing the extent to which the client is following through on short-term goal attainment Supportive Counseling — affirming, challenging, encouraging, informing, and exploring options Graduated Disengagement — seeking to replace the social worker with a naturally occurring resource Administration — planning and managing social work programs, providing operations management support, and administrating case management services There are six broad ethical principles in National Association of Social Workers' (NASW) Code of Ethics that inform social work practice, they are both prescriptive and proscriptive, and are based on six core values:
Juvenile court
Q468501 EXACT TITLE 1.000
QID OVERLAP: Q468501 in substance_use_recovery (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (45): "adult", "adults", "age", "authority", "capacity", "changes", "child", "children", "context", "courts", "create", "data", "dependency", "development", "differ", "early", "general", "increasingly", "initiatives", "intervention".... | EXACT TITLE in childcare_family: "Juvenile court".
adultadultsageauthoritycapacitychangeschildchildrencontextcourtscreatedatadependencydevelopmentdifferearlygeneralincreasinglyinitiativesinterventionjuvenilelegallocallymeaningmodelneedsparentparticularlypracticeprotection+15
l authority to pass judgements for crimes committed by children who have not attained the age of majority. In most modern legal systems, children who commit a crime are treated differently from legal adults who have committed the same offense. Juveniles have a lack of capacity for understanding their criminal acts, meaning they also have diminished criminal responsibility compared to their adult counterparts. In some states like California and Georgia, juvenile courts also have jurisdiction over dependency proceedings which involve determining whether a child has been abused or neglected by their parent or legal guardian and needs state intervention to protect them from further harm. Industrialized countries differ in whether juveniles should be charged as adults for serious crimes or considered separately. Since the 1970s, minors have been increasingly tried as adults in response to "increases in violent juvenile crime". Young offenders may still not be charged as adults. Serious offenses, such as murder or rape, can be prosecuted through adult court in England. However, as of 2007, no United States data reported any exact numbers of juvenile offenders prosecuted as adults. In contrast, countries such as Australia and Japan are in the early stages of developing and implementing youth-focused justice initiatives positive youth justice as a deferment from adult court. Globally, the United Nations has encouraged nations to reform their systems to fit with a model in which "entire society [must] ensure the harmonious development of adolescence" despite the delinquent behavior that may be causing issues. The hope was to create a more "child-friendly justice". Despite all the changes made by the United Nations, the rules in practice are less clear cut. Changes in a broad context cause issues of implementation locally, and international crimes committed by youth are causing additional questions regarding the benefit of separate proceedings for juveniles. Issues of juvenile justice have gained global prominence in various cultural contexts. As globalization has progressed in recent centuries, questions about justice, particularly concerning the protection of children's rights within juvenile courts, have come to the forefront.
legal adults who have committed the same offense. Juveniles have a lack of capacity for understanding their criminal acts, meaning they also have diminished criminal responsibility compared to their adult counterparts. In some states like California and Georgia, juvenile courts also have jurisdiction over dependency proceedings which involve determining whether a child has been abused or neglected by their parent or legal guardian and needs state intervention to protect them from further harm. Industrialized countries differ in whether juveniles should be charged as adults for serious crimes or considered separately. Since the 1970s, minors have been increasingly tried as adults in response to "increases in violent juvenile crime". Young offenders may still not be charged as adults. Serious offenses, such as murder or rape, can be prosecuted through adult court in England. However, as of 2007, no United States data reported any exact numbers of juvenile offenders prosecuted as adults. In contrast, countries such as Australia and Japan are in the early stages of developing and implementing youth-focused justice initiatives positive youth justice as a deferment from adult court. Globally, the United Nations has encouraged nations to reform their systems to fit with a model in which "entire society [must] ensure the harmonious development of adolescence" despite the delinquent behavior that may be causing issues. The hope was to create a more "child-friendly justice". Despite all the changes made by the United Nations, the rules in practice are less clear cut. Changes in a broad context cause issues of implementation locally, and international crimes committed by youth are causing additional questions regarding the benefit of separate proceedings for juveniles. Issues of juvenile justice have gained global prominence in various cultural contexts. As globalization has progressed in recent centuries, questions about justice, particularly concerning the protection of children's rights within juvenile courts, have come to the forefront.
as been abused or neglected by their parent or legal guardian and needs state intervention to protect them from further harm. Industrialized countries differ in whether juveniles should be charged as adults for serious crimes or considered separately. Since the 1970s, minors have been increasingly tried as adults in response to "increases in violent juvenile crime". Young offenders may still not be charged as adults. Serious offenses, such as murder or rape, can be prosecuted through adult court in England. However, as of 2007, no United States data reported any exact numbers of juvenile offenders prosecuted as adults. In contrast, countries such as Australia and Japan are in the early stages of developing and implementing youth-focused justice initiatives positive youth justice as a deferment from adult court. Globally, the United Nations has encouraged nations to reform their systems to fit with a model in which "entire society [must] ensure the harmonious development of adolescence" despite the delinquent behavior that may be causing issues. The hope was to create a more "child-friendly justice". Despite all the changes made by the United Nations, the rules in practice are less clear cut. Changes in a broad context cause issues of implementation locally, and international crimes committed by youth are causing additional questions regarding the benefit of separate proceedings for juveniles. Issues of juvenile justice have gained global prominence in various cultural contexts. As globalization has progressed in recent centuries, questions about justice, particularly concerning the protection of children's rights within juvenile courts, have come to the forefront.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (33): "activities", "adult", "age", "agencies", "beyond", "college", "continuing", "curriculum", "development", "different", "division", "economic", "education", "formal", "frequently", "general", "helping", "institutional", "intended", "least".... | EXACT TITLE in substance_use_recovery: "Continuing education". | EXACT TITLE in childcare_family: "Continuing education".
activitiesadultageagenciesbeyondcollegecontinuingcurriculumdevelopmentdifferentdivisioneconomiceducationformalfrequentlygeneralhelpinginstitutionalintendedleastoperationprofessionalprogramsprovisionratherrevenueschoolseparatestudentssupport+3
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
aditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
enue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (18): "activity", "among", "boise", "business", "college", "division", "education", "health", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research", "school", "university". | EXACT TITLE in substance_use_recovery: "Boise State University". | EXACT TITLE in childcare_family: "Boise State University".
activityamongboisebusinesscollegedivisioneducationhealthidahoindependentinstitutionprogramprogramspublicreportedresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Telehealth
Q46994 EXACT TITLE 1.000
QID OVERLAP: Q46994 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (41): "access", "administration", "another", "application", "applications", "care", "case", "clinical", "clinicians", "conditions", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "healthcare", "home".... | EXACT TITLE in substance_use_recovery: "Telehealth". | EXACT TITLE in childcare_family: "Telehealth".
accessadministrationanotherapplicationapplicationscarecaseclinicalcliniciansconditionsdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcarehomeimproveinformationlimitedlivemanagementmedicalportalspracticeprofessionalprovider+11
t an intervening health care provider." When rural settings, lack of transport, a lack of mobility, conditions due to outbreaks, epidemics or pandemics, decreased funding, or a lack of staff restrict access to care, telemedicine may bridge the gap and can even improve retention in treatment as well as provide distance-learning; meetings, supervision, and presentations between practitioners; online information and health data management and healthcare system integration.
gration. EHealth encompasses a wide range of applications, including but not limited to the following: Two clinicians discussing a case via video conference; Robotic surgery performed through remote access; Physical therapy conducted using digital monitoring instruments, live feed, and application combinations; Diagnostic tests transferred between facilities for interpretation by a higher specialist; Home monitoring through continuous transmission of patient health data; Online consultations between patients and practitioners; Video remote interpretation services for clinical visits.
Telehealth versus telemedicine Telehealth is sometimes discussed interchangeably with telemedicine, the latter being more common than the former. Telehealth has been described as a disruptive innovation in healthcare because it enables medical services to be delivered remotely using communication technologies. The Health Resources and Services Administration distinguishes telehealth from telemedicine in its scope, defining telemedicine only as describing remote clinical services, such as diagnosis and monitoring, while telehealth includes preventative, promotive, and curative care delivery. This includes the above-mentioned non-clinical applications, like administration and provider education. The United States Department of Health and Human Services states that the term telehealth includes "non-clinical services, such as provider training, administrative meetings, and continuing medical education", and that the term telemedicine means "remote clinical services". The World Health Organization uses telemedicine to describe all aspects of health care including preventive care. The American Telemedicine Association uses the terms telemedicine and telehealth interchangeably, although it acknowledges that telehealth is sometimes used more broadly for remote health not involving active clinical treatments. eHealth is another related term, used particularly in the U.K. and Europe, as an umbrella term that includes telehealth, electronic medical records, and other components of health information technology. Methods and modalities Telehealth requires good Internet access by participants, usually in the form of a strong, reliable broadband connection, and broadband mobile communication technology of at least the fourth generation (4G) or long-term evolution (LTE) standard to overcome issues with video stability and bandwidth restrictions. As broadband infrastructure has improved, telehealth usage has become more widely feasible. Healthcare providers often begin telehealth with a needs assessment which assesses hardships that can be improved by telehealth such as travel time, costs or time off work. Collaborators such as technology companies can ease the transition. Delivery can come within four distinct domains: live video (synchronous), store-and-forward (asynchronous), remote patient monitoring, and mobile health. Audio-based telemedicine, primarily through telephone consultations, has been studied as a tool for managing chronic conditions.
N
Q163740 EXACT TITLE 1.000
QID OVERLAP: Q163740 in substance_use_recovery (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (24): "business", "community", "faith", "hospitals", "institution", "local", "meaning", "mission", "nonprofit", "operated", "operates", "operations", "organization", "organizations", "private", "program", "public", "purpose", "rather", "revenue".... | EXACT TITLE in childcare_family: "Nonprofit organization".
businesscommunityfaithhospitalsinstitutionlocalmeaningmissionnonprofitoperatedoperatesoperationsorganizationorganizationsprivateprogrampublicpurposeratherrevenueschoolssocialstatussubject
A nonprofit organization (NPO), also known as a nonbusiness entity, nonprofit institution, not-for-profit organization (NFPO), or simply nonprofit, is a non-governmental entity that operates for a collective, public, or social benefit, rather than to generate profit for private owners. Nonprofit organizations are subject to a non-distribution constraint, meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
Management Most nonprofits have staff that work for the organization, possibly using volunteers to perform the nonprofit's services under the direction of the paid staff. Nonprofits must be careful to balance the salaries paid to staff against the money paid to provide services to the nonprofit's beneficiaries. Organizations whose salary expenses are too high relative to their program expenses may face regulatory scrutiny. Some have the misconception that nonprofit organizations may not make a profit. Although the goal of nonprofits is not specifically to maximize profits, they still have to operate as a fiscally responsible business. They must manage their income (grants, donations, and income from services) and expenses so as to remain a fiscally viable entity. Nonprofits have the responsibility of focusing on being professional and financially responsible, replacing self-interest and profit motive with mission motive. Though nonprofits are managed differently from for-profit businesses, they have felt pressure to be more businesslike. To combat private and public business growth in the public service industry, some nonprofits have modeled their business management and mission, shifting their reason of existing to establish sustainability and growth. Setting effective missions is a key for the successful management of nonprofit organizations. There are three important conditions for effective mission: opportunity, competence, and commitment. One way of managing the sustainability of nonprofit organizations is to establish strong relations with donor groups. This requires a donor marketing strategy, something many nonprofits lack. Nonprofit organizations need to motivate staff, maintain and communicate a vision, set a strategic direction, manage change effectively, and provide a safe working environment for employees, volunteers, and visitors.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in substance_use_recovery (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (12): "association", "boise", "historically", "idaho", "local", "lower", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in substance_use_recovery: "Treasure Valley". | EXACT TITLE in childcare_family: "Treasure Valley".
associationboisehistoricallyidaholocallowerregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.800
QID OVERLAP: Q1111004 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (21): "act", "ada", "against", "business", "changes", "costs", "covered", "disability", "employers", "final", "house", "identity", "individuals", "law", "national", "protection", "protections", "public", "requirements", "requires"....
actadaagainstbusinesschangescostscovereddisabilityemployersfinalhouseidentityindividualslawnationalprotectionprotectionspublicrequirementsrequiresrights
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (15): "ada", "annual", "block", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "population", "technology", "treasure", "valley".
adaannualblockboisecapitalcountiesemployershomeidaholocallymajorpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Boise metropolitan area
Q4938481 QID OVERLAP 0.760
QID OVERLAP: Q4938481 in substance_use_recovery (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (13): "ada", "boise", "canyon", "combined", "counties", "home", "idaho", "meridian", "nampa", "percent", "population", "treasure", "valley".
adaboisecanyoncombinedcountieshomeidahomeridiannampapercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "nampa", "population", "principal", "university", "western".
boisecanyoncollegehomeidahomeaningmeridiannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
R
Q1339196 QID OVERLAP 0.720
QID OVERLAP: Q1339196 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (11): "contacts", "designed", "distinct", "family", "influence", "information", "marketing", "primary", "process", "referral", "referrals".
contactsdesigneddistinctfamilyinfluenceinformationmarketingprimaryprocessreferralreferrals
Referral marketing is a word-of-mouth initiative designed by a company to incentivize existing customers to introduce their family, friends, and contacts to become new customers.
ity to track—referral marketing actively incentivizes and rewards existing customers for referring new ones, allowing the company to influence, track, and measure the referral process. The process is distinct from multi-level marketing, in that there is no incentive for the original existing customer to drive or influence the subsequent referrals of the new customer – only the conversion of the initial, primary customer is rewarded.
Online referral marketing Online referral marketing is the internet-based, or Software as a Service (SaaS) approach, to traditional referral marketing. By tracking customer behavior online through the use of web browser cookies and similar technology, online referral marketing can potentially increase brand awareness, referrals and, ultimately, revenue. Many platforms allow organizations to see their referral marketing return on investment (ROI), and to optimize their campaigns to improve results. Many of the newest systems provide users with the same experience whether they are on a desktop or mobile device. Offline referral marketers sometimes use trackable business cards. Trackable business cards typically contain QR codes linking them to online content for sale while providing a way to track that sale back to the person whose card was scanned. Online referral marketing focuses on interactions between customers. The Internet is a common channel for referral-based marketing. It delivers abundant outlets for customers to share their opinions, product favourites, and experiences, including the company's website and through social media. The marketers can encourage the referring parties by providing pre-scripted messages. Advocates can provide their family members and friends with personalised links including unique referral codes and advertisement information through e-mails, blogs and instant messages. The company can give rewards to advocates when their family members and friends buy through the link. These same technologies also help companies set up a system that integrates referrals into the marketing plan.
Ada County, Idaho
QID OVERLAP 0.680
QID OVERLAP: Q109820 in substance_use_recovery (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "capital", "district", "home", "idaho", "local", "population", "private".
adaboisecapitaldistricthomeidaholocalpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in substance_use_recovery (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
boisecaldwellcanyoncollegeidaholocallypopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
224 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP224 edges
🌲 EVERGREEN1 edges
0.650
agecarechildchildrenearlyeducationnetworkoperatedoperatesownedprivateprogramsproviderprovidingschools
SHARED TOKENS (15): "age", "care", "child", "children", "early", "education", "network", "operated", "operates", "owned", "private", "programs", "provider", "providing", "schools". | URL->B (1): https://www.roarkcapital.com/files/Primrose-Press_Release.pdf. | EXACT TITLE in childcare_family: "Primrose Schools".
🌿 BRANCH186 edges
0.500
YMCA ↗ Q157169 EXACT TITLE
activitiesassociationbodydevelopmentfacilitieshealthyindependentlocalmovementnationalorganizationorganizationspeoplepracticeprogramsprovidingregionalstatedsubjectwork
SHARED TOKENS (22): "activities", "association", "body", "development", "facilities", "healthy", "independent", "local", "movement", "national", "organization", "organizations", "people", "practice", "programs", "providing", "regional", "stated", "subject", "work".... | EXACT TITLE in childcare_family: "YMCA".
0.500
Orphanage ↗ Q160645 EXACT TITLE
abusecannotcarecenterschildchildrencommunitiescontroldescribedfamiliesfamilyfundinggroupgroupshomehomesincreaseinstitutioninstitutionslegal
SHARED TOKENS (35): "abuse", "cannot", "care", "centers", "child", "children", "communities", "control", "described", "families", "family", "funding", "group", "groups", "home", "homes", "increase", "institution", "institutions", "legal".... | EXACT TITLE in childcare_family: "Orphanage".
0.500
businesscostfinancialgrouphouseindependentlivingmodeloperatingorganizationrehabilitationresidentsrulessystemtreatment
SHARED TOKENS (15): "business", "cost", "financial", "group", "house", "independent", "living", "model", "operating", "organization", "rehabilitation", "residents", "rules", "system", "treatment". | EXACT TITLE in substance_use_recovery: "Oxford House".
0.500
amongcarecoordinationdepartmentsdirectlyearlygeneralhospitalimprovingintensivelimitedmedicalmodelmodelspracticeprimaryprogramsprovidersprovidingqualified
SHARED TOKENS (26): "among", "care", "coordination", "departments", "directly", "early", "general", "hospital", "improving", "intensive", "limited", "medical", "model", "models", "practice", "primary", "programs", "providers", "providing", "qualified".... | EXACT TITLE in substance_use_recovery: "Emergency medicine".
0.500
Parenting ↗ Q1217379 EXACT TITLE
affectcarechildchildrencognitivedevelopmenteducationalexperiencesfamilyhistoryinfluencelegallong-termolderoutcomesparentalparentingparentsparticularlyprocess
SHARED TOKENS (29): "affect", "care", "child", "children", "cognitive", "development", "educational", "experiences", "family", "history", "influence", "legal", "long-term", "older", "outcomes", "parental", "parenting", "parents", "particularly", "process".... | EXACT TITLE in substance_use_recovery: "Parenting". | EXACT TITLE in childcare_family: "Parenting".
0.500
adultagechildrencoordinationdesigneddevelopmentdifferentfacilitiesgroupsinformalinstitutionsolderpeopleprovidingpublicsafeschoolssocialstructuressupporting
SHARED TOKENS (20): "adult", "age", "children", "coordination", "designed", "development", "different", "facilities", "groups", "informal", "institutions", "older", "people", "providing", "public", "safe", "schools", "social", "structures", "supporting". | EXACT TITLE in childcare_family: "Playground".
0.500
accesscarecenterdepartmentdepartmentsentryfacilityfoundhospitalhospitalshoursimportantlevelsmedicaloperatepointspresentprimaryrequirestaffing
SHARED TOKENS (21): "access", "care", "center", "department", "departments", "entry", "facility", "found", "hospital", "hospitals", "hours", "important", "levels", "medical", "operate", "points", "present", "primary", "require", "staffing".... | EXACT TITLE in substance_use_recovery: "Emergency department".
0.500
anotherassistancecapacityfoundfoundationintendedkeeplawlegalmedicaloperateparentalpeopleprofessionalprotectionpurposereducerequiresrightssystem
SHARED TOKENS (22): "another", "assistance", "capacity", "found", "foundation", "intended", "keep", "law", "legal", "medical", "operate", "parental", "people", "professional", "protection", "purpose", "reduce", "requires", "rights", "system".... | EXACT TITLE in substance_use_recovery: "Good Samaritan law".
0.500
absenceactivitiesaffectaffectsamongbroadercommunitycreatedailydecisionsdefinesdetermineshealthindividualmentalmerelyorganizationpeopleprofessionalrather
SHARED TOKENS (24): "absence", "activities", "affect", "affects", "among", "broader", "community", "create", "daily", "decisions", "defines", "determines", "health", "individual", "mental", "merely", "organization", "people", "professional", "rather".... | EXACT TITLE in substance_use_recovery: "Mental health". | EXACT TITLE in childcare_family: "Mental health".
0.500
Family court ↗ Q82749 EXACT TITLE
addressagainstchangeschildcourtscreateddecisionsdifferentdistinctionfamilylawlegalmattersrelationshipsrequirementsrulessupportsystem
SHARED TOKENS (18): "address", "against", "changes", "child", "courts", "created", "decisions", "different", "distinction", "family", "law", "legal", "matters", "relationships", "requirements", "rules", "support", "system". | EXACT TITLE in substance_use_recovery: "Family court". | EXACT TITLE in childcare_family: "Family court".
0.500
affectsamongaroundcarechildcostdifferenteducationevenexperiencefamilyhealthhealthcareindividualsinvestmentlivingparticularlyplanningreducethough
SHARED TOKENS (21): "affects", "among", "around", "care", "child", "cost", "different", "education", "even", "experience", "family", "health", "healthcare", "individuals", "investment", "living", "particularly", "planning", "reduce", "though".... | EXACT TITLE in childcare_family: "Maternal health".
0.500
abuseadultaffectsageagencyamongapprovedcarechildchildrenclientscommunityconditionscreateddatadecisionsdescribedfamiliesfamilygeneral
SHARED TOKENS (46): "abuse", "adult", "affects", "age", "agency", "among", "approved", "care", "child", "children", "clients", "community", "conditions", "created", "data", "decisions", "described", "families", "family", "general".... | EXACT TITLE in childcare_family: "Foster care".
0.500
activecommunitydepartmentsdifferentfamiliesfundinghealthhomelessnesshousingindividualsintendedlivementalpeopleprofessionalstablework
SHARED TOKENS (17): "active", "community", "departments", "different", "families", "funding", "health", "homelessness", "housing", "individuals", "intended", "live", "mental", "people", "professional", "stable", "work". | EXACT TITLE in substance_use_recovery: "Supportive housing".
0.500
Family ↗ Q8436 EXACT TITLE
categorieschildrencommunitycreateeconomicfamiliesfamilygrouphistoricallyhistoryimportantorganizationsparentspeopleprimarypurposerelatedrelationshipsafetysocial
SHARED TOKENS (21): "categories", "children", "community", "create", "economic", "families", "family", "group", "historically", "history", "important", "organizations", "parents", "people", "primary", "purpose", "related", "relationship", "safety", "social".... | EXACT TITLE in substance_use_recovery: "Family". | EXACT TITLE in childcare_family: "Family".
0.500
Living wage ↗ Q543406 EXACT TITLE
authoritycampaignscarechildcreateddefineddefinitiondemanddiscoveryeconomicemploymentfamilyfoodhealthhourshouseholdhousingimprovelaborlegal
SHARED TOKENS (37): "authority", "campaigns", "care", "child", "created", "defined", "definition", "demand", "discovery", "economic", "employment", "family", "food", "health", "hours", "household", "housing", "improve", "labor", "legal".... | EXACT TITLE in childcare_family: "Living wage".
0.500
Fentanyl ↗ Q407541 EXACT TITLE
alongsideamongapprovedcaseclinicalfamilyfederalformhealthhealthcareleadlistlocalmakesmanagementmedicalnationalorganizationoutsideprimary
SHARED TOKENS (28): "alongside", "among", "approved", "case", "clinical", "family", "federal", "form", "health", "healthcare", "lead", "list", "local", "makes", "management", "medical", "national", "organization", "outside", "primary".... | EXACT TITLE in substance_use_recovery: "Fentanyl".
0.500
applicableassistancecasecoachingcommunitiescredentialsdescribeddevelopmenteducationformalfoundinformalinstitutionsintensiveknowledgepracticeprofessionalschoolsstudysupervision
SHARED TOKENS (21): "applicable", "assistance", "case", "coaching", "communities", "credentials", "described", "development", "education", "formal", "found", "informal", "institutions", "intensive", "knowledge", "practice", "professional", "schools", "study", "supervision".... | EXACT TITLE in substance_use_recovery: "Professional development".
0.500
analysisanotherapplicationclinicalcommunitycontroleducationalfamilyframeworkhealthmanagementmentalmodelprogramrulestherapytrainingtreatmentuses
SHARED TOKENS (19): "analysis", "another", "application", "clinical", "community", "control", "educational", "family", "framework", "health", "management", "mental", "model", "program", "rules", "therapy", "training", "treatment", "uses". | EXACT TITLE in substance_use_recovery: "Contingency management".
0.500
agencybeganchildrencreatedcreatingdepartmentenforcementforceidaholawmunicipalorganizationpolicepresentpreventpublicstatewide
SHARED TOKENS (17): "agency", "began", "children", "created", "creating", "department", "enforcement", "force", "idaho", "law", "municipal", "organization", "police", "present", "prevent", "public", "statewide". | EXACT TITLE in substance_use_recovery: "Idaho State Police".
0.500
administrationadministrativeanalysisanalyzingcostcostsdifferentdocumenteddutieseconomicestablishedevaluatorsfundinginformationintendedlawmanagementmarketoutcomesparticipant
SHARED TOKENS (46): "administration", "administrative", "analysis", "analyzing", "cost", "costs", "different", "documented", "duties", "economic", "established", "evaluators", "funding", "information", "intended", "law", "management", "market", "outcomes", "participant".... | EXACT TITLE in substance_use_recovery: "Program evaluation".
0.500
adaadultboisecampuscanyoncollegecommunitycomprehensivecountiesdevelopmenteducationgovernedidahonampapopulationprimaryprogramspublicreportedresidents
SHARED TOKENS (27): "ada", "adult", "boise", "campus", "canyon", "college", "community", "comprehensive", "counties", "development", "education", "governed", "idaho", "nampa", "population", "primary", "programs", "public", "reported", "residents".... | EXACT TITLE in childcare_family: "College of Western Idaho".
0.500
abuseactivityaffectsamongapprovedchangesclassificationdifferenthealthhistoryhoursimportantincreaselistmedicalorganizationpointreportedrisksafe
SHARED TOKENS (25): "abuse", "activity", "affects", "among", "approved", "changes", "classification", "different", "health", "history", "hours", "important", "increase", "list", "medical", "organization", "point", "reported", "risk", "safe".... | EXACT TITLE in substance_use_recovery: "Buprenorphine".
0.500
articlecentralchangesclientsclinicalcognitivecounselingdefineddescribeddescriptionexperiencehelpinginfluencemakingproblempublishedpurposeratherrelationshiptherapy
SHARED TOKENS (21): "article", "central", "changes", "clients", "clinical", "cognitive", "counseling", "defined", "described", "description", "experience", "helping", "influence", "making", "problem", "published", "purpose", "rather", "relationship", "therapy".... | EXACT TITLE in substance_use_recovery: "Motivational interviewing".
0.500
activitiesagechildrendescribeeducationeducationalhomeinstitutionsoutsideparentsschoolservesocialtransitionwhose
SHARED TOKENS (15): "activities", "age", "children", "describe", "education", "educational", "home", "institutions", "outside", "parents", "school", "serve", "social", "transition", "whose". | EXACT TITLE in childcare_family: "Kindergarten".
0.500
Pharmacy ↗ EXACT TITLE
affordablecareclinicalcommunitydirecthealthinformationinstitutionallinksofficepracticeprimaryproducingproductsprofessionalprovidingrelatedsafesafetysupplies
SHARED TOKENS (24): "affordable", "care", "clinical", "community", "direct", "health", "information", "institutional", "links", "office", "practice", "primary", "producing", "products", "professional", "providing", "related", "safe", "safety", "supplies".... | EXACT TITLE in substance_use_recovery: "Pharmacy".
0.500
ageamongcarechangesclinicalclinicianscombinesconditionsdatadesigneddifferentdigitalhealthhealthcarehistoryidentifyimproveinformationlong-termmedical
SHARED TOKENS (41): "age", "among", "care", "changes", "clinical", "clinicians", "combines", "conditions", "data", "designed", "different", "digital", "health", "healthcare", "history", "identify", "improve", "information", "long-term", "medical".... | EXACT TITLE in substance_use_recovery: "Electronic health record".
0.500
agearoundcarecentralchildchildrencognitivecollegecostscurriculumdescribeddevelopmentearlyeducationeducationalfederalfoundationfundinggoverningimportant
SHARED TOKENS (48): "age", "around", "care", "central", "child", "children", "cognitive", "college", "costs", "curriculum", "described", "development", "early", "education", "educational", "federal", "foundation", "funding", "governing", "important".... | EXACT TITLE in childcare_family: "Early childhood education".
0.500
clinicalconnectioncontinuingcontrolcounselingdistincteducationexperienceinitiativesknowledgemedicalorganizationspeerpeoplepersonnelpositionrelationshiprelevantrequiredsocial
SHARED TOKENS (27): "clinical", "connection", "continuing", "control", "counseling", "distinct", "education", "experience", "initiatives", "knowledge", "medical", "organizations", "peer", "people", "personnel", "position", "relationship", "relevant", "required", "social".... | EXACT TITLE in substance_use_recovery: "Peer support".
0.500
abuseactadministrationagenciesapplicationclassificationcomprehensivecontrolcreateddecisionsdistributionenforcementfederalfoodlawlegislationmedicalnationalpolicyprevention
SHARED TOKENS (27): "abuse", "act", "administration", "agencies", "application", "classification", "comprehensive", "control", "created", "decisions", "distribution", "enforcement", "federal", "food", "law", "legislation", "medical", "national", "policy", "prevention".... | EXACT TITLE in substance_use_recovery: "Controlled Substances Act".
0.500
abuseactagainstageamongbroaderchildchildrencontextcontrolcreatedefinitiondirectdocumentationearlyestablishedexperienceexperiencesfamilyfinancial
SHARED TOKENS (45): "abuse", "act", "against", "age", "among", "broader", "child", "children", "context", "control", "create", "definition", "direct", "documentation", "early", "established", "experience", "experiences", "family", "financial".... | EXACT TITLE in substance_use_recovery: "Domestic violence".
0.500
agecarecentercenterschildchildrencommunitiescommunitycoordinatedcoordinationcountiesdesigneddifferentearlyeducationeligibleexperienceexperiencesfamiliesfamily
SHARED TOKENS (52): "age", "care", "center", "centers", "child", "children", "communities", "community", "coordinated", "coordination", "counties", "designed", "different", "early", "education", "eligible", "experience", "experiences", "families", "family".... | EXACT TITLE in childcare_family: "Early Head Start".
0.500
Disability ↗ Q12131 EXACT TITLE
accessactivitiesactivityagainstaroundbarrierscategoriescenterscognitivecommunitycreateddefinesdescribedifferentdisabilityexperienceframeworkhistoricallyhistoryidentity
SHARED TOKENS (49): "access", "activities", "activity", "against", "around", "barriers", "categories", "centers", "cognitive", "community", "created", "defines", "describe", "different", "disability", "experience", "framework", "historically", "history", "identity".... | EXACT TITLE in substance_use_recovery: "Disability". | EXACT TITLE in childcare_family: "Disability".
0.500
actadministrationagencycommunitydepartmentdistributionenforcementestablishedfederallawleadnationaloperationsprotectionratherreportsschedulinguses
SHARED TOKENS (18): "act", "administration", "agency", "community", "department", "distribution", "enforcement", "established", "federal", "law", "lead", "national", "operations", "protection", "rather", "reports", "scheduling", "uses". | EXACT TITLE in substance_use_recovery: "Drug Enforcement Administration".
0.500
applicantsassociatecarechildchildrencredentialdemonstratedevelopmentearlyeducationfamilyhealthyhomeprofessionalprogramssupport
SHARED TOKENS (16): "applicants", "associate", "care", "child", "children", "credential", "demonstrate", "development", "early", "education", "family", "healthy", "home", "professional", "programs", "support". | EXACT TITLE in childcare_family: "Child Development Associate".
0.500
Methadone ↗ Q179996 EXACT TITLE
abuseamongapproveddailyfrequentlyfunctionhealthhourslistlong-termmaintenancemanagementorganizationpeoplesidesingletherapytreatment
SHARED TOKENS (18): "abuse", "among", "approved", "daily", "frequently", "function", "health", "hours", "list", "long-term", "maintenance", "management", "organization", "people", "side", "single", "therapy", "treatment". | EXACT TITLE in substance_use_recovery: "Methadone".
0.500
Probation ↗ Q13961 EXACT TITLE
abusecasechildcommunityconditionscontactcourtseducationalformerfoundlawleavelimitedlivemovementofficerparticularlypermitprogramremain
SHARED TOKENS (26): "abuse", "case", "child", "community", "conditions", "contact", "courts", "educational", "former", "found", "law", "leave", "limited", "live", "movement", "officer", "particularly", "permit", "program", "remain".... | EXACT TITLE in substance_use_recovery: "Probation".
0.500
adultsagenciescarechildrendisabilityfamilyhealthhomeindividualinstitutionallong-termmentalneedspeopleratherrequiredresidentialsupportvoluntary
SHARED TOKENS (19): "adults", "agencies", "care", "children", "disability", "family", "health", "home", "individual", "institutional", "long-term", "mental", "needs", "people", "rather", "required", "residential", "support", "voluntary". | EXACT TITLE in substance_use_recovery: "Residential care".
0.500
Child care ↗ Q1455871 EXACT TITLE
accessactivitiesaffordableanothercarecenterschildchildrencommunitiescontextdailydevelopmentearlyeconomiceducationeducationalfacilityfamiliesfamilyforce
SHARED TOKENS (45): "access", "activities", "affordable", "another", "care", "centers", "child", "children", "communities", "context", "daily", "development", "early", "economic", "education", "educational", "facility", "families", "family", "force".... | EXACT TITLE in childcare_family: "Child care".
0.500
Drug court ↗ Q5308883 EXACT TITLE
addresscombinedcommunitiescourtsenforcementhealthlawlong-termmentalmodelprocesspublicpurposereducesocialtreatmentwork
SHARED TOKENS (17): "address", "combined", "communities", "courts", "enforcement", "health", "law", "long-term", "mental", "model", "process", "public", "purpose", "reduce", "social", "treatment", "work". | EXACT TITLE in substance_use_recovery: "Drug court".
0.500
addressassociationbehavioralchildrencognitivecombinedcombinesconditionsdefineddesigneddevelopmentformhealthhelpingidentifiedimproveindividuallimitedmaintenancemedical
SHARED TOKENS (35): "address", "association", "behavioral", "children", "cognitive", "combined", "combines", "conditions", "defined", "designed", "development", "form", "health", "helping", "identified", "improve", "individual", "limited", "maintenance", "medical".... | EXACT TITLE in substance_use_recovery: "Cognitive behavioral therapy".
0.500
administrationassistancebeganblockchildrencreatesdepartmentdesigneddivisioneducationaleligiblefamiliesfederalfundsgranthealthhomehoursleastmaintenance
SHARED TOKENS (33): "administration", "assistance", "began", "block", "children", "creates", "department", "designed", "division", "educational", "eligible", "families", "federal", "funds", "grant", "health", "home", "hours", "least", "maintenance".... | EXACT TITLE in childcare_family: "Temporary Assistance for Needy Families".
0.500
Psychology ↗ Q9418 EXACT TITLE
activityanotherassessmentbehavioralclinicalcognitivecounselingdevelopmenteducationexperiencesfamilyfunctioningfunctionsgroupgroupshealthhospitalsindividualindividualsknowledge
SHARED TOKENS (42): "activity", "another", "assessment", "behavioral", "clinical", "cognitive", "counseling", "development", "education", "experiences", "family", "functioning", "functions", "group", "groups", "health", "hospitals", "individual", "individuals", "knowledge".... | EXACT TITLE in substance_use_recovery: "Psychology".
0.500
advertisingbusinesscapacitycasecommercialdefinedexpandedfamiliesfamilyhomehouseofficeoperateoperatedoperatesparkingresidentialruralsmallwork
SHARED TOKENS (21): "advertising", "business", "capacity", "case", "commercial", "defined", "expanded", "families", "family", "home", "house", "office", "operate", "operated", "operates", "parking", "residential", "rural", "small", "work".... | EXACT TITLE in childcare_family: "Home business".
0.500
accessactivitiesactivityagainstanothercampaignscarechangesdesigneddifferenteducationfacilitiesfoodfreehealthhealthyhomelessnessinformationinitiativesinsecurity
SHARED TOKENS (46): "access", "activities", "activity", "against", "another", "campaigns", "care", "changes", "designed", "different", "education", "facilities", "food", "free", "health", "healthy", "homelessness", "information", "initiatives", "insecurity".... | EXACT TITLE in substance_use_recovery: "Harm reduction".
0.500
Indeed ↗ EXACT TITLE
aroundbegancentralcomdirectlyemployersemploymentindependentpagesrecruitrevenuesearchsinglesitestaffing
SHARED TOKENS (15): "around", "began", "central", "com", "directly", "employers", "employment", "independent", "pages", "recruit", "revenue", "search", "single", "site", "staffing". | EXACT TITLE in childcare_family: "Indeed".
0.500
Pharmacist ↗ Q105186 EXACT TITLE
amongapprovedcareclinicalcommunitycounseldifferenteducationhealthhealthcarehospitalindustryknowledgelegallegislationlicensingmanagementmechanismmechanismspositions
SHARED TOKENS (38): "among", "approved", "care", "clinical", "community", "counsel", "different", "education", "health", "healthcare", "hospital", "industry", "knowledge", "legal", "legislation", "licensing", "management", "mechanism", "mechanisms", "positions".... | EXACT TITLE in substance_use_recovery: "Pharmacist".
0.500
Alcoholism ↗ Q15326 EXACT TITLE
affectsamongbehavioralchildclinicalcognitivecontextcostcostsdevelopmentdirectlyfoundgroupgroupshealthincreaseindividualinformalinformationkeep
SHARED TOKENS (46): "affects", "among", "behavioral", "child", "clinical", "cognitive", "context", "cost", "costs", "development", "directly", "found", "group", "groups", "health", "increase", "individual", "informal", "information", "keep".... | EXACT TITLE in substance_use_recovery: "Alcoholism".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessactivitiesapplicablechildrencommunitiesconditionscontactdefineddevelopmentgeneralhealthlevelslimitedmaintainingoperatingparticularlypeopleprovidingpublicrelated
SHARED TOKENS (29): "access", "activities", "applicable", "children", "communities", "conditions", "contact", "defined", "development", "general", "health", "levels", "limited", "maintaining", "operating", "particularly", "people", "providing", "public", "related".... | EXACT TITLE in childcare_family: "Sanitation".
0.500
activeaffectamongassociationciviccommunitiescommunitycontextcreateddefineddefinesdevelopmenteconomiceducationgroupsidentityimproveindividualsinstitutionslocal
SHARED TOKENS (38): "active", "affect", "among", "association", "civic", "communities", "community", "context", "created", "defined", "defines", "development", "economic", "education", "groups", "identity", "improve", "individuals", "institutions", "local".... | EXACT TITLE in substance_use_recovery: "Community development".
0.500
aroundbuildingcommunitiescommunitydevelopmentdistinctexperiencefunctioninghealthmakingmodelnetworksoperateoperatingorganizationorganizationssocialsocietyspacevoluntary
SHARED TOKENS (22): "around", "building", "communities", "community", "development", "distinct", "experience", "functioning", "health", "making", "model", "networks", "operate", "operating", "organization", "organizations", "social", "society", "space", "voluntary".... | EXACT TITLE in substance_use_recovery: "Community organization". | EXACT TITLE in childcare_family: "Community organization".
0.500
affectsbusinesscertificationconsumercreateseconomicentryformfreefrequentlygeneralhealthindividualindividualslawleastlicenselicensedlicensinglicensure
SHARED TOKENS (40): "affects", "business", "certification", "consumer", "creates", "economic", "entry", "form", "free", "frequently", "general", "health", "individual", "individuals", "law", "least", "license", "licensed", "licensing", "licensure".... | EXACT TITLE in substance_use_recovery: "Occupational licensing".
0.500
accessbehavioralcommunitycurriculumdesigneddifferenteducationeducationalgeneralimproveindividualindividualsmaterialsneedspracticeprovisionreduceresourceschoolseparate
SHARED TOKENS (25): "access", "behavioral", "community", "curriculum", "designed", "different", "education", "educational", "general", "improve", "individual", "individuals", "materials", "needs", "practice", "provision", "reduce", "resource", "school", "separate".... | EXACT TITLE in childcare_family: "Special education".
0.500
affordabilityaffordabledemandeconomicformalhomehomelessnesshouseholdhousingindexinformallocalmarketsnationalownershipresponsesocialsupply
SHARED TOKENS (18): "affordability", "affordable", "demand", "economic", "formal", "home", "homelessness", "household", "housing", "index", "informal", "local", "markets", "national", "ownership", "response", "social", "supply". | EXACT TITLE in substance_use_recovery: "Affordable housing". | EXACT TITLE in childcare_family: "Affordable housing".
0.500
amongcounselingdefinitiondesigneddevelopmentfamilygeneralgrouphealthincorporatedindividualinterventionlong-termmedicalmentalorganizationsoversightpathwaypeopleprevention
SHARED TOKENS (32): "among", "counseling", "definition", "designed", "development", "family", "general", "group", "health", "incorporated", "individual", "intervention", "long-term", "medical", "mental", "organizations", "oversight", "pathway", "people", "prevention".... | EXACT TITLE in substance_use_recovery: "Addiction medicine".
0.500
Care work ↗ Q5038877 EXACT TITLE
activitiesaddresscarecenterschildcommunitiesconditionscostdatadescribeddevelopmentdirectdistributionemploymentfamiliesfamilyformformalgrouphospitals
SHARED TOKENS (41): "activities", "address", "care", "centers", "child", "communities", "conditions", "cost", "data", "described", "development", "direct", "distribution", "employment", "families", "family", "form", "formal", "group", "hospitals".... | EXACT TITLE in childcare_family: "Care work".
0.500
activitiesageanotheraroundblockbodybuildingcapacitycarechangeschildchildrencognitivecreatesdefineddescribedevelopmentearlyeducationalestablished
SHARED TOKENS (48): "activities", "age", "another", "around", "block", "body", "building", "capacity", "care", "changes", "child", "children", "cognitive", "creates", "defined", "describe", "development", "early", "educational", "established".... | EXACT TITLE in childcare_family: "Child development".
0.500
abuseadultsagebehavioralcategoriescategorydirectdirectlyhealthindividualmentaloperatingpatternpeoplepercentqualifiedreducerelated
SHARED TOKENS (18): "abuse", "adults", "age", "behavioral", "categories", "category", "direct", "directly", "health", "individual", "mental", "operating", "pattern", "people", "percent", "qualified", "reduce", "related". | EXACT TITLE in substance_use_recovery: "Substance use disorder".
0.500
adultsamongbehavioralcentralcognitivecombinedconditionsdepartmentexposurefacilitiesfrequentlyhealthlistlong-termmajormedicalolderoutsidepeopleproperties
SHARED TOKENS (33): "adults", "among", "behavioral", "central", "cognitive", "combined", "conditions", "department", "exposure", "facilities", "frequently", "health", "list", "long-term", "major", "medical", "older", "outside", "people", "properties".... | EXACT TITLE in substance_use_recovery: "Benzodiazepine".
0.500
activeaddressescomprehensivecounselingdailydependencyeducationalengagementfacilitiesfacilityfamilygroupgroupshealthhospitalhoursindividualintensivementaloperates
SHARED TOKENS (34): "active", "addresses", "comprehensive", "counseling", "daily", "dependency", "educational", "engagement", "facilities", "facility", "family", "group", "groups", "health", "hospital", "hours", "individual", "intensive", "mental", "operates".... | EXACT TITLE in substance_use_recovery: "Intensive outpatient program".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcarecertificationclinicalcredentialsdemandeducationfamiliesfunctioninghealthhealthcareimprovelevelspracticepreventionprotectionprovidersprovidingpublicqualified
SHARED TOKENS (26): "act", "care", "certification", "clinical", "credentials", "demand", "education", "families", "functioning", "health", "healthcare", "improve", "levels", "practice", "prevention", "protection", "providers", "providing", "public", "qualified".... | EXACT TITLE in substance_use_recovery: "Nursing".
0.500
accessactiveaffectsaffordableageagencyanotheravailabilitybeyondchildrencognitivecreatedevelopmentearlyeconomicevenfamilyfoodfuturehealth
SHARED TOKENS (48): "access", "active", "affects", "affordable", "age", "agency", "another", "availability", "beyond", "children", "cognitive", "create", "development", "early", "economic", "even", "family", "food", "future", "health".... | EXACT TITLE in childcare_family: "Food security".
0.500
Franchising ↗ Q171947 EXACT TITLE
anotherbrandedbusinesscapitalconditionscontrollingcorporatedirecteconomicexpansionexplicitlyfeesfinancialindividualinvestmentlegallicenseslicensingmarketmodel
SHARED TOKENS (32): "another", "branded", "business", "capital", "conditions", "controlling", "corporate", "direct", "economic", "expansion", "explicitly", "fees", "financial", "individual", "investment", "legal", "licenses", "licensing", "market", "model".... | EXACT TITLE in childcare_family: "Franchising".
0.500
actchildrencognitivecomprehensivecurrentdepartmentdesignedearlyeducationestablishexpandedfamiliesfamilyfederalhealthnetworkoutsideparentprogramrelationships
SHARED TOKENS (26): "act", "children", "cognitive", "comprehensive", "current", "department", "designed", "early", "education", "establish", "expanded", "families", "family", "federal", "health", "network", "outside", "parent", "program", "relationships".... | EXACT TITLE in childcare_family: "Head Start (program)".
0.500
agenciesbegancarecasecontactdepartmentfacilitieshistoricallyhospitalleastlevelsmedicalmodeloperatepersonnelpointpresentprimaryprovidingpublic
SHARED TOKENS (31): "agencies", "began", "care", "case", "contact", "department", "facilities", "historically", "hospital", "least", "levels", "medical", "model", "operate", "personnel", "point", "present", "primary", "providing", "public".... | EXACT TITLE in substance_use_recovery: "Emergency medical services".
0.500
advocacycommunityexperiencesformgroupinformationnetworkspeopleprovidingpublicrelevantsocialsupporttypeswork
SHARED TOKENS (15): "advocacy", "community", "experiences", "form", "group", "information", "networks", "people", "providing", "public", "relevant", "social", "support", "types", "work". | EXACT TITLE in childcare_family: "Support group".
0.500
carecontrolcreatesdistributionevenhealthhealthcareindividualsinformationmanagementmedicalorganizationspeopleremainsafesystemthemtreatingtreatmentunused
SHARED TOKENS (21): "care", "control", "creates", "distribution", "even", "health", "healthcare", "individuals", "information", "management", "medical", "organizations", "people", "remain", "safe", "system", "them", "treating", "treatment", "unused".... | EXACT TITLE in substance_use_recovery: "Drug disposal".
0.500
alignedaloneamongchiefcommunitycostseducationestablishesexecutivefundinggeneralgroupsinstitutionmajormissionmovementnationalneedsofficerofficial
SHARED TOKENS (34): "aligned", "alone", "among", "chief", "community", "costs", "education", "establishes", "executive", "funding", "general", "groups", "institution", "major", "mission", "movement", "national", "needs", "officer", "official".... | EXACT TITLE in childcare_family: "Salvation Army".
0.500
accessadministrationaroundcannotdependindividualindividualsindustryleastlevelsmentalpartlypeoplepreventprovidingreducerisksafesmallsupporting
SHARED TOKENS (22): "access", "administration", "around", "cannot", "depend", "individual", "individuals", "industry", "least", "levels", "mental", "partly", "people", "prevent", "providing", "reduce", "risk", "safe", "small", "supporting".... | EXACT TITLE in substance_use_recovery: "Opioid overdose".
0.480
businessformincreaseinitiativeslong-termmaterialpracticespresentprivateprovidingprovisionpublicqualityrather
SHARED TOKENS (14): "business", "form", "increase", "initiatives", "long-term", "material", "practices", "present", "private", "providing", "provision", "public", "quality", "rather". | EXACT TITLE in childcare_family: "Philanthropy".
0.480
Workforce ↗ Q13440398 EXACT TITLE
alignedcannotchildrendefinedemploymentforceparticipationpeoplepopulationresultsstatedtextworkworkforce
SHARED TOKENS (14): "aligned", "cannot", "children", "defined", "employment", "force", "participation", "people", "population", "results", "stated", "text", "work", "workforce". | EXACT TITLE in substance_use_recovery: "Workforce". | EXACT TITLE in childcare_family: "Workforce".
0.480
adaboisedepartmentdistricteducationeducationalidahopublicratesschoolschoolsservessystemwestern
SHARED TOKENS (14): "ada", "boise", "department", "district", "education", "educational", "idaho", "public", "rates", "school", "schools", "serves", "system", "western". | EXACT TITLE in childcare_family: "Boise School District".
0.480
activitiesamongcompletecomprehensiveeducationemploymenthistoryindividualindividualsprocesspurposerecordsearchsecurity
SHARED TOKENS (14): "activities", "among", "complete", "comprehensive", "education", "employment", "history", "individual", "individuals", "process", "purpose", "record", "search", "security". | EXACT TITLE in childcare_family: "Background check".
0.460
anotheraprilcapitalfinancialformerinvestmentmakesmanagementmeaningprivatesignificantstructuredtechnology
SHARED TOKENS (13): "another", "april", "capital", "financial", "former", "investment", "makes", "management", "meaning", "private", "significant", "structured", "technology". | EXACT TITLE in childcare_family: "Golden Gate Capital".
0.460
Naltrexone ↗ Q409587 EXACT TITLE
amongapprovedfoundlistmedicalmodelpeoplereducingsafesidethemthoughtreatment
SHARED TOKENS (13): "among", "approved", "found", "list", "medical", "model", "people", "reducing", "safe", "side", "them", "though", "treatment". | EXACT TITLE in substance_use_recovery: "Naltrexone".
0.440
conditionscontrollingeducationenforcementheavilyknowledgepracticespreventpreventionreduceresponsethem
SHARED TOKENS (12): "conditions", "controlling", "education", "enforcement", "heavily", "knowledge", "practices", "prevent", "prevention", "reduce", "response", "them". | EXACT TITLE in childcare_family: "Fire prevention".
0.440
agechildrenearlyeducationfederallyimportantorganizationsprivateprogramroleschoolvoluntary
SHARED TOKENS (12): "age", "children", "early", "education", "federally", "important", "organizations", "private", "program", "role", "school", "voluntary". | EXACT TITLE in childcare_family: "Pre-kindergarten".
0.440
Preschool ↗ Q1076052 EXACT TITLE
agechildrenearlyeducationeducationalfundsoperatedprimarypublicschoolspaceyoung
SHARED TOKENS (12): "age", "children", "early", "education", "educational", "funds", "operated", "primary", "public", "school", "space", "young". | EXACT TITLE in childcare_family: "Preschool".
0.440
Prenatal care ↗ EXACT TITLE
availabilitycarechangesformhealthhealthcarehealthymedicalparentpreventreducingscreening
SHARED TOKENS (12): "availability", "care", "changes", "form", "health", "healthcare", "healthy", "medical", "parent", "prevent", "reducing", "screening". | EXACT TITLE in childcare_family: "Prenatal care".
0.440
blockbodyfederalgeneralgrantgrantsoversightprogramsregionalrevenuespecifiedtypes
SHARED TOKENS (12): "block", "body", "federal", "general", "grant", "grants", "oversight", "programs", "regional", "revenue", "specified", "types". | EXACT TITLE in substance_use_recovery: "Block grant". | EXACT TITLE in childcare_family: "Block grant".
0.420
communitydistinctformfreegrouppeopleprogramsrequirementsschoolwayswork
SHARED TOKENS (11): "community", "distinct", "form", "free", "group", "people", "programs", "requirements", "school", "ways", "work". | EXACT TITLE in substance_use_recovery: "Community service".
0.420
abusecontroldifferenteducationforminformationlegallylicensemeaningmedicalrequiring
SHARED TOKENS (11): "abuse", "control", "different", "education", "form", "information", "legally", "license", "meaning", "medical", "requiring". | EXACT TITLE in substance_use_recovery: "Prescription drug".
0.400
bodycapablelimitedlivinglong-termremovalspecificallysupportingtherapytypes
SHARED TOKENS (10): "body", "capable", "limited", "living", "long-term", "removal", "specifically", "supporting", "therapy", "types". | EXACT TITLE in substance_use_recovery: "Detoxification".
0.400
affordablehousinglong-termpeoplepopulationresidenceresidentssheltersupporttransition
SHARED TOKENS (10): "affordable", "housing", "long-term", "people", "population", "residence", "residents", "shelter", "support", "transition". | EXACT TITLE in substance_use_recovery: "Transitional housing".
0.380
businesscostsemployerskeepknowledgeorganizationretentiontrainingworkforce
SHARED TOKENS (9): "business", "costs", "employers", "keep", "knowledge", "organization", "retention", "training", "workforce". | EXACT TITLE in childcare_family: "Employee retention".
0.350
aroundbusinesscapitalcentralfoodgrouphealthmanagementmulti-locationprivate
SHARED TOKENS (10): "around", "business", "capital", "central", "food", "group", "health", "management", "multi-location", "private". | URL->B (1): https://www.roarkcapital.com/portfolio.
0.340
associatebuildingchiefcourtsdecisionsidahopresent
SHARED TOKENS (7): "associate", "building", "chief", "courts", "decisions", "idaho", "present". | EXACT TITLE in substance_use_recovery: "Idaho Supreme Court".
0.340
acquisitionbusinesscontextdefinedfinancialgrouptreatment
SHARED TOKENS (7): "acquisition", "business", "context", "defined", "financial", "group", "treatment". | EXACT TITLE in substance_use_recovery: "Consolidation (business)".
0.320
buildingsbuiltdevelopmentmaintainsproductsspecifically
SHARED TOKENS (6): "buildings", "built", "development", "maintains", "products", "specifically". | EXACT TITLE in childcare_family: "Historic preservation".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in substance_use_recovery: "Idaho Department of Health and Welfare". | EXACT TITLE in childcare_family: "Idaho Department of Health and Welfare".
0.320
applicableauthorizesdistrictpermituseszoning
SHARED TOKENS (6): "applicable", "authorizes", "district", "permit", "uses", "zoning". | EXACT TITLE in childcare_family: "Special-use permit".
0.320
Relapse ↗ Q2292472 EXACT TITLE
activityformindividualsmedicalmentalmultiple
SHARED TOKENS (6): "activity", "form", "individuals", "medical", "mental", "multiple". | EXACT TITLE in substance_use_recovery: "Relapse".
0.300
administeredamonganothercasecognitivedescribeexperiencefunctioningindividuallivelowermaintenanceongoingpeopleprogramsqualityratesretentionsocialtherapy
SHARED TOKENS (21): "administered", "among", "another", "case", "cognitive", "describe", "experience", "functioning", "individual", "live", "lower", "maintenance", "ongoing", "people", "programs", "quality", "rates", "retention", "social", "therapy"....
0.300
activearoundeligiblefaithfaith-basedfundinggrantsgrouplistlocallymissionorganizationorganizationssocialwhose
SHARED TOKENS (15): "active", "around", "eligible", "faith", "faith-based", "funding", "grants", "group", "list", "locally", "mission", "organization", "organizations", "social", "whose".
0.300
Legal guardian ↗ Q157509 KW CROSS HIGH
adultsageanotherauthoritycannotcarecorrespondingdecisionsfamilyfoundhousingimportantindividuallegalmakingmeaningmedicalprofessionalpublicrelevant
SHARED TOKENS (22): "adults", "age", "another", "authority", "cannot", "care", "corresponding", "decisions", "family", "found", "housing", "important", "individual", "legal", "making", "meaning", "medical", "professional", "public", "relevant"....
0.300
aroundassociatebegancannotcarecliniciansdirecteducationalhealthhealthcareleastmedicalmodelpracticepresentprincipalproviderprovidersqualifiedrequired
SHARED TOKENS (28): "around", "associate", "began", "cannot", "care", "clinicians", "direct", "educational", "health", "healthcare", "least", "medical", "model", "practice", "present", "principal", "provider", "providers", "qualified", "required"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectaffectsaroundbehavioralchangesclinicalcommunitycontextdifferentdisabilityearlyfunctioningfunctionshealthhospitalsincreaseindividualmajormakingmedical
SHARED TOKENS (37): "affect", "affects", "around", "behavioral", "changes", "clinical", "community", "context", "different", "disability", "early", "functioning", "functions", "health", "hospitals", "increase", "individual", "major", "making", "medical"....
0.300
activitiesanotherarticleauthoritycapacitychildclinicalconditionsdecisionsdisabilityfactsforceformfreehealthcareindividualinformationinstitutionalintendedintervention
SHARED TOKENS (47): "activities", "another", "article", "authority", "capacity", "child", "clinical", "conditions", "decisions", "disability", "facts", "force", "form", "free", "healthcare", "individual", "information", "institutional", "intended", "intervention"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actactivitiesaffordablecarecontrollingcontrolscostcostsearlyeconomicgrouphealthhealthcareimprovinginsuranceintendedintensivemaintenancemanagementmechanisms
SHARED TOKENS (34): "act", "activities", "affordable", "care", "controlling", "controls", "cost", "costs", "early", "economic", "group", "health", "healthcare", "improving", "insurance", "intended", "intensive", "maintenance", "management", "mechanisms"....
0.300
Group home ↗ Q442993 KW CROSS HIGH
activityadultadultsarticlecannotcarecasechildrenclientsearlyfacilitiesfacilityfamiliesfamilygrouphealthhomehomeshourshouse
SHARED TOKENS (37): "activity", "adult", "adults", "article", "cannot", "care", "case", "children", "clients", "early", "facilities", "facility", "families", "family", "group", "health", "home", "homes", "hours", "house"....
0.300
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingbuildingschiefchildrencodesdepartmentdivisionintendedofficerpracticespreventpreventionreduceresultssafetyschoolsstructures
SHARED TOKENS (17): "building", "buildings", "chief", "children", "codes", "department", "division", "intended", "officer", "practices", "prevent", "prevention", "reduce", "results", "safety", "schools", "structures".
0.300
Cocaine ↗ Q41576 KW CROSS HIGH
abuseadministrationaffectbegancentralcontrolcostdevelopmentexpandingexposuregroupshistoricallyleadleastlegallimitedlocalmarketmedicalproducing
SHARED TOKENS (29): "abuse", "administration", "affect", "began", "central", "control", "cost", "development", "expanding", "exposure", "groups", "historically", "lead", "least", "legal", "limited", "local", "market", "medical", "producing"....
0.300
accessactivebodycapacitycollaborationcommunitycreateeducationenforcementhealthhealthcareincreasinglyindexpediatricpreventpreventionproblemproductsprotectionquality
SHARED TOKENS (32): "access", "active", "body", "capacity", "collaboration", "community", "create", "education", "enforcement", "health", "healthcare", "increasingly", "index", "pediatric", "prevent", "prevention", "problem", "products", "protection", "quality"....
0.300
actcareemployersfacilityhealthincreaseinstitutionsinsurancemaintainingmanagementmedicalpeoplepracticeprovidersrecordsreducesecuritysystems
SHARED TOKENS (18): "act", "care", "employers", "facility", "health", "increase", "institutions", "insurance", "maintaining", "management", "medical", "people", "practice", "providers", "records", "reduce", "security", "systems".
0.300
behavioralconditionscounselingdependencyfinancialgeneralgroupslegalmedicalparticipationpeoplepresentprocessprocessesrehabilitationsocialtreatment
SHARED TOKENS (17): "behavioral", "conditions", "counseling", "dependency", "financial", "general", "groups", "legal", "medical", "participation", "people", "present", "process", "processes", "rehabilitation", "social", "treatment".
0.300
carechangeschildconditionsdefineddescribesdistinctearlyfacilityfunctionhealthhospitalhoursleastleavelong-termmedicalorganizationorganizationsoutcomes
SHARED TOKENS (29): "care", "changes", "child", "conditions", "defined", "describes", "distinct", "early", "facility", "function", "health", "hospital", "hours", "least", "leave", "long-term", "medical", "organization", "organizations", "outcomes"....
0.300
abuseactadministrationagainstagenciesagencyanotherassociationauthoritycommunitycompletecomprehensivecontrolcreatesdatadepartmentdeterminesdistributionenforcementfederal
SHARED TOKENS (59): "abuse", "act", "administration", "against", "agencies", "agency", "another", "association", "authority", "community", "complete", "comprehensive", "control", "creates", "data", "department", "determines", "distribution", "enforcement", "federal"....
0.300
administeredavailabilitydifferdifferentenforcementformfutureintendedinterventionlawoperationspreventprogramrehabilitationsystemsystems
SHARED TOKENS (16): "administered", "availability", "differ", "different", "enforcement", "form", "future", "intended", "intervention", "law", "operations", "prevent", "program", "rehabilitation", "system", "systems".
0.300
Heroin ↗ Q60168 KW CROSS HIGH
administrationamongaroundbehavioralclinicalcontextformfunctionhistoryhourslicenselong-termmentalpeoplepercentpointpossessschedulessidesingle
SHARED TOKENS (22): "administration", "among", "around", "behavioral", "clinical", "context", "form", "function", "history", "hours", "license", "long-term", "mental", "people", "percent", "point", "possess", "schedules", "side", "single"....
0.300
ageassociationbehavioralclinicianscognitivecurrentdailydifferentfamilygrouphealthhistoryhomeimportantindividuallivinglong-termmedicalmentalpeer
SHARED TOKENS (33): "age", "association", "behavioral", "clinicians", "cognitive", "current", "daily", "different", "family", "group", "health", "history", "home", "important", "individual", "living", "long-term", "medical", "mental", "peer"....
0.300
administeredagencyamongassociationbusinesscarecasecentralcommunitycostscoveredcoveringdefineddisabilityhealthindividualindividualsinsurancemedicalnational
SHARED TOKENS (32): "administered", "agency", "among", "association", "business", "care", "case", "central", "community", "costs", "covered", "covering", "defined", "disability", "health", "individual", "individuals", "insurance", "medical", "national"....
0.300
Adoption ↗ Q180472 KW CROSS HIGH
anothercarechildcomprehensivecontractsdesignedformalgovernedgoverninghistoricallyintendedlegalparentparentalparentingparentsprocessrequiresrightsspecified
SHARED TOKENS (23): "another", "care", "child", "comprehensive", "contracts", "designed", "formal", "governed", "governing", "historically", "intended", "legal", "parent", "parental", "parenting", "parents", "process", "requires", "rights", "specified"....
0.300
activitiesanotherapprovedaroundauthoritycareclinicalcoachingcontroldefineddirecteducationexaminedexperiencefinancialformalfoundgeneralhealthhealthcare
SHARED TOKENS (46): "activities", "another", "approved", "around", "authority", "care", "clinical", "coaching", "control", "defined", "direct", "education", "examined", "experience", "financial", "formal", "found", "general", "health", "healthcare"....
0.300
Epidemiology ↗ Q133805 KW CROSS HIGH
amonganalysisapplicationassessmentclinicalconditionsdatadecisionsdefineddescribedescriptiondesigndistinctiondistributionexaminedexposurefunctiongeneralhealthhealthcare
SHARED TOKENS (48): "among", "analysis", "application", "assessment", "clinical", "conditions", "data", "decisions", "defined", "describe", "description", "design", "distinction", "distribution", "examined", "exposure", "function", "general", "health", "healthcare"....
0.300
accessaffectschildchildrenconditionscreatescurriculumdatademonstratesdescribesdisabilitydocumentdocumentseducationeducationaleligibleexperiencefederalformfree
SHARED TOKENS (45): "access", "affects", "child", "children", "conditions", "creates", "curriculum", "data", "demonstrates", "describes", "disability", "document", "documents", "education", "educational", "eligible", "experience", "federal", "form", "free"....
0.300
acquisitionapplicationapplicationscarecontextdatadesigndevelopmenthealthhealthcarehospitalsimproveinformationinstitutionslibrarymanagementmedicalresearchstudysystems
SHARED TOKENS (21): "acquisition", "application", "applications", "care", "context", "data", "design", "development", "health", "healthcare", "hospitals", "improve", "information", "institutions", "library", "management", "medical", "research", "study", "systems"....
0.300
activitiesactivityadministrationadministrativeagenciesanotherbuiltchangescontrolcourtscreateddecisionsdivisioneconomiceducationenforcementexecutiveexpandedgoverningincrease
SHARED TOKENS (33): "activities", "activity", "administration", "administrative", "agencies", "another", "built", "changes", "control", "courts", "created", "decisions", "division", "economic", "education", "enforcement", "executive", "expanded", "governing", "increase"....
0.300
availabilityconsumergeneralinformationmultipleneedsoperatorprimaryprocessproductsproviderssegmentsinglesitetypes
SHARED TOKENS (15): "availability", "consumer", "general", "information", "multiple", "needs", "operator", "primary", "process", "products", "providers", "segment", "single", "site", "types".
0.300
accessadultsageanothercarechildrenconnectedcontrolcontrollingdefinesdefinitionearlyeducationalexperiencehealthhealthylaborlegallylevelslower
SHARED TOKENS (32): "access", "adults", "age", "another", "care", "children", "connected", "control", "controlling", "defines", "definition", "early", "educational", "experience", "health", "healthy", "labor", "legally", "levels", "lower"....
0.300
actadministrativecarecoveredemployersfamiliesfamilyfederalgrouphealthhealthcareindividualsinformationinsurancelawlimitedmedicalnationalprovidersprovisions
SHARED TOKENS (26): "act", "administrative", "care", "covered", "employers", "families", "family", "federal", "group", "health", "healthcare", "individuals", "information", "insurance", "law", "limited", "medical", "national", "providers", "provisions"....
0.300
Public health ↗ Q189603 KW CROSS HIGH
accessamonganalyzingbeganbehavioralcarecasechildcommunitiescommunitycomprehensivecontrolcrisesdesigneddevelopmentdifferentdisabilitydistributioneducationeven
SHARED TOKENS (55): "access", "among", "analyzing", "began", "behavioral", "care", "case", "child", "communities", "community", "comprehensive", "control", "crises", "designed", "development", "different", "disability", "distribution", "education", "even"....
0.300
activityadultsagainstamongcentralcontainingcontainsdistinctgrouphealthindustryleadlegallong-termmovementnewsorganizationpointrequirerisk
SHARED TOKENS (22): "activity", "adults", "against", "among", "central", "containing", "contains", "distinct", "group", "health", "industry", "lead", "legal", "long-term", "movement", "news", "organization", "point", "require", "risk"....
0.300
Morphine ↗ Q81225 KW CROSS HIGH
abuseadministeredadministrationaffectamongbegancentraldirectlyfamilyfoundfrequentlyhealthhoursincreaselaborlistlong-termmarketingmultipleorganization
SHARED TOKENS (26): "abuse", "administered", "administration", "affect", "among", "began", "central", "directly", "family", "found", "frequently", "health", "hours", "increase", "labor", "list", "long-term", "marketing", "multiple", "organization"....
0.300
activityadministrationadultsagealoneassociationchildrencombinedconditionscurrentearlyfunctiongeneralleastoutcomespurposeratherrequiressubjecttreatment
SHARED TOKENS (21): "activity", "administration", "adults", "age", "alone", "association", "children", "combined", "conditions", "current", "early", "function", "general", "least", "outcomes", "purpose", "rather", "requires", "subject", "treatment"....
0.300
abusebehavioralexpandedexperiencefinancialformframeworkidentifiedindividualleadmentalprocessprocessesratherrelatedrisksocialsolelysystem
SHARED TOKENS (19): "abuse", "behavioral", "expanded", "experience", "financial", "form", "framework", "identified", "individual", "lead", "mental", "process", "processes", "rather", "related", "risk", "social", "solely", "system".
0.300
abuseagenciescaredataenforcementestablishedfederallyhealthidentifyinglawlicensingmultiplepreventprogramprogramsprovidersreportreportingrequiredrequirements
SHARED TOKENS (26): "abuse", "agencies", "care", "data", "enforcement", "established", "federally", "health", "identifying", "law", "licensing", "multiple", "prevent", "program", "programs", "providers", "report", "reporting", "required", "requirements"....
0.300
analysiscareclinicalcurrentdatadecisionsdescribeexperienceexternalguidehealthhealthcareimprovingindividualinformationleastmakingmanagementpracticeprevention
SHARED TOKENS (23): "analysis", "care", "clinical", "current", "data", "decisions", "describe", "experience", "external", "guide", "health", "healthcare", "improving", "individual", "information", "least", "making", "management", "practice", "prevention"....
0.300
addressingadministeredcreateddepartmenteducationexecutivefederalfundinggeneralhealthhealthcarehhsmattersmedicalmissionprimaryprivateprovidingpublicseparate
SHARED TOKENS (22): "addressing", "administered", "created", "department", "education", "executive", "federal", "funding", "general", "health", "healthcare", "hhs", "matters", "medical", "mission", "primary", "private", "providing", "public", "separate"....
0.300
actcommunitiesconflictcrisisfederalhistorylawlegislationmedicalongoingpdfpreventpreventionsinglesupporttexttreatment
SHARED TOKENS (17): "act", "communities", "conflict", "crisis", "federal", "history", "law", "legislation", "medical", "ongoing", "pdf", "prevent", "prevention", "single", "support", "text", "treatment".
0.300
accessactivitiesadministrationagencyannouncedassociationcapacitycenterschangescontroldepartmentdesigneddisabilityeducationalfederalfoodhealthhealthyhhsimprove
SHARED TOKENS (40): "access", "activities", "administration", "agency", "announced", "association", "capacity", "centers", "changes", "control", "department", "designed", "disability", "educational", "federal", "food", "health", "healthy", "hhs", "improve"....
0.300
certificationcompleteexchangeformalfoundlaborlicenseoutsidepeopleplacementpracticeprofessionalregulatedstudysystemtraining
SHARED TOKENS (16): "certification", "complete", "exchange", "formal", "found", "labor", "license", "outside", "people", "placement", "practice", "professional", "regulated", "study", "system", "training".
0.300
abuseagechildchildrencognitivecommunitiesdevelopmentearlyeducationalfamiliesinterventionlimitedmissionresourcesrisksocialsupportsupportssystemthem
SHARED TOKENS (21): "abuse", "age", "child", "children", "cognitive", "communities", "development", "early", "educational", "families", "intervention", "limited", "mission", "resources", "risk", "social", "support", "supports", "system", "them"....
0.300
adultchildrencodedevelopmenthealthleadershiplocalmentorsnetworknonprofitoperatesorganizationprogramsprovidingregionalsafeservessupporttitleyouth
SHARED TOKENS (20): "adult", "children", "code", "development", "health", "leadership", "local", "mentors", "network", "nonprofit", "operates", "organization", "programs", "providing", "regional", "safe", "serves", "support", "title", "youth".
0.300
actadministeredageassistancechangedchildrendisabilityeducationfederalfreegeneralimportantindividualindividualsinformationlawleastlegislationnationalneeds
SHARED TOKENS (33): "act", "administered", "age", "assistance", "changed", "children", "disability", "education", "federal", "free", "general", "important", "individual", "individuals", "information", "law", "least", "legislation", "national", "needs"....
0.300
Psychotherapy ↗ Q183257 KW CROSS HIGH
adultschildrenclinicalconditionsdesigneddifferdifferentfamiliesfamilyfoundgeneralgroupshealthimproveincreaseindividualitselfleastlegallylicensed
SHARED TOKENS (42): "adults", "children", "clinical", "conditions", "designed", "differ", "different", "families", "family", "found", "general", "groups", "health", "improve", "increase", "individual", "itself", "least", "legally", "licensed"....
0.300
actaffordableageapplicantscannotcarechangesconditionscostscoverededucationeligibilityexpandedexpansionfederalforcefoundfundinghealthhealthcare
SHARED TOKENS (57): "act", "affordable", "age", "applicants", "cannot", "care", "changes", "conditions", "costs", "covered", "education", "eligibility", "expanded", "expansion", "federal", "force", "found", "funding", "health", "healthcare"....
0.300
Imprisonment ↗ Q841236 KW CROSS HIGH
againstauthoritycaseconditionsevenforceitselflawmovementofficerpeopleplacingpolicepositionprovisionspurposeratesrights
SHARED TOKENS (18): "against", "authority", "case", "conditions", "even", "force", "itself", "law", "movement", "officer", "people", "placing", "police", "position", "provisions", "purpose", "rates", "rights".
0.300
actadministeredcarecategorieschildcovereddepartmentdivisioneligibleemployersfamilyhourslaborlawleastleavemajormedicalprotectionsproviding
SHARED TOKENS (25): "act", "administered", "care", "categories", "child", "covered", "department", "division", "eligible", "employers", "family", "hours", "labor", "law", "least", "leave", "major", "medical", "protections", "providing"....
0.300
Play therapy ↗ Q1542331 KW CROSS HIGH
assessmentbodycarechildrencodescontextdevelopmentexperienceshealthindividualinstitutionsinterventionknowledgementalneedspeoplepracticeprocessprofessionalrelationship
SHARED TOKENS (28): "assessment", "body", "care", "children", "codes", "context", "development", "experiences", "health", "individual", "institutions", "intervention", "knowledge", "mental", "needs", "people", "practice", "process", "professional", "relationship"....
0.300
abuseadultadultsagechildchildrendisabilitylawlegallymentalpeoplepolicereportreportingrequiredrisksubject
SHARED TOKENS (17): "abuse", "adult", "adults", "age", "child", "children", "disability", "law", "legally", "mental", "people", "police", "report", "reporting", "required", "risk", "subject".
0.300
abuseactiveactivityamongavailabilitybeyondcentralchangesdistributionfreefunctionincreaseleadplacementpossessreduceregulatoryrelatedreportedstructure
SHARED TOKENS (22): "abuse", "active", "activity", "among", "availability", "beyond", "central", "changes", "distribution", "free", "function", "increase", "lead", "placement", "possess", "reduce", "regulatory", "related", "reported", "structure"....
0.300
Drug checking ↗ Q3519101 KW CROSS HIGH
healthidentifyinginformationlegallylocalnationalpeopleprogramspublicreduceresultsrolesafesinglesitessmallsupplythem
SHARED TOKENS (18): "health", "identifying", "information", "legally", "local", "national", "people", "programs", "public", "reduce", "results", "role", "safe", "single", "sites", "small", "supply", "them".
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
addressaddressesaffectagainstcarechildrencommunitycomprehensivecostdifferenteducationemploymentfamilyformhealthcarehomelessnesshospitalshousehouseholdhousing
SHARED TOKENS (51): "address", "addresses", "affect", "against", "care", "children", "community", "comprehensive", "cost", "different", "education", "employment", "family", "form", "healthcare", "homelessness", "hospitals", "house", "household", "housing"....
0.300
activitiesadultsaffordableapplicationcarechildrencostcounselingdecisionsdisabilityeducationevenhealthhealthcarehealthyhomeidentifyimportantincreaseindex
SHARED TOKENS (40): "activities", "adults", "affordable", "application", "care", "children", "cost", "counseling", "decisions", "disability", "education", "even", "health", "healthcare", "healthy", "home", "identify", "important", "increase", "index"....
0.300
acquisitionactactivityanotherbusinesscapitalcentralcombinedcontrolcorporatecreatedepartmentdescribeddirectfederalgovernedlawlegalmanagementmarket
SHARED TOKENS (37): "acquisition", "act", "activity", "another", "business", "capital", "central", "combined", "control", "corporate", "create", "department", "described", "direct", "federal", "governed", "law", "legal", "management", "market"....
0.300
builtcommunitiesconnectedcontroldatadigitalfeesgroupindividualinfluencemanagementmarketingmarketsnetworksnodesorganizationspeopleproductsrelatedremoval
SHARED TOKENS (27): "built", "communities", "connected", "control", "data", "digital", "fees", "group", "individual", "influence", "management", "marketing", "markets", "networks", "nodes", "organizations", "people", "products", "related", "removal"....
0.300
actaddressingamongcrisesdecisionsdepartmentdivisioneconomicexternalfinancialgroupgroupsidentifiedindividualleadershipleaveorganizationorganizationsparticularlyrequire
SHARED TOKENS (26): "act", "addressing", "among", "crises", "decisions", "department", "division", "economic", "external", "financial", "group", "groups", "identified", "individual", "leadership", "leave", "organization", "organizations", "particularly", "require"....
0.300
activitiesclientscommunitiescommunitydifferentgroupincreasinglylivinglong-termmentalpathrehabilitationreputationresidentialtherapytreatment
SHARED TOKENS (16): "activities", "clients", "communities", "community", "different", "group", "increasingly", "living", "long-term", "mental", "path", "rehabilitation", "reputation", "residential", "therapy", "treatment".
0.300
addressassociationbehavioralcannotcodecontrolhelpinglivemakingorganizationsprocessprogramprogramspublishedsupportingtwelve
SHARED TOKENS (16): "address", "association", "behavioral", "cannot", "code", "control", "helping", "live", "making", "organizations", "process", "program", "programs", "published", "supporting", "twelve".
0.300
abusebehavioralfederalhealthimproveindividualinstituteknowledgemissionnationalpublicresearchsocialstudysupplywhose
SHARED TOKENS (16): "abuse", "behavioral", "federal", "health", "improve", "individual", "institute", "knowledge", "mission", "national", "public", "research", "social", "study", "supply", "whose".
0.300
accessarrangementsassociationcoordinationcostsdefinitiondevelopmentdiffereconomicestatefinancialfrequentlyfundinggeneralindustryinfrastructureintendedinvestmentlevelslocal
SHARED TOKENS (47): "access", "arrangements", "association", "coordination", "costs", "definition", "development", "differ", "economic", "estate", "financial", "frequently", "funding", "general", "industry", "infrastructure", "intended", "investment", "levels", "local"....
0.300
First aid ↗ Q133981 KW CROSS HIGH
assistancecareconflictearlyexternalguidancehealthindividuallegislationmedicalmentalpeoplepreventprofessionalprovisionpublicregulationrelationshiprequireresponse
SHARED TOKENS (27): "assistance", "care", "conflict", "early", "external", "guidance", "health", "individual", "legislation", "medical", "mental", "people", "prevent", "professional", "provision", "public", "regulation", "relationship", "require", "response"....
0.300
Child abuse ↗ Q167191 KW CROSS HIGH
abuseactchildchildrencommunitiesdifferentfamilieshomeorganizationsparentreportingrequirementsresultsschoolstherefore
SHARED TOKENS (15): "abuse", "act", "child", "children", "communities", "different", "families", "home", "organizations", "parent", "reporting", "requirements", "results", "schools", "therefore".
0.300
affordabilityagainstamongauthorityavailabilitybegandistrictearlyeconomicexplicitlyhomelessnesshomeshousingincreaselocallowermajoroperatingoppositionowned
SHARED TOKENS (34): "affordability", "against", "among", "authority", "availability", "began", "district", "early", "economic", "explicitly", "homelessness", "homes", "housing", "increase", "local", "lower", "major", "operating", "opposition", "owned"....
0.300
Respite care ↗ Q7315937 KW CROSS HIGH
abuseadultadultsamongcarechildchildrencognitivedescribeddisabilityexperiencefamiliesfamilyfinancialhealthhealthcarehomelong-termmentalpercent
SHARED TOKENS (30): "abuse", "adult", "adults", "among", "care", "child", "children", "cognitive", "described", "disability", "experience", "families", "family", "financial", "health", "healthcare", "home", "long-term", "mental", "percent"....
0.300
abuseactactivitiesaddressingassistancecenterchildchildrencomprehensivedatadefinitionestablishestablishedfederalfinancialidentifiesinformationlawlegislationnational
SHARED TOKENS (29): "abuse", "act", "activities", "addressing", "assistance", "center", "child", "children", "comprehensive", "data", "definition", "establish", "established", "federal", "financial", "identifies", "information", "law", "legislation", "national"....
0.300
actapplicableaprilchildchildrencodedevelopmentdifferentenforcementexpandedfamiliesfamilyfederalfinancingforcefundinghousinglawlegislationmakes
SHARED TOKENS (29): "act", "applicable", "april", "child", "children", "code", "development", "different", "enforcement", "expanded", "families", "family", "federal", "financing", "force", "funding", "housing", "law", "legislation", "makes"....
0.300
administrationassessmentbehavioralcentralchangedclinicclinicalclinicianscognitivedevelopmentdifferenteducationalfamilyhealthheavilyidahoincreaseknowledgemedicalmental
SHARED TOKENS (33): "administration", "assessment", "behavioral", "central", "changed", "clinic", "clinical", "clinicians", "cognitive", "development", "different", "educational", "family", "health", "heavily", "idaho", "increase", "knowledge", "medical", "mental"....
0.300
administeredadministrativeaffordableagenciesagencyassistanceauthoritybuildingscentraldepartmentdevelopmentdifferentdirectlydistinctexchangefamiliesformhomehousingindividual
SHARED TOKENS (35): "administered", "administrative", "affordable", "agencies", "agency", "assistance", "authority", "buildings", "central", "department", "development", "different", "directly", "distinct", "exchange", "families", "form", "home", "housing", "individual"....
0.300
behavioralbuiltcognitivecommunityestablishedfreegroupsguidedmedicalmodelorganizationpeerpeopleprofessionalseekingsupporttherapytraining
SHARED TOKENS (18): "behavioral", "built", "cognitive", "community", "established", "free", "groups", "guided", "medical", "model", "organization", "peer", "people", "professional", "seeking", "support", "therapy", "training".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
approvedauthoritybeganbuildingbuildingscasecodecodescompliancecontroldepartmentsdesigndistrictestatefacilitygeneralhealthinsuranceintendedlaw
SHARED TOKENS (42): "approved", "authority", "began", "building", "buildings", "case", "code", "codes", "compliance", "control", "departments", "design", "district", "estate", "facility", "general", "health", "insurance", "intended", "law"....
0.300
actadministrationadministrativeagencycarecenterscertificationchildrenclinicaldepartmentfacilitiesfederalfinancinggovhealthhealthcarehhshomehomesinsurance
SHARED TOKENS (30): "act", "administration", "administrative", "agency", "care", "centers", "certification", "children", "clinical", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "hhs", "home", "homes", "insurance"....
0.300
accessaddressesaffectbegancarecostcostsfinancinghealthhealthcareindividualsinformationinstitutionsknowledgemedicalorganizationorganizationalpeoplepolicypopulations
SHARED TOKENS (34): "access", "addresses", "affect", "began", "care", "cost", "costs", "financing", "health", "healthcare", "individuals", "information", "institutions", "knowledge", "medical", "organization", "organizational", "people", "policy", "populations"....
0.300
acquisitionadultamongbuiltchangeschildchildrencognitivecontextdevelopmentdifferenteducationalexecutiveexpandedfunctionsidentityindividualinfluencemajorongoing
SHARED TOKENS (25): "acquisition", "adult", "among", "built", "changes", "child", "children", "cognitive", "context", "development", "different", "educational", "executive", "expanded", "functions", "identity", "individual", "influence", "major", "ongoing"....
0.300
Pediatrics ↗ Q123028 KW CROSS HIGH
adultsagecarecenterschildchildrengeneralhospitalsinsurancemedicalparentspediatricpeoplepracticerequiresresearchresourcesworkyoung
SHARED TOKENS (19): "adults", "age", "care", "centers", "child", "children", "general", "hospitals", "insurance", "medical", "parents", "pediatric", "people", "practice", "requires", "research", "resources", "work", "young".
0.300
Child neglect ↗ Q559562 KW CROSS HIGH
abuseactagecarechildchildrendecisionsdefiningdependsdifferentdirectdutieseducationalemploymentestablishedexaminedfederalformhealthhousing
SHARED TOKENS (39): "abuse", "act", "age", "care", "child", "children", "decisions", "defining", "depends", "different", "direct", "duties", "educational", "employment", "established", "examined", "federal", "form", "health", "housing"....
0.300
abuseadministrationannouncedavailabilitybuildingcostdepartmentdirectlydisabilityhealthhealthyhhsimprovingmentaloutsidequalityreducereportssocietytreatment
SHARED TOKENS (20): "abuse", "administration", "announced", "availability", "building", "cost", "department", "directly", "disability", "health", "healthy", "hhs", "improving", "mental", "outside", "quality", "reduce", "reports", "society", "treatment".
0.300
abuseactadministrationannouncedauthorizesavailabilitycommunitycomprehensiveeducationfederalfundinggrantshealthincreaseintendedlawmajormentalnetworksorganizations
SHARED TOKENS (26): "abuse", "act", "administration", "announced", "authorizes", "availability", "community", "comprehensive", "education", "federal", "funding", "grants", "health", "increase", "intended", "law", "major", "mental", "networks", "organizations"....
0.300
businesscaredefinesdepartmentfacilityhealthindividualinsurancelicensedmedicalorganizationpaymentsprofessionalproviderproviderstreatment
SHARED TOKENS (16): "business", "care", "defines", "department", "facility", "health", "individual", "insurance", "licensed", "medical", "organization", "payments", "professional", "provider", "providers", "treatment".
0.300
beyondcommunitydefinitiondemonstratingdependencydevelopmentdifferentevenexplicitlyhealthindividualslivingmeaningmentalmodelmodelsmovementpeopleprocessproviders
SHARED TOKENS (30): "beyond", "community", "definition", "demonstrating", "dependency", "development", "different", "even", "explicitly", "health", "individuals", "living", "meaning", "mental", "model", "models", "movement", "people", "process", "providers"....
0.300
abuseadultcasechangeschildchildrencontactcontinuityexperienceexperienceshelpinginformationlegalmaintainingmultiplenationalneedsorganizationprocessproviders
SHARED TOKENS (26): "abuse", "adult", "case", "changes", "child", "children", "contact", "continuity", "experience", "experiences", "helping", "information", "legal", "maintaining", "multiple", "national", "needs", "organization", "process", "providers"....
0.300
Private equity ↗ KW CROSS HIGH
activebusinesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancialfinancingfundsgeneralinvestmentinvestorlimitedlong-termmanagementoperationalownership
SHARED TOKENS (27): "active", "business", "capital", "category", "changes", "control", "described", "development", "expansion", "financial", "financing", "funds", "general", "investment", "investor", "limited", "long-term", "management", "operational", "ownership"....
0.300
controldemandexpandingfederalfoodfundinghealthknowledgelegalmedicalpeopleprivatepublicrelatedresearchsectortreatment
SHARED TOKENS (17): "control", "demand", "expanding", "federal", "food", "funding", "health", "knowledge", "legal", "medical", "people", "private", "public", "related", "research", "sector", "treatment".
0.300
actactivitiesadministrationadvocacyanalysisanotherassociatecapacitycareclientscognitivecontactcontrolcreatedefineddefinitioneducationfamilyhealthhome
SHARED TOKENS (45): "act", "activities", "administration", "advocacy", "analysis", "another", "associate", "capacity", "care", "clients", "cognitive", "contact", "control", "create", "defined", "definition", "education", "family", "health", "home"....
0.300
accessbehavioralcarecenterconditionsdailyfacilitiesfacilityhealthhealthcareintensiveleastlimitedmakesmentaloutpatientoutsidepeoplepopulationspractice
SHARED TOKENS (34): "access", "behavioral", "care", "center", "conditions", "daily", "facilities", "facility", "health", "healthcare", "intensive", "least", "limited", "makes", "mental", "outpatient", "outside", "people", "populations", "practice"....
0.300
actadministrationagencyauthoritybegancontrolcurrentdepartmentdirectlyfederalfoodformerhealthhhshouseholdmedicalprimaryproductspublicregulated
SHARED TOKENS (26): "act", "administration", "agency", "authority", "began", "control", "current", "department", "directly", "federal", "food", "former", "health", "hhs", "household", "medical", "primary", "products", "public", "regulated"....
0.300
Data sharing ↗ Q5227350 KW CROSS HIGH
absenceaccessagenciesalonecodecommunityconstitutedatadevelopmentestablishedfoundfundinggoverninghistoryidentifiedincreasinglyinformationinstitutionsmechanismmedia
SHARED TOKENS (38): "absence", "access", "agencies", "alone", "code", "community", "constitute", "data", "development", "established", "found", "funding", "governing", "history", "identified", "increasingly", "information", "institutions", "mechanism", "media"....
0.300
administeredadultaloneamonganotherchildconstitutedefinitiondifferenteducationindividualindividualsintendedlegallegallymedicalprofessionalprogramprogramspurpose
SHARED TOKENS (22): "administered", "adult", "alone", "among", "another", "child", "constitute", "definition", "different", "education", "individual", "individuals", "intended", "legal", "legally", "medical", "professional", "program", "programs", "purpose"....
0.300
Kinship care ↗ Q5595400 KW CROSS HIGH
adultscarechildchildrencommunitiescustodyexperiencefamiliesfamilyformalhomeincreaselegalparentsplacementreducerelatedrelationshipschoolssystem
SHARED TOKENS (20): "adults", "care", "child", "children", "communities", "custody", "experience", "families", "family", "formal", "home", "increase", "legal", "parents", "placement", "reduce", "related", "relationship", "schools", "system".
0.300
activeassistancecontrolcostdistinctexperiencefoundfreegoverninggrouphealthcareinstitutionskeepongoingorganizationsprimaryprogrampublicratesrequired
SHARED TOKENS (23): "active", "assistance", "control", "cost", "distinct", "experience", "found", "free", "governing", "group", "healthcare", "institutions", "keep", "ongoing", "organizations", "primary", "program", "public", "rates", "required"....
0.300
actadministeredagainstamongchildrencreatedcreatingdirectearlyestablishedfamiliesfederalhealthcareinsurancelaborlawmajormovementnationalolder
SHARED TOKENS (32): "act", "administered", "against", "among", "children", "created", "creating", "direct", "early", "established", "families", "federal", "healthcare", "insurance", "labor", "law", "major", "movement", "national", "older"....
0.300
Trinity Health ↗ KW CROSS HIGH
carecomprehensivecontinuingfacilitieshealthhealthcarehomehospitalhospitalsidaholivingnetworkoperatesoperatingoutpatientpeoplesouthsupportsystem
SHARED TOKENS (19): "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "living", "network", "operates", "operating", "outpatient", "people", "south", "support", "system".
0.300
activitiesactivityadultbuildingcarecenterchildrencommercialcommunitydifferentearlyeducationalexperiencefinalhelpingimprovingleadleadershiplibraryorganizations
SHARED TOKENS (40): "activities", "activity", "adult", "building", "care", "center", "children", "commercial", "community", "different", "early", "educational", "experience", "final", "helping", "improving", "lead", "leadership", "library", "organizations"....
0.300
activitieschangescommunitiescommunitydecisionsdefineddesignededucationexpandingexperiencesformgroupshealthhealthyimproveimprovingindividualindividualsinfluenceinformation
SHARED TOKENS (31): "activities", "changes", "communities", "community", "decisions", "defined", "designed", "education", "expanding", "experiences", "form", "groups", "health", "healthy", "improve", "improving", "individual", "individuals", "influence", "information"....
0.300
actapprovalapprovedbuildingcommercialcontextcostscreatesdefineddesigndevelopmentdifferdifferenteconomicestateexchangefinancialfinancinghousingimproving
SHARED TOKENS (38): "act", "approval", "approved", "building", "commercial", "context", "costs", "creates", "defined", "design", "development", "differ", "different", "economic", "estate", "exchange", "financial", "financing", "housing", "improving"....
0.300
authoritybuildingbuildingsbusinesscapitalcenterscommercialcontainingestatefunctionshousingintendedinvestmentleastlevelslocalmedicalmultipleofficereal
SHARED TOKENS (24): "authority", "building", "buildings", "business", "capital", "centers", "commercial", "containing", "estate", "functions", "housing", "intended", "investment", "least", "levels", "local", "medical", "multiple", "office", "real"....
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
absenceassessmentassociationcaseclassificationclinicalcommunityconditionsconductingcontrolemploymenthealthhistoryindividualindustryinfluenceinstitutemattersmedicalmental
SHARED TOKENS (34): "absence", "assessment", "association", "case", "classification", "clinical", "community", "conditions", "conducting", "control", "employment", "health", "history", "individual", "industry", "influence", "institute", "matters", "medical", "mental"....
🫐 BERRY37 edges
0.280
alonecategorydependencygrouphomelessnessindividualsitselfmakingmentalneedspeopleprimaryratessingle
SHARED TOKENS (14): "alone", "category", "dependency", "group", "homelessness", "individuals", "itself", "making", "mental", "needs", "people", "primary", "rates", "single".
0.280
conditionsfacilitieshomeshousehousinglivingpeopleprogramprogramsrehabilitationsafeservesocietystructured
SHARED TOKENS (14): "conditions", "facilities", "homes", "house", "housing", "living", "people", "program", "programs", "rehabilitation", "safe", "serve", "society", "structured".
0.280
capitalconsumerpartnersprivate
SHARED TOKENS (4): "capital", "consumer", "partners", "private". | EXACT TITLE in childcare_family: "Sycamore Partners".
0.280
administrationaffectconditionsdescribedifferentevenformgroupindividualslegalmedicalratherrolethem
SHARED TOKENS (14): "administration", "affect", "conditions", "describe", "different", "even", "form", "group", "individuals", "legal", "medical", "rather", "role", "them".
0.260
actcarechildchildrencommunitiescustodyfamiliesfederallawliveplacementremovalwelfare
SHARED TOKENS (13): "act", "care", "child", "children", "communities", "custody", "families", "federal", "law", "live", "placement", "removal", "welfare".
0.260
childchildrencoveringeducationgeneralimproveindividualparentparentingparentsprogramprogramstraining
SHARED TOKENS (13): "child", "children", "covering", "education", "general", "improve", "individual", "parent", "parenting", "parents", "program", "programs", "training".
0.260
crisisinterventionstabilize
SHARED TOKENS (3): "crisis", "intervention", "stabilize". | EXACT TITLE in substance_use_recovery: "Crisis intervention". | EXACT TITLE in childcare_family: "Crisis intervention".
0.240
boiseconsumercreateddatademandidahomajormarketownedproductssouthtechnology
SHARED TOKENS (12): "boise", "consumer", "created", "data", "demand", "idaho", "major", "market", "owned", "products", "south", "technology".
0.220
carecoordinationhealthmedicalneedspracticepreventionproviderregisteredtrainingtreatment
SHARED TOKENS (11): "care", "coordination", "health", "medical", "needs", "practice", "prevention", "provider", "registered", "training", "treatment".
0.220
Parole ↗ Q5357120 KW CROSS HIGH
behavioralcomplianceconditionsearlyformoutsidepeopleratherservingsupervisionsystem
SHARED TOKENS (11): "behavioral", "compliance", "conditions", "early", "form", "outside", "people", "rather", "serving", "supervision", "system".
0.220
activityawaybusinesscategoriescategorycodedirectoryfunctioninformationpagessearch
SHARED TOKENS (11): "activity", "away", "business", "categories", "category", "code", "directory", "function", "information", "pages", "search".
0.220
actchildcreatesemploymenthourslaborlawlegislationpeoplestandardswork
SHARED TOKENS (11): "act", "child", "creates", "employment", "hours", "labor", "law", "legislation", "people", "standards", "work".
0.210
rehabilitation
SHARED TOKENS (1): "rehabilitation". | EXACT TITLE in substance_use_recovery: "Rehabilitation". | EXACT TITLE in childcare_family: "Rehabilitation".
0.210
idaho
SHARED TOKENS (1): "idaho". | EXACT TITLE in childcare_family: "Frank R. Gooding".
0.200
describesitselfmajormodelnonprofitorganizationpeopleproblemsocietyuses
SHARED TOKENS (10): "describes", "itself", "major", "model", "nonprofit", "organization", "people", "problem", "society", "uses".
0.200
childchildrendevelopmentfamiliesinfluencementalpediatricpopulationpreventiontreatment
SHARED TOKENS (10): "child", "children", "development", "families", "influence", "mental", "pediatric", "population", "prevention", "treatment".
0.200
activitybehavioralchangescognitiveengagementexposureformongoingpreventrequiring
SHARED TOKENS (10): "activity", "behavioral", "changes", "cognitive", "engagement", "exposure", "form", "ongoing", "prevent", "requiring".
0.200
Oxycodone ↗ Q407535 KW CROSS HIGH
abuseamongformhealthhourslistorganizationproductssidetreatment
SHARED TOKENS (10): "abuse", "among", "form", "health", "hours", "list", "organization", "products", "side", "treatment".
0.180
improvingpointpolicepreventionreducingrightsstatedsystemsystems
SHARED TOKENS (9): "improving", "point", "police", "prevention", "reducing", "rights", "stated", "system", "systems".
0.180
Hydrocodone ↗ Q411441 KW CROSS HIGH
amongapprovedformitselfmedicalrequiresidesupplywork
SHARED TOKENS (9): "among", "approved", "form", "itself", "medical", "require", "side", "supply", "work".
0.180
Volunteering ↗ Q188844 KW CROSS HIGH
actcommunityeducationgroupindividuallaborresponsetrainingwork
SHARED TOKENS (9): "act", "community", "education", "group", "individual", "labor", "response", "training", "work".
0.180
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahopopulationschoolschools
SHARED TOKENS (9): "ada", "boise", "canyon", "district", "house", "idaho", "population", "school", "schools".
0.160
adaboisecanyoncountiesidahoregiontreasurevalley
SHARED TOKENS (8): "ada", "boise", "canyon", "counties", "idaho", "region", "treasure", "valley".
0.160
Single parent ↗ Q1204559 KW CROSS HIGH
alonechildchildrenfamilyhouseholdparentsinglesupport
SHARED TOKENS (8): "alone", "child", "children", "family", "household", "parent", "single", "support".
0.160
activitieseducationexperiencesgrouppracticesprogramsresidentialschool
SHARED TOKENS (8): "activities", "education", "experiences", "group", "practices", "programs", "residential", "school".
0.160
costexchangeprogramprovidingreducerisksocialunused
SHARED TOKENS (8): "cost", "exchange", "program", "providing", "reduce", "risk", "social", "unused".
0.160
Unemployment ↗ Q41171 KW CROSS HIGH
ageemploymentforcepeopleratherseekingspecifiedwork
SHARED TOKENS (8): "age", "employment", "force", "people", "rather", "seeking", "specified", "work".
0.140
decisionsexperienceformproductsprofessionalreviewsites
SHARED TOKENS (7): "decisions", "experience", "form", "products", "professional", "review", "sites".
0.140
caldwellcanyondistrictextendsidahonampaschool
SHARED TOKENS (7): "caldwell", "canyon", "district", "extends", "idaho", "nampa", "school".
0.120
adaboiseidahomunicipalpopulationseparate
SHARED TOKENS (6): "ada", "boise", "idaho", "municipal", "population", "separate".
0.120
carecomprehensivehospitalrequiresrequiringwhose
SHARED TOKENS (6): "care", "comprehensive", "hospital", "requires", "requiring", "whose".
0.120
Recidivism ↗ Q1420643 KW CROSS HIGH
abuseactformerfrequentlyindividualmodel
SHARED TOKENS (6): "abuse", "act", "former", "frequently", "individual", "model".
0.120
actapprovedfamilieslawpublicsafe
SHARED TOKENS (6): "act", "approved", "families", "law", "public", "safe".
0.120
Cannabis ↗ Q79817 KW CROSS HIGH
familyhistorylevelsprincipalproductssingle
SHARED TOKENS (6): "family", "history", "levels", "principal", "products", "single".
0.120
agebegandisabilityemploymentindividualpattern
SHARED TOKENS (6): "age", "began", "disability", "employment", "individual", "pattern".
0.100
agencycertificationeducationalprofessionalpublic
SHARED TOKENS (5): "agency", "certification", "educational", "professional", "public".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseeagleidahopopulation
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
◈ Frequently Asked Questions
Substance Use Recovery × Childcare Family — Treasure Valley
HAIKU · HIGH GATE
How does family therapy in Boise support parents in substance use recovery who need childcare stability?
Family therapy providers in the Treasure Valley address both parental recovery and child safety simultaneously, which childcare and family services require when assessing home environments. Case management through Idaho nonprofits coordinates these services so that parents completing substance use treatment can maintain consistent childcare arrangements without losing progress in recovery.
What role does child protection play when a Treasure Valley family is navigating substance use recovery?
Idaho's child protection system works with case managers to ensure children remain safe while parents access recovery services, preventing unnecessary removal when families engage in treatment. Social workers in Boise assess whether substance use recovery participation and family therapy demonstrate sufficient progress to support children remaining in the home or reunifying.
How do Medicaid and telehealth expand substance use recovery access for families with childcare needs in the Treasure Valley?
Medicaid coverage in Idaho enables families to access telehealth-delivered substance use treatment and family therapy without requiring transportation to Boise or surrounding areas during childcare hours. This removes barriers that prevent parents from pursuing recovery while maintaining their childcare responsibilities.
What happens when a family in the Treasure Valley experiences homelessness while seeking substance use recovery and childcare support?
Nonprofit organizations and social workers in Boise coordinate emergency housing, substance use recovery programs, and childcare family services through case management to address homelessness and recovery simultaneously. Idaho's juvenile court system may become involved to ensure child safety and family reunification planning while parents access treatment.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Substance Use Recovery × Childcare Family 22 QID bridges 246 edges 6,818 ext links 2026-07-17 23:23:58 UTC 86cf1832c43b9087
Substance Use Recovery corridor ↗ Childcare Family corridor ↗ Childcare Family × Substance Use Recovery ↗ boisestandard.org/standard ↗
Parent Corridors
Substance Use Recovery × All Other Verticals