—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Rivers Lakes ↔ relates to ↔ Mortgage Lending

16 Wikipedia bridge articles confirmed in both vertical ledgers. 279 deterministic cross-vertical edges. 6,709 external source links harvested. Every edge provenance-stamped. Every claim auditable.

16 QID Bridge Articles
279 Cross Edges
6,709 External Sources
307 Wikipedia Articles
18 🌲 Evergreen
188 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Rivers Lakes
× Mortgage Lending
QID Bridge Articles
16
confirmed Wikipedia overlap
Total Cross Edges
279
External Sources Harvested
6,709
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  17 shared tokens
QID Bridge Titles (16)
Boise State UniversityGroundwaterCollege of Western IdahoTreasure ValleyWater rightBoise RiverNampa, IdahoBoise metropolitan areaSnake River PlainLand-use planningIrrigation districts in the United StatesBoise, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanvalleyadacanyoncollegepublicagriculturallandwaternampatreasurewesternhomeeastwestcountieslocal
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:59:32 UTC
Content Hash
eaf61f5742e5b828
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
16 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (17): "activity", "among", "boise", "college", "degrees", "division", "education", "idaho", "independent", "institution", "mountain", "program", "programs", "public", "research", "university", "west". | URL->B (1): https://boisestate.edu/. | EXACT TITLE in rivers_lakes: "Boise State University". | EXACT TITLE in mortgage_lending: "Boise State University".
activityamongboisecollegedegreesdivisioneducationidahoindependentinstitutionmountainprogramprogramspublicresearchuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Groundwater
Q161598 EXACT TITLE 1.000
QID OVERLAP: Q161598 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (41): "agricultural", "agriculture", "become", "billion", "capacity", "central", "change", "commonly", "contains", "distribution", "environmental", "field", "form", "formation", "geothermal", "household", "industrial", "influence", "land", "loss".... | EXACT TITLE in rivers_lakes: "Groundwater".
agriculturalagriculturebecomebillioncapacitycentralchangecommonlycontainsdistributionenvironmentalfieldformformationgeothermalhouseholdindustrialinfluencelandlossmunicipaloperatingparticularlypercentpresentprimaryprocessprovidepublicseptic+11
d the water table. Groundwater is recharged from the surface; it may discharge from the surface naturally at springs and seeps, and can form oases or wetlands. Groundwater is also often withdrawn for agricultural, municipal, and industrial use by constructing and operating extraction wells. The study of the distribution and movement of groundwater is hydrogeology, also called groundwater hydrology. Typically, groundwater is thought of as water flowing through shallow aquifers, but, in the technical sense, it can also contain soil moisture, permafrost (frozen soil), immobile water in very low permeability bedrock, and deep geothermal or oil formation water. Groundwater is hypothesized to provide lubrication that can possibly influence the movement of faults. It is likely that much of Earth's subsurface contains some water, which may be mixed with other fluids in some instances. Groundwater is often cheaper, more convenient and less vulnerable to pollution than surface water. Therefore, it is commonly used for public drinking water supplies. For example, groundwater provides the largest source of usable water storage in the United States, and California annually withdraws the largest amount of groundwater of all the states. Underground reservoirs contain far more water than the capacity of all surface reservoirs and lakes in the US, including the Great Lakes. Many municipal water supplies are derived solely from groundwater. Over 2 billion people rely on it as their primary water source worldwide. Human use of groundwater causes environmental problems. For example, polluted groundwater is less visible and more difficult to clean up than pollution in rivers and lakes. Groundwater pollution most often results from improper disposal of wastes on land. Major sources include industrial and household chemicals and garbage landfills, excessive fertilizers and pesticides used in agriculture, industrial waste lagoons, tailings and process wastewater from mines, industrial fracking, oil field brine pits, leaking underground oil storage tanks and pipelines, sewage sludge and septic systems. Additionally, groundwater is susceptible to saltwater intrusion in coastal areas and can cause land subsidence when extracted unsustainably, leading to sinking cities (like Bangkok) and loss in elevation (such as the multiple meters lost in the Central Valley of California). These issues are made more complicated by sea level rise and other effects of climate change, particularly those on the water cycle.
Quantities Groundwater is the most accessed source of freshwater around the world, including as drinking water, irrigation, and manufacturing. Groundwater accounts for about half of the world's drinking water, 40% of its irrigation water, and a third of water for industrial purposes. Another estimate stated that globally groundwater accounts for about one third of all water withdrawals, and surface water for the other two thirds. Groundwater provides drinking water to at least 50% of the global population. About 2.5 billion people depend solely on groundwater resources to satisfy their basic daily water needs. A similar estimate was published in 2021 which stated that "groundwater is estimated to supply between a quarter and a third of the world's annual freshwater withdrawals to meet agricultural, industrial and domestic demands." Global freshwater withdrawal was probably around 600 km3 per year in 1900 and increased to 3,880 km3 per year in 2017. The rate of increase was especially high (around 3% per year) during the period 1950–1980, partly due to a higher population growth rate, and partly to rapidly increasing groundwater development, particularly for irrigation. The rate of increase is (as per 2022) approximately 1% per year, in tune with the current population growth rate. Global groundwater depletion has been calculated to be between 100 and 300 km3 per year. This depletion is mainly caused by "expansion of irrigated agriculture in drylands". The Asia-Pacific region is the largest groundwater abstractor in the world, containing seven out of the ten countries that extract most groundwater (Bangladesh, China, India, Indonesia, Iran, Pakistan and Turkey).
Municipal and industrial water supplies are provided through large wells. Multiple wells for one water supply source are termed "wellfields", which may withdraw water from confined or unconfined aquifers. Using groundwater from deep, confined aquifers provides more protection from surface water contamination. Some wells, termed "collector wells", are specifically designed to induce infiltration of surface (usually river) water. Aquifers that provide sustainable fresh groundwater to urban areas and for agricultural irrigation are typically close to the ground surface (within a couple of hundred metres) and have some recharge by fresh water. This recharge is typically from rivers or meteoric water (precipitation) that percolates into the aquifer through overlying unsaturated materials. In cases where the groundwater has unacceptable levels of salinity or specific ions, desalination is a common treatment,.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (21): "ada", "boise", "canyon", "college", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "students", "treasure", "valley", "western".... | EXACT TITLE in rivers_lakes: "College of Western Idaho". | EXACT TITLE in mortgage_lending: "College of Western Idaho".
adaboisecanyoncollegecountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicstudentstreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "treasure", "urbanized", "valley", "western". | EXACT TITLE in rivers_lakes: "Treasure Valley". | EXACT TITLE in mortgage_lending: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitanregionresourcestreasureurbanizedvalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
W
Q7973730 EXACT TITLE 0.880
QID OVERLAP: Q7973730 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (9): "different", "generally", "irrigation", "law", "legal", "physical", "source", "systems", "water". | EXACT TITLE in rivers_lakes: "Water right". | EXACT TITLE in mortgage_lending: "Water right".
differentgenerallyirrigationlawlegalphysicalsourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
History In ancient Rome, the law was that people could obtain temporary usufructuary rights for running water. These rights were independent of land ownership, and lasted as long as use continued. Under English common law, all tidal waters were held by the Crown and all freshwater streams were included with title to the lands, with full accompanying rights. However, under the riparian doctrine, landowners had the right to receive water undiminished by upstream landowners. Over time, rights evolved from being strictly land-based to also include use-based, allowing non-landowners to hold enforceable rights to receive clean water. A reasonable use rule evolved in some countries. Finland In Finland, waterbodies are generally privately owned, but Finland also applies the Roman law principle of aqua profluens (flowing water), according to which the freely flowing water in waterbodies cannot be owned or possessed. This means that the owners of waterbodies cannot prohibit diversion of water for agricultural, industrial, municipal, or domestic use according to the provisions of the Finnish Water Law. A separate act regulates provision of water.
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "urban", "western". | EXACT TITLE in rivers_lakes: "Boise River".
agriculturalapproximatelyboiseidahourbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (16): "according", "boise", "canyon", "college", "footprint", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegefootprinthomeidahomeaningmeridianmetropolitannampapopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Boise metropolitan area
Q4938481 QID OVERLAP 0.800
QID OVERLAP: Q4938481 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (22): "ada", "adds", "boise", "canyon", "combined", "commonly", "component", "counties", "currently", "estimate", "home", "idaho", "larger", "meridian", "metropolitan", "mountain", "nampa", "percent", "population", "section"....
adaaddsboisecanyoncombinedcommonlycomponentcountiescurrentlyestimatehomeidaholargermeridianmetropolitanmountainnampapercentpopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Snake River Plain
Q1396049 EXACT TITLE 0.800
QID OVERLAP: Q1396049 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (5): "agricultural", "east", "flat", "idaho", "land". | EXACT TITLE in rivers_lakes: "Snake River Plain".
agriculturaleastflatidaholand
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (42): "act", "applicable", "applied", "association", "assume", "authority", "behavior", "best", "central", "change", "changes", "conditions", "costs", "creating", "depend", "development", "districts", "end", "environmental", "exposure"....
actapplicableappliedassociationassumeauthoritybehaviorbestcentralchangechangesconditionscostscreatingdependdevelopmentdistrictsendenvironmentalexposurefacilitiesfunctionfuturelandland-usemanagemodernoutcomespatternsphysical+12
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
I
Q6073798 QID OVERLAP 0.780
QID OVERLAP: Q6073798 in rivers_lakes (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (14): "authority", "boundaries", "district", "districts", "entity", "geographic", "government", "irrigation", "large", "local", "obtain", "public", "subdivision", "water".
authorityboundariesdistrictdistrictsentitygeographicgovernmentirrigationlargelocalobtainpublicsubdivisionwater
division of the State government, with definite geographic boundaries, organized, and having taxing power to obtain and distribute water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn.
water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district
igation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district References External links Federal lands included in state irrigation districts "The Nevada Irrigation District Act"
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "counties", "east", "home", "idaho", "locally", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountieseasthomeidaholocallymetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in rivers_lakes (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "east", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "roads".
adaboisecapitaldistricteasthomeidahojurisdictionlocalmetropolitanpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in rivers_lakes (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
263 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP263 edges
🌲 EVERGREEN2 edges
0.650
adaboisebureaucompletedconstructioncontroldirectlyeastengineersfederalfloodgenerationidahoirrigationmountainoperatingoperationalprimaryprivatepurpose
SHARED TOKENS (22): "ada", "boise", "bureau", "completed", "construction", "control", "directly", "east", "engineers", "federal", "flood", "generation", "idaho", "irrigation", "mountain", "operating", "operational", "primary", "private", "purpose".... | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in rivers_lakes: "Lucky Peak Dam".
0.610
adaapproximatelyboisecanyoncapacitychannelidahoirrigationsystemtreasurevalleywaterwestern
SHARED TOKENS (13): "ada", "approximately", "boise", "canyon", "capacity", "channel", "idaho", "irrigation", "system", "treasure", "valley", "water", "western". | URL->A (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in rivers_lakes: "New York Canal".
🌿 BRANCH188 edges
0.500
applicationsbankbankingbecomecomplianceconsumerdevelopeddirectestatefinanceindividualinstitutionsjurisdictionlawsmarketsproductsrealregulatedregulationrole
SHARED TOKENS (20): "applications", "bank", "banking", "become", "compliance", "consumer", "developed", "direct", "estate", "finance", "individual", "institutions", "jurisdiction", "laws", "markets", "products", "real", "regulated", "regulation", "role". | EXACT TITLE in mortgage_lending: "Mortgage broker".
0.500
administrationannualapproximatelybillionbudgetingeducationfederalfieldsgovernmentindependentnationaloperationsplanningrequireresearchsourcesupports
SHARED TOKENS (17): "administration", "annual", "approximately", "billion", "budgeting", "education", "federal", "fields", "government", "independent", "national", "operations", "planning", "require", "research", "source", "supports". | EXACT TITLE in rivers_lakes: "National Science Foundation".
0.500
amongapproximatelyboisedivisionestablishedidaholateroperatesproductionprofessionalpublicresearchstatewidestudentsuniversity
SHARED TOKENS (15): "among", "approximately", "boise", "division", "established", "idaho", "later", "operates", "production", "professional", "public", "research", "statewide", "students", "university". | EXACT TITLE in rivers_lakes: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanothercommoncompletedconstructedconstructioncontainscontaminationcreatedateenvironmentalhistoricallymaterialmodernpointpotentialprovidereachrequireresources
SHARED TOKENS (30): "access", "another", "common", "completed", "constructed", "construction", "contains", "contamination", "create", "date", "environmental", "historically", "material", "modern", "point", "potential", "provide", "reach", "require", "resources".... | EXACT TITLE in rivers_lakes: "Well". | EXACT TITLE in mortgage_lending: "Well".
0.500
activitycommoncommonlydatadatedistributioninformationpracticeprimaryprocesspurposesreportingresearchspecializedstudytype
SHARED TOKENS (16): "activity", "common", "commonly", "data", "date", "distribution", "information", "practice", "primary", "process", "purposes", "reporting", "research", "specialized", "study", "type". | EXACT TITLE in rivers_lakes: "Wildlife observation".
0.500
alongsidecertainchannelscontainsformindustrialirrigationlandlargepresentproducereportssurroundingtreatmentuseswater
SHARED TOKENS (16): "alongside", "certain", "channels", "contains", "form", "industrial", "irrigation", "land", "large", "present", "produce", "reports", "surrounding", "treatment", "uses", "water". | EXACT TITLE in rivers_lakes: "Surface water".
0.500
baseboiseconstructedhomeidahomissionmountainnearoctoberoperationspersonnelplacepopulationprimaryprovidesupporttrainingwestern
SHARED TOKENS (18): "base", "boise", "constructed", "home", "idaho", "mission", "mountain", "near", "october", "operations", "personnel", "place", "population", "primary", "provide", "support", "training", "western". | EXACT TITLE in mortgage_lending: "Mountain Home Air Force Base".
0.500
activitiesassociatedbuildingconstructiondevelopmentdomesticendfacilitiesfinancingimproveindustrialindustryinfrastructurepercentplanningprocessproductswork
SHARED TOKENS (18): "activities", "associated", "building", "construction", "development", "domestic", "end", "facilities", "financing", "improve", "industrial", "industry", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in rivers_lakes: "Construction". | EXACT TITLE in mortgage_lending: "Construction".
0.500
agenciesassetsbankbankingbasebeyondbillioncommercialdecisionsdefinitionsemployeesfederalfocusgovernmentinstitutioninstitutionsinsurancelocallocallynational
SHARED TOKENS (25): "agencies", "assets", "bank", "banking", "base", "beyond", "billion", "commercial", "decisions", "definitions", "employees", "federal", "focus", "government", "institution", "institutions", "insurance", "local", "locally", "national".... | EXACT TITLE in mortgage_lending: "Community bank".
0.500
Culvert ↗ Q4168092 EXACT TITLE
channelchannelscommonlyitselflongermaterialperformancepracticeprocessrequirementsroadroadsstructuretypewater
SHARED TOKENS (15): "channel", "channels", "commonly", "itself", "longer", "material", "performance", "practice", "process", "requirements", "road", "roads", "structure", "type", "water". | EXACT TITLE in rivers_lakes: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedbestboisecapitalcontainsdistinctdividedeastgeographicidaholandmountainnationalofficialperiodspopulationproducts
SHARED TOKENS (30): "agricultural", "agriculture", "approximately", "associated", "best", "boise", "capital", "contains", "distinct", "divided", "east", "geographic", "idaho", "land", "mountain", "national", "official", "periods", "population", "products".... | EXACT TITLE in rivers_lakes: "Idaho". | EXACT TITLE in mortgage_lending: "Idaho".
0.500
actactionsactivityagainstamongannualauthoritybureaucollectioncomplianceconsumerdatadepartmentdirectenforcementexaminationfederalfieldsfinancinggeographic
SHARED TOKENS (47): "act", "actions", "activity", "against", "among", "annual", "authority", "bureau", "collection", "compliance", "consumer", "data", "department", "direct", "enforcement", "examination", "federal", "fields", "financing", "geographic".... | EXACT TITLE in mortgage_lending: "Home Mortgage Disclosure Act".
0.500
Accountant ↗ Q326653 EXACT TITLE
abilityassociationscertaindeterminefirmindustryinfluenceobligationsorganizationpractitionersprocessprofessionalprofessionalspublicqualityregisteredrequiresrolestatutorystudy
SHARED TOKENS (21): "ability", "associations", "certain", "determine", "firm", "industry", "influence", "obligations", "organization", "practitioners", "process", "professional", "professionals", "public", "quality", "registered", "requires", "role", "statutory", "study".... | EXACT TITLE in mortgage_lending: "Accountant".
0.500
activityanothercommonlyconnectedconstructedcontaminationdevelopeddistributionflowgoverninginteractionlawslocalmaintainedmeaningplacesqualitystudysuppliessystem
SHARED TOKENS (23): "activity", "another", "commonly", "connected", "constructed", "contamination", "developed", "distribution", "flow", "governing", "interaction", "laws", "local", "maintained", "meaning", "places", "quality", "study", "supplies", "system".... | EXACT TITLE in rivers_lakes: "Hydrogeology".
0.500
Wildfire ↗ Q169950 EXACT TITLE
changecommoncontaminationcreatecreatesdependdirectfactgrowthlandland-usemanagementmaterialmitigationmodernoccurringparticularlyperiodsphysicalpotential
SHARED TOKENS (29): "change", "common", "contamination", "create", "creates", "depend", "direct", "fact", "growth", "land", "land-use", "management", "material", "mitigation", "modern", "occurring", "particularly", "periods", "physical", "potential".... | EXACT TITLE in rivers_lakes: "Wildfire".
0.500
actactionsactualagainstapplicantsappliesassistanceauthoritybankcapacityconsumercontractcoursedefinesdevelopmentdifferentfederalfinancegovernmenthousing
SHARED TOKENS (38): "act", "actions", "actual", "against", "applicants", "applies", "assistance", "authority", "bank", "capacity", "consumer", "contract", "course", "defines", "development", "different", "federal", "finance", "government", "housing".... | EXACT TITLE in mortgage_lending: "Equal Credit Opportunity Act".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingcertaincombinecommondeterminedevelopeddevelopmentdifferentdiffersformgovernmentgrowthguidelinesindustriallandland-uselocalnatureparticular
SHARED TOKENS (32): "activities", "building", "certain", "combine", "common", "determine", "developed", "development", "different", "differs", "form", "government", "growth", "guidelines", "industrial", "land", "land-use", "local", "nature", "particular".... | EXACT TITLE in mortgage_lending: "Zoning".
0.500
centralchangesconcentrationconsequencecoredevelopmenteastenvironmentalexpansionformationgrowthmodeloutcomespatternspopulationprocesssouthsuburbanurban
SHARED TOKENS (19): "central", "changes", "concentration", "consequence", "core", "development", "east", "environmental", "expansion", "formation", "growth", "model", "outcomes", "patterns", "population", "process", "south", "suburban", "urban". | EXACT TITLE in mortgage_lending: "Suburbanization".
0.500
Phosphorus ↗ Q674 EXACT TITLE
agriculturealoneapplicationscommoncomponentconsequencecontainingdiscoveryexposureformgenerallygroupindustrialitselfmaintainedmakesmeaningmodernnatureproduction
SHARED TOKENS (23): "agriculture", "alone", "applications", "common", "component", "consequence", "containing", "discovery", "exposure", "form", "generally", "group", "industrial", "itself", "maintained", "makes", "meaning", "modern", "nature", "production".... | EXACT TITLE in rivers_lakes: "Phosphorus".
0.500
actappliedbecomebureaucurrentlydeliverydepartmentdevelopmentestablishedfederalgenerationgovernmentirrigationlawmanagementnationoperationpotentialproduceprogram
SHARED TOKENS (26): "act", "applied", "become", "bureau", "currently", "delivery", "department", "development", "established", "federal", "generation", "government", "irrigation", "law", "management", "nation", "operation", "potential", "produce", "program".... | EXACT TITLE in rivers_lakes: "Bureau of Reclamation".
0.500
Dam ↗ Q12323 EXACT TITLE
applicationavailabilitybuildingconstructiondevelopeddisciplinefacefloodflowfunctionsgoverninghazardhouseholdimproveincreaseindustrialirrigatedirrigationlandlarge
SHARED TOKENS (41): "application", "availability", "building", "construction", "developed", "discipline", "face", "flood", "flow", "functions", "governing", "hazard", "household", "improve", "increase", "industrial", "irrigated", "irrigation", "land", "large".... | EXACT TITLE in rivers_lakes: "Dam".
0.500
buildingconstructeddevelopmenteventsirrigationlandlandscapematerialsmunicipalpropertiesremainsroadssewersourcesystemsurbanwater
SHARED TOKENS (17): "building", "constructed", "development", "events", "irrigation", "land", "landscape", "materials", "municipal", "properties", "remains", "roads", "sewer", "source", "systems", "urban", "water". | EXACT TITLE in rivers_lakes: "Urban runoff".
0.500
backgroundbecomechangeconditionconditionscurrentdistinctestimatefunctionhistoricalidentifiedimproveincreasedlocallossnatureparticularplacepointprocess
SHARED TOKENS (27): "background", "become", "change", "condition", "conditions", "current", "distinct", "estimate", "function", "historical", "identified", "improve", "increased", "local", "loss", "nature", "particular", "place", "point", "process".... | EXACT TITLE in rivers_lakes: "Ecological restoration".
0.500
affectdeterminediffersestablishedestateframeworkinterestslandlawlegalprincipalprotectpublicrealrecordsystemsystemstitle
SHARED TOKENS (18): "affect", "determine", "differs", "established", "estate", "framework", "interests", "land", "law", "legal", "principal", "protect", "public", "real", "record", "system", "systems", "title". | EXACT TITLE in mortgage_lending: "Recording (real estate)".
0.500
assetsbankbankingbillioncertificatescommercialcommonlyconsumercorporateinstitutioninstitutionsnonprofitoperationsperiodpublicsmallsystems
SHARED TOKENS (17): "assets", "bank", "banking", "billion", "certificates", "commercial", "commonly", "consumer", "corporate", "institution", "institutions", "nonprofit", "operations", "period", "public", "small", "systems". | EXACT TITLE in mortgage_lending: "Credit union".
0.500
adaboisebureaucanyonchannelcompletedcountiesengineersidahoirrigationoperatedprimarytreasurevalleywaterwestern
SHARED TOKENS (16): "ada", "boise", "bureau", "canyon", "channel", "completed", "counties", "engineers", "idaho", "irrigation", "operated", "primary", "treasure", "valley", "water", "western". | EXACT TITLE in rivers_lakes: "Boise River Diversion Dam".
0.500
alteranotherbankingcommonconditionscontextcorporatedifferentfinancehomelongermakesmanagementnationobligationsparticularlyperiodprimaryraterates
SHARED TOKENS (24): "alter", "another", "banking", "common", "conditions", "context", "corporate", "different", "finance", "home", "longer", "makes", "management", "nation", "obligations", "particularly", "period", "primary", "rate", "rates".... | EXACT TITLE in mortgage_lending: "Refinancing".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
appliedassessmentsassociationbankcannotcommonlycostsdefaultfeefuturelawlegalmakingoperationparcelprincipalprocesspropertyrealresidential
SHARED TOKENS (24): "applied", "assessments", "association", "bank", "cannot", "commonly", "costs", "default", "fee", "future", "law", "legal", "making", "operation", "parcel", "principal", "process", "property", "real", "residential".... | EXACT TITLE in mortgage_lending: "Foreclosure".
0.500
approximatelybecomebillionchangecommonconditioncreatecreatescurrentdescribesdevelopeddevelopmenteducationenvironmentalfacegeographygrowthincreaseincreasedincreasing
SHARED TOKENS (50): "approximately", "become", "billion", "change", "common", "condition", "create", "creates", "current", "describes", "developed", "development", "education", "environmental", "face", "geography", "growth", "increase", "increased", "increasing".... | EXACT TITLE in rivers_lakes: "Urbanization". | EXACT TITLE in mortgage_lending: "Urbanization".
0.500
actchaptercodecostsestatelawnaturepracticepracticesproceduresprocessprotectproviderealrequiresthemtitle
SHARED TOKENS (17): "act", "chapter", "code", "costs", "estate", "law", "nature", "practice", "practices", "procedures", "process", "protect", "provide", "real", "requires", "them", "title". | EXACT TITLE in mortgage_lending: "Real Estate Settlement Procedures Act".
0.500
activitycanyoncentercontainscountiesedgeflatidaholandnampanationaloutsidesitesurroundingwaterwest
SHARED TOKENS (16): "activity", "canyon", "center", "contains", "counties", "edge", "flat", "idaho", "land", "nampa", "national", "outside", "site", "surrounding", "water", "west". | EXACT TITLE in rivers_lakes: "Deer Flat National Wildlife Refuge".
0.500
chaindocumentdocumentationdocumentshistoricallawmaintainedofficeownershippresentpropertyrecordsequencetitletransfers
SHARED TOKENS (15): "chain", "document", "documentation", "documents", "historical", "law", "maintained", "office", "ownership", "present", "property", "record", "sequence", "title", "transfers". | EXACT TITLE in mortgage_lending: "Chain of title".
0.500
agricultureboisebureaucountieseastengineersidahoirrigationnationaloperatedprimaryprovidepurposewaterwestern
SHARED TOKENS (15): "agriculture", "boise", "bureau", "counties", "east", "engineers", "idaho", "irrigation", "national", "operated", "primary", "provide", "purpose", "water", "western". | EXACT TITLE in rivers_lakes: "Arrowrock Dam".
0.500
Hydrology ↗ EXACT TITLE
datadistributionenvironmentalfieldsgeographymanagementphysicalplanningpolicyqualityrelatedresearchresourcesstudywater
SHARED TOKENS (15): "data", "distribution", "environmental", "fields", "geography", "management", "physical", "planning", "policy", "quality", "related", "research", "resources", "study", "water". | EXACT TITLE in rivers_lakes: "Hydrology".
0.500
againstanalysisbestbuildingchangechangescontroleventsexposurefloodincreaseincreasedindividualinfrastructurelandscapemanagemanagementmitigationpotentialpractice
SHARED TOKENS (32): "against", "analysis", "best", "building", "change", "changes", "control", "events", "exposure", "flood", "increase", "increased", "individual", "infrastructure", "landscape", "manage", "management", "mitigation", "potential", "practice".... | EXACT TITLE in rivers_lakes: "Flood management".
0.500
capacitycreatedefaultdetermineevenfinalguidelineslargermanagementparticularprocessprovidequalityriskrisksuses
SHARED TOKENS (16): "capacity", "create", "default", "determine", "even", "final", "guidelines", "larger", "management", "particular", "process", "provide", "quality", "risk", "risks", "uses". | EXACT TITLE in mortgage_lending: "Mortgage underwriting".
0.500
Easement ↗ Q448405 EXACT TITLE
accessamonganotherbestcommonconceptseasementsenteritselflandlawpersonprivatelypropertypublicpurposerealrightsroadsubstantially
SHARED TOKENS (21): "access", "among", "another", "best", "common", "concepts", "easements", "enter", "itself", "land", "law", "person", "privately", "property", "public", "purpose", "real", "rights", "road", "substantially".... | EXACT TITLE in rivers_lakes: "Easement". | EXACT TITLE in mortgage_lending: "Easement".
0.500
authorityestategoverninggovernmentimprovementsjurisdictionlandnationalparticularlypropertyraterealregionrequiressystemvaluewhose
SHARED TOKENS (17): "authority", "estate", "governing", "government", "improvements", "jurisdiction", "land", "national", "particularly", "property", "rate", "real", "region", "requires", "system", "value", "whose". | EXACT TITLE in mortgage_lending: "Property tax".
0.500
actualagainstcommercialcommonlycostscoveredestateevidencefeefinancedformgeneralgenerallyindependentinstitutionalinsuranceinterestslandlargelaw
SHARED TOKENS (41): "actual", "against", "commercial", "commonly", "costs", "covered", "estate", "evidence", "fee", "financed", "form", "general", "generally", "independent", "institutional", "insurance", "interests", "land", "large", "law".... | EXACT TITLE in mortgage_lending: "Title insurance".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondconceptsflowformationhomeindustriallandlayermaterialmaterialspresentpressurepurposesregionrelatedsourcestudyunderlyingwaterwells
SHARED TOKENS (20): "beyond", "concepts", "flow", "formation", "home", "industrial", "land", "layer", "material", "materials", "present", "pressure", "purposes", "region", "related", "source", "study", "underlying", "water", "wells". | EXACT TITLE in rivers_lakes: "Aquifer".
0.500
addressingappliesconstructioncontrolcreatedisciplineengineersenvironmentalevaluateimproveindustriallawlicensinglivinglocalmaintainmanagementmunicipalnatureplans
SHARED TOKENS (33): "addressing", "applies", "construction", "control", "create", "discipline", "engineers", "environmental", "evaluate", "improve", "industrial", "law", "licensing", "living", "local", "maintain", "management", "municipal", "nature", "plans".... | EXACT TITLE in rivers_lakes: "Environmental engineering".
0.500
activitiesaffectagriculturalanotherchangescommonconditionscontaminationcontrolformincreasedindustrialinfrastructureirrigationmanagementplanspointproductsrequiresresource
SHARED TOKENS (25): "activities", "affect", "agricultural", "another", "changes", "common", "conditions", "contamination", "control", "form", "increased", "industrial", "infrastructure", "irrigation", "management", "plans", "point", "products", "requires", "resource".... | EXACT TITLE in rivers_lakes: "Water pollution".
0.500
Fishing ↗ Q14373 EXACT TITLE
accordingactivitiesactivityappliedcommercialcommonlydirectemploymentidentifiedindustriallivinglong-termmodernproductionprovidestatisticswater
SHARED TOKENS (17): "according", "activities", "activity", "applied", "commercial", "commonly", "direct", "employment", "identified", "industrial", "living", "long-term", "modern", "production", "provide", "statistics", "water". | EXACT TITLE in rivers_lakes: "Fishing".
0.500
Nitrogen ↗ Q627 EXACT TITLE
actapplicationscommercialcommoncontainscontroldescribesformgroupindustrialindustrylargemakingpresentpressurereleasessystemsystemstechnologyuses
SHARED TOKENS (21): "act", "applications", "commercial", "common", "contains", "control", "describes", "form", "group", "industrial", "industry", "large", "making", "present", "pressure", "releases", "system", "systems", "technology", "uses".... | EXACT TITLE in rivers_lakes: "Nitrogen".
0.500
Swimming ↗ Q6388 EXACT TITLE
actionsactivitiesamongcurriculumexposurefacilitiesincreasedlocalmodernmovenationalperformancepersonplacepotentialpublicpurposesrequiresrisksspecialized
SHARED TOKENS (22): "actions", "activities", "among", "curriculum", "exposure", "facilities", "increased", "local", "modern", "move", "national", "performance", "person", "place", "potential", "public", "purposes", "requires", "risks", "specialized".... | EXACT TITLE in rivers_lakes: "Swimming".
0.500
alongsidebankbasecapitalcentraldefaultdeterminefederalfinancingfutureinvestmentperiodperiodspolicyprincipalraterates
SHARED TOKENS (17): "alongside", "bank", "base", "capital", "central", "default", "determine", "federal", "financing", "future", "investment", "period", "periods", "policy", "principal", "rate", "rates". | EXACT TITLE in mortgage_lending: "Interest rate".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitioncommercialdifferententityestatefarmgeneralgovernmenthousinglandlawlegalnaturenonprofitownershippersonprivatepropertypublicpurpose
SHARED TOKENS (24): "acquisition", "commercial", "different", "entity", "estate", "farm", "general", "government", "housing", "land", "law", "legal", "nature", "nonprofit", "ownership", "person", "private", "property", "public", "purpose".... | EXACT TITLE in rivers_lakes: "Real estate". | EXACT TITLE in mortgage_lending: "Real estate".
0.500
concentrationdevelopedendenvironmentalflowincreasedindustrialirrigationmaterialsprocessprocessesqualityrecentresourcesupplysystemstreatmentuseswater
SHARED TOKENS (19): "concentration", "developed", "end", "environmental", "flow", "increased", "industrial", "irrigation", "materials", "process", "processes", "quality", "recent", "resource", "supply", "systems", "treatment", "uses", "water". | EXACT TITLE in rivers_lakes: "Water treatment".
0.500
abilityactactionsactivityauthorizedbillionbureauconsumerdataenforcementestablishedexistencefederalgovernmentindependentindustryinstitutionsjurisdictionlawlimit
SHARED TOKENS (35): "ability", "act", "actions", "activity", "authorized", "billion", "bureau", "consumer", "data", "enforcement", "established", "existence", "federal", "government", "independent", "industry", "institutions", "jurisdiction", "law", "limit".... | EXACT TITLE in mortgage_lending: "Consumer Financial Protection Bureau".
0.500
createdocumentdocumentseventsfunctionsgeneralindividualinformationoperationsorganizationpersonprocessrealrecordrecordsreportreportssourcestatementsystems
SHARED TOKENS (20): "create", "document", "documents", "events", "functions", "general", "individual", "information", "operations", "organization", "person", "process", "real", "record", "records", "report", "reports", "source", "statement", "systems". | EXACT TITLE in mortgage_lending: "Bookkeeping".
0.500
Wetland ↗ Q170321 EXACT TITLE
accordingactamongbuildingchangecontroldifferentdistinctenvironmentalfloodformfunctionfunctionsinfrastructuremitigationplaceprocessprocessesprotectprotection
SHARED TOKENS (31): "according", "act", "among", "building", "change", "control", "different", "distinct", "environmental", "flood", "form", "function", "functions", "infrastructure", "mitigation", "place", "process", "processes", "protect", "protection".... | EXACT TITLE in rivers_lakes: "Wetland".
0.500
assetscertaincommoncontractdatediscoveryfeefinancefuturelaterlossmanagersmarketmarketsparticularphysicalpracticepressurepublicrate
SHARED TOKENS (26): "assets", "certain", "common", "contract", "date", "discovery", "fee", "finance", "future", "later", "loss", "managers", "market", "markets", "particular", "physical", "practice", "pressure", "public", "rate".... | EXACT TITLE in rivers_lakes: "Short (finance)". | EXACT TITLE in mortgage_lending: "Short (finance)".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciescanyoncentralchannelcommercialconstructedconstructioncontrolcovereddevelopedeastfloodflowsheavilyhistoryidahoirrigationlargenational
SHARED TOKENS (37): "activities", "agencies", "canyon", "central", "channel", "commercial", "constructed", "construction", "control", "covered", "developed", "east", "flood", "flows", "heavily", "history", "idaho", "irrigation", "large", "national".... | EXACT TITLE in rivers_lakes: "Snake River".
0.500
Freddie Mac ↗ Q935969 EXACT TITLE
actionassetsassociationbillioncommonlydepartmentdescribedfederalfinancegovernmenthomehousingincreasedinvestmentmakingmanagementmarketmarketsnationalorganization
SHARED TOKENS (26): "action", "assets", "association", "billion", "commonly", "department", "described", "federal", "finance", "government", "home", "housing", "increased", "investment", "making", "management", "market", "markets", "national", "organization".... | EXACT TITLE in mortgage_lending: "Freddie Mac".
0.500
Floodplain ↗ EXACT TITLE
agriculturalbasechannelcontroldevelopedfloodheavilyincreasinglandnearperiodsriskurbanvalleywater
SHARED TOKENS (15): "agricultural", "base", "channel", "control", "developed", "flood", "heavily", "increasing", "land", "near", "periods", "risk", "urban", "valley", "water". | EXACT TITLE in rivers_lakes: "Floodplain".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
bankbankingbuildingcapitalcommercialdemanddescribeddevelopeddirectlydomesticestateformhomeinstitutioninvestmentlawlegalmarketsmeaningownership
SHARED TOKENS (31): "bank", "banking", "building", "capital", "commercial", "demand", "described", "developed", "directly", "domestic", "estate", "form", "home", "institution", "investment", "law", "legal", "markets", "meaning", "ownership".... | EXACT TITLE in mortgage_lending: "Mortgage".
0.500
actualagainstcommoneventsfloodhomeinsurancelistedlosspolicypropertyprotectionrequirerisksspecialized
SHARED TOKENS (15): "actual", "against", "common", "events", "flood", "home", "insurance", "listed", "loss", "policy", "property", "protection", "require", "risks", "specialized". | EXACT TITLE in mortgage_lending: "Property insurance".
0.500
activitiesagenciesanotherbankbankingcapitalcertaincommercialconsumerdirectlydiscoveryenterentityfacefederalfeeframeworkgenerallyinstitutionslarge
SHARED TOKENS (38): "activities", "agencies", "another", "bank", "banking", "capital", "certain", "commercial", "consumer", "directly", "discovery", "enter", "entity", "face", "federal", "fee", "framework", "generally", "institutions", "large".... | EXACT TITLE in mortgage_lending: "Mortgage bank".
0.500
Bluegill ↗ Q1148148 EXACT TITLE
amonganotherchaincommonlyeastfaceinsidelargermovepopulationrolesidesmallstructureswater
SHARED TOKENS (15): "among", "another", "chain", "commonly", "east", "face", "inside", "larger", "move", "population", "role", "side", "small", "structures", "water". | EXACT TITLE in rivers_lakes: "Bluegill".
0.500
actaddressaddressingassistancechangescontaminationcontroldirectlyengineersenvironmentalfederalformgoverninglawlawsmaintainmodernnationphysicalprimary
SHARED TOKENS (28): "act", "address", "addressing", "assistance", "changes", "contamination", "control", "directly", "engineers", "environmental", "federal", "form", "governing", "law", "laws", "maintain", "modern", "nation", "physical", "primary".... | EXACT TITLE in rivers_lakes: "Clean Water Act".
0.500
actactionactivitiesaffectagriculturalanotherapplicationschangecommercialcurrentdemanddevelopmentfuturegrowthhouseholdimprovementsincreasedirrigationlocalloss
SHARED TOKENS (39): "act", "action", "activities", "affect", "agricultural", "another", "applications", "change", "commercial", "current", "demand", "development", "future", "growth", "household", "improvements", "increased", "irrigation", "local", "loss".... | EXACT TITLE in rivers_lakes: "Water conservation".
0.500
Levee ↗ Q105190 EXACT TITLE
againstalongsidebankcapacitychannelconstructedcoursecreatingformoccurringprotectsidetypevalleywater
SHARED TOKENS (15): "against", "alongside", "bank", "capacity", "channel", "constructed", "course", "creating", "form", "occurring", "protect", "side", "type", "valley", "water". | EXACT TITLE in rivers_lakes: "Levee".
0.500
actbillingcertainconnectedconnectionconsumerfederallawlimitsmakingplanspracticesprincipalproceduresratesregulatesregulationrequirementsrequiring
SHARED TOKENS (19): "act", "billing", "certain", "connected", "connection", "consumer", "federal", "law", "limits", "making", "plans", "practices", "principal", "procedures", "rates", "regulates", "regulation", "requirements", "requiring". | EXACT TITLE in mortgage_lending: "Truth in Lending Act".
0.500
actadministrationagainstassessmentsassistanceavailabilitybillionconstructioncontrolcostscoveredcreatingdevelopmentendenforcementfederalfloodgenerallygovernmenthazard
SHARED TOKENS (45): "act", "administration", "against", "assessments", "assistance", "availability", "billion", "construction", "control", "costs", "covered", "creating", "development", "end", "enforcement", "federal", "flood", "generally", "government", "hazard".... | EXACT TITLE in rivers_lakes: "National Flood Insurance Program".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeconditionscontextdifferentformationphysicalpropertiesprovideremoteresourcestabilitystudywater
SHARED TOKENS (15): "agriculture", "annual", "change", "conditions", "context", "different", "formation", "physical", "properties", "provide", "remote", "resource", "stability", "study", "water". | EXACT TITLE in rivers_lakes: "Snowpack".
0.500
activityaddschangescreatescreatingdevelopmentdifferentevenformformationhistoryidentifiedincreasinglargelong-termlongermaterialparticularperiodpotential
SHARED TOKENS (29): "activity", "adds", "changes", "creates", "creating", "development", "different", "even", "form", "formation", "history", "identified", "increasing", "large", "long-term", "longer", "material", "particular", "period", "potential".... | EXACT TITLE in rivers_lakes: "Sedimentary basin".
0.500
Pollution ↗ Q58734 EXACT TITLE
agenciesagriculturalagriculturealongsideapproximatelyboundariesconcentratedconstructioncontaminationcoredevelopmentenvironmentaleventsformformationgenerallyhistoricallyincreasinglaterlocal
SHARED TOKENS (39): "agencies", "agricultural", "agriculture", "alongside", "approximately", "boundaries", "concentrated", "construction", "contamination", "core", "development", "environmental", "events", "form", "formation", "generally", "historically", "increasing", "later", "local".... | EXACT TITLE in rivers_lakes: "Pollution".
0.500
associateddemandgenerallygovernmenthomehouseholdhousingincreasedindexlocalmarketsnationalownershipresponsesupply
SHARED TOKENS (15): "associated", "demand", "generally", "government", "home", "household", "housing", "increased", "index", "local", "markets", "national", "ownership", "response", "supply". | EXACT TITLE in mortgage_lending: "Affordable housing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliesapplyingcentralchangescollectioncommonconditionsconsolidationcontroldevelopeddirectlydiscussiondistributionenvironmentalfieldfieldsflow
SHARED TOKENS (49): "agricultural", "agriculture", "application", "applies", "applying", "central", "changes", "collection", "common", "conditions", "consolidation", "control", "developed", "directly", "discussion", "distribution", "environmental", "field", "fields", "flow".... | EXACT TITLE in rivers_lakes: "Irrigation". | EXACT TITLE in mortgage_lending: "Irrigation".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingcertainchannelchannelscontrolcreatecurrentfloodflowgenerallyincreaseirrigationmanagementmodernpressurerequiringresourcessourcesourcessupply
SHARED TOKENS (22): "building", "certain", "channel", "channels", "control", "create", "current", "flood", "flow", "generally", "increase", "irrigation", "management", "modern", "pressure", "requiring", "resources", "source", "sources", "supply".... | EXACT TITLE in rivers_lakes: "Canal".
0.500
agenciesconstructiondepartmentsdisciplinegovernmentinfrastructurelocallymunicipalnationalphysicalplaceprivateprofessionalpublicroadssystemsworks
SHARED TOKENS (17): "agencies", "construction", "departments", "discipline", "government", "infrastructure", "locally", "municipal", "national", "physical", "place", "private", "professional", "public", "roads", "systems", "works". | EXACT TITLE in rivers_lakes: "Civil engineering".
0.500
activitiesagriculturalagricultureannualapprovalcollectioncontextdefinitionsdevelopmentdividedevengenerallyirrigatedirrigationlandorganizationparticularlyperiodpermittedpresent
SHARED TOKENS (26): "activities", "agricultural", "agriculture", "annual", "approval", "collection", "context", "definitions", "development", "divided", "even", "generally", "irrigated", "irrigation", "land", "organization", "particularly", "period", "permitted", "present".... | EXACT TITLE in rivers_lakes: "Agricultural land".
0.500
actagricultureapproximatelyboisebureaucapacitycentercompletedconstructionflowshomeidahoincreasedirrigationlaborlawmaterialsmountainnationaloperated
SHARED TOKENS (29): "act", "agriculture", "approximately", "boise", "bureau", "capacity", "center", "completed", "construction", "flows", "home", "idaho", "increased", "irrigation", "labor", "law", "materials", "mountain", "national", "operated".... | EXACT TITLE in rivers_lakes: "Anderson Ranch Dam".
0.500
cannotcombinedconnectevenflowinfrastructureinsidelargemanagemunicipalparkspropertypublicrequireresidentialriskroadssewersmallsystems
SHARED TOKENS (22): "cannot", "combined", "connect", "even", "flow", "infrastructure", "inside", "large", "manage", "municipal", "parks", "property", "public", "require", "residential", "risk", "roads", "sewer", "small", "systems".... | EXACT TITLE in rivers_lakes: "Storm drain".
0.500
Credit risk ↗ Q162714 EXACT TITLE
againstanotherassessmentsassetsassociatedbankcollectionconsumercostsflowsgeneralgovernmentincreasedinsurancelossmarketobligationspolicyprincipalprotection
SHARED TOKENS (25): "against", "another", "assessments", "assets", "associated", "bank", "collection", "consumer", "costs", "flows", "general", "government", "increased", "insurance", "loss", "market", "obligations", "policy", "principal", "protection".... | EXACT TITLE in mortgage_lending: "Credit risk".
0.500
academicsaccessapprovedbureauconsumerdateestatefacegenerallyhomeindependentinsurancelegalmaintainmarketmoveparticularlypatternsproductsproperty
SHARED TOKENS (29): "academics", "access", "approved", "bureau", "consumer", "date", "estate", "face", "generally", "home", "independent", "insurance", "legal", "maintain", "market", "move", "particularly", "patterns", "products", "property".... | EXACT TITLE in mortgage_lending: "Reverse mortgage".
0.500
administrationboisebureaucanyoncapacitycompletedcreatesgenerationidahoinventoryirrigationlargernationaloperatedprojectreducedsidestructurewater
SHARED TOKENS (19): "administration", "boise", "bureau", "canyon", "capacity", "completed", "creates", "generation", "idaho", "inventory", "irrigation", "larger", "national", "operated", "project", "reduced", "side", "structure", "water". | EXACT TITLE in rivers_lakes: "Black Canyon Diversion Dam".
0.500
Reddit ↗ Q1136 EXACT TITLE
abilityaccordingacquiredadministratorsamongbillioncommonlycreatecurrentdatadiscussionindependentlinksmarketmedianewsoctoberoperatedparticularlyregistered
SHARED TOKENS (26): "ability", "according", "acquired", "administrators", "among", "billion", "commonly", "create", "current", "data", "discussion", "independent", "links", "market", "media", "news", "october", "operated", "particularly", "registered".... | EXACT TITLE in mortgage_lending: "Reddit".
0.500
agriculturecapitalcommercialcostsdependdifferentinstitutionalirrigationlargelargerpersonnelpolicypracticepressurepublicpurposesqualityregulationscaleseparate
SHARED TOKENS (28): "agriculture", "capital", "commercial", "costs", "depend", "different", "institutional", "irrigation", "large", "larger", "personnel", "policy", "practice", "pressure", "public", "purposes", "quality", "regulation", "scale", "separate".... | EXACT TITLE in rivers_lakes: "Water supply".
0.480
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmentexpansionfeegovernmentgrowthimprovementslocalpopulationprojectpublicreduce
SHARED TOKENS (14): "capital", "construction", "costs", "development", "expansion", "fee", "government", "growth", "improvements", "local", "population", "project", "public", "reduce". | EXACT TITLE in mortgage_lending: "Impact fee".
0.480
Veolia ↗ Q1632461 EXACT TITLE
activitiesbillionemployeesendenvironmentalgroupmanagedmanagementoperationspublicsignedsingleutilitywater
SHARED TOKENS (14): "activities", "billion", "employees", "end", "environmental", "group", "managed", "management", "operations", "public", "signed", "single", "utility", "water". | EXACT TITLE in rivers_lakes: "Veolia".
0.460
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommonlydomesticgeneratedindustrialmunicipalprocessessewerwater
SHARED TOKENS (13): "activities", "agricultural", "another", "applications", "commercial", "commonly", "domestic", "generated", "industrial", "municipal", "processes", "sewer", "water". | EXACT TITLE in rivers_lakes: "Wastewater".
0.460
againstcommoncomplianceconditioncontactdeterminesgenerallyphysicalqualitystandardssupplytreatmentwater
SHARED TOKENS (13): "against", "common", "compliance", "condition", "contact", "determines", "generally", "physical", "quality", "standards", "supply", "treatment", "water". | EXACT TITLE in rivers_lakes: "Water quality".
0.460
analysisanalystsbureaucorporatediscussionlabormanagementorganizationpersonpotentialriskrolestatistics
SHARED TOKENS (13): "analysis", "analysts", "bureau", "corporate", "discussion", "labor", "management", "organization", "person", "potential", "risk", "role", "statistics". | EXACT TITLE in mortgage_lending: "Credit analyst".
0.460
boisecanyoncoveringflowsformationformeridahoidentifiednearperiodssourcesystemwestern
SHARED TOKENS (13): "boise", "canyon", "covering", "flows", "formation", "former", "idaho", "identified", "near", "periods", "source", "system", "western". | EXACT TITLE in rivers_lakes: "Lake Idaho".
0.460
Fannie Mae ↗ Q621096 EXACT TITLE
assetsassociationassociationscommonlyestablishedfederalhomelocalmakingmarketnationalorganizationprocess
SHARED TOKENS (13): "assets", "association", "associations", "commonly", "established", "federal", "home", "local", "making", "market", "national", "organization", "process". | EXACT TITLE in mortgage_lending: "Fannie Mae".
0.450
approvedboisebuildingcommonlycompletedconstructionflowsidahonationalroadsitesouthsubstantialvalleywaterwestern
SHARED TOKENS (16): "approved", "boise", "building", "commonly", "completed", "construction", "flows", "idaho", "national", "road", "site", "south", "substantial", "valley", "water", "western". | URL->A (1): http://www.usbr.gov/pn/hydromet/boipaytea.html.
0.440
accessanotherbankestateevenlegalpersonpropertyrightstitleunderlyingwater
SHARED TOKENS (12): "access", "another", "bank", "estate", "even", "legal", "person", "property", "rights", "title", "underlying", "water". | EXACT TITLE in rivers_lakes: "Beneficial use".
0.440
actionactiveassociatedboundariescommonlylargeplacerapidreleaserepresentssinglevolume
SHARED TOKENS (12): "action", "active", "associated", "boundaries", "commonly", "large", "place", "rapid", "release", "represents", "single", "volume". | EXACT TITLE in rivers_lakes: "Fault (geology)". | EXACT TITLE in mortgage_lending: "Fault (geology)".
0.440
Suez ↗ Q134514 EXACT TITLE
backgroundcapitalcenterconnectfacilitiesformindustrialmetropolitanmodernnearsmalltogether
SHARED TOKENS (12): "background", "capital", "center", "connect", "facilities", "form", "industrial", "metropolitan", "modern", "near", "small", "together". | EXACT TITLE in rivers_lakes: "Suez".
0.440
billionchannelscommonlyflowflowsformfragmentedgenerallylargereachvalleywater
SHARED TOKENS (12): "billion", "channels", "commonly", "flow", "flows", "form", "fragmented", "generally", "large", "reach", "valley", "water". | EXACT TITLE in rivers_lakes: "Debris flow".
0.420
Escrow ↗ Q338451 EXACT TITLE
accountcompletedconditionsestablishedinsurancemeaningobligationspersonprimaryprincipalproperty
SHARED TOKENS (11): "account", "completed", "conditions", "established", "insurance", "meaning", "obligations", "person", "primary", "principal", "property". | EXACT TITLE in mortgage_lending: "Escrow".
0.420
Lien ↗ Q4469383 EXACT TITLE
applicationcertainformgenerallyinterestsmeaningperformancepersonpropertysecuritytype
SHARED TOKENS (11): "application", "certain", "form", "generally", "interests", "meaning", "performance", "person", "property", "security", "type". | EXACT TITLE in rivers_lakes: "Lien". | EXACT TITLE in mortgage_lending: "Lien".
0.420
agriculturecontactinfrastructurelargermaterialprimaryproductsstructuressupplysystemswater
SHARED TOKENS (11): "agriculture", "contact", "infrastructure", "larger", "material", "primary", "products", "structures", "supply", "systems", "water". | EXACT TITLE in rivers_lakes: "Volcanic ash".
0.400
activitybillionconditionsdirectlyenvironmentalformmaintainphysicalwaterwork
SHARED TOKENS (10): "activity", "billion", "conditions", "directly", "environmental", "form", "maintain", "physical", "water", "work". | EXACT TITLE in rivers_lakes: "Drinking water".
0.400
anotherchannelcourseestablishedflowformationinfluenceprocessrapidrate
SHARED TOKENS (10): "another", "channel", "course", "established", "flow", "formation", "influence", "process", "rapid", "rate". | EXACT TITLE in rivers_lakes: "Avulsion (river)".
0.400
codecommonlyfederalhomehousinglawmobileregulatedtypeunits
SHARED TOKENS (10): "code", "commonly", "federal", "home", "housing", "law", "mobile", "regulated", "type", "units". | EXACT TITLE in mortgage_lending: "Manufactured housing".
0.400
acquisitionanalysisassetslawperiodprincipalprocesspropertysystemvalue
SHARED TOKENS (10): "acquisition", "analysis", "assets", "law", "period", "principal", "process", "property", "system", "value". | EXACT TITLE in mortgage_lending: "Amortization".
0.380
amongbecomecentraldescribedlargeregionalreportsstudyurban
SHARED TOKENS (9): "among", "become", "central", "described", "large", "regional", "reports", "study", "urban". | EXACT TITLE in rivers_lakes: "Largemouth bass".
0.380
agriculturalcombinedirrigationlocalmanagementprocessesresourcerolewater
SHARED TOKENS (9): "agricultural", "combined", "irrigation", "local", "management", "processes", "resource", "role", "water". | EXACT TITLE in rivers_lakes: "Evapotranspiration".
0.380
bankdivisionfirmlossmitigationprocessreducerisksworks
SHARED TOKENS (9): "bank", "division", "firm", "loss", "mitigation", "process", "reduce", "risks", "works". | EXACT TITLE in mortgage_lending: "Loss mitigation".
0.380
departmentdevelopmentgovernedmetropolitanmunicipaloperatepublictechnologyutility
SHARED TOKENS (9): "department", "development", "governed", "metropolitan", "municipal", "operate", "public", "technology", "utility". | EXACT TITLE in rivers_lakes: "Seattle City Light".
0.360
Basalt ↗ Q43338 EXACT TITLE
commonfloodflowsnearprocessesrapidsystemtype
SHARED TOKENS (8): "common", "flood", "flows", "near", "processes", "rapid", "system", "type". | EXACT TITLE in rivers_lakes: "Basalt".
0.360
Parcel ↗ Q7136418 EXACT TITLE
bankdeliverygeographyindividuallandmodernparceltype
SHARED TOKENS (8): "bank", "delivery", "geography", "individual", "land", "modern", "parcel", "type". | EXACT TITLE in rivers_lakes: "Parcel". | EXACT TITLE in mortgage_lending: "Parcel".
0.360
actenvironmentalidentifieslawqualityregulatorystandardswater
SHARED TOKENS (8): "act", "environmental", "identifies", "law", "quality", "regulatory", "standards", "water". | EXACT TITLE in rivers_lakes: "Total maximum daily load".
0.360
Zillow ↗ Q8071921 EXACT TITLE
comcurrentestateformergrouprealreal-estatetechnology
SHARED TOKENS (8): "com", "current", "estate", "former", "group", "real", "real-estate", "technology". | EXACT TITLE in mortgage_lending: "Zillow".
0.360
Catfish ↗ Q59576 EXACT TITLE
behaviorcommercialgrouphistoricallylargerregionregionalsouth
SHARED TOKENS (8): "behavior", "commercial", "group", "historically", "larger", "region", "regional", "south". | EXACT TITLE in rivers_lakes: "Catfish".
0.360
againstdeterminefloodinsurancelosspropertiespropertyrisk
SHARED TOKENS (8): "against", "determine", "flood", "insurance", "loss", "properties", "property", "risk". | EXACT TITLE in rivers_lakes: "Flood insurance".
0.360
commonenvironmentalestimateprimaryprocessprocessesrateswater
SHARED TOKENS (8): "common", "environmental", "estimate", "primary", "process", "processes", "rates", "water". | EXACT TITLE in rivers_lakes: "Groundwater recharge".
0.340
Trust deed ↗ Q7848150 EXACT TITLE
commonestategenerallawlegalrealsystems
SHARED TOKENS (7): "common", "estate", "general", "law", "legal", "real", "systems". | EXACT TITLE in mortgage_lending: "Trust deed".
0.340
Seepage ↗ Q125392015 EXACT TITLE
accordingconditionsconsolidationincreasingprocesstypewater
SHARED TOKENS (7): "according", "conditions", "consolidation", "increasing", "process", "type", "water". | EXACT TITLE in rivers_lakes: "Seepage".
0.340
applicationsapprovalcommercialevaluateinstitutionslicensedrelated
SHARED TOKENS (7): "applications", "approval", "commercial", "evaluate", "institutions", "licensed", "related". | EXACT TITLE in mortgage_lending: "Loan officer".
0.320
Reservoir ↗ Q131681 EXACT TITLE
buildingcontrollingformgenerationretainingwater
SHARED TOKENS (6): "building", "controlling", "form", "generation", "retaining", "water". | EXACT TITLE in rivers_lakes: "Reservoir".
0.320
Snowmelt ↗ Q1754697 EXACT TITLE
annualconditionscontrolperiodrapidwater
SHARED TOKENS (6): "annual", "conditions", "control", "period", "rapid", "water". | EXACT TITLE in rivers_lakes: "Snowmelt".
0.320
Bull trout ↗ Q2429513 EXACT TITLE
acthistoricallylistedpopulationriskseparate
SHARED TOKENS (6): "act", "historically", "listed", "population", "risk", "separate". | EXACT TITLE in rivers_lakes: "Bull trout".
0.320
anotherconditionsdocumentlegalspecifiedsubject
SHARED TOKENS (6): "another", "conditions", "document", "legal", "specified", "subject". | EXACT TITLE in mortgage_lending: "Promissory note".
0.320
costsestatepointpropertyrealtitle
SHARED TOKENS (6): "costs", "estate", "point", "property", "real", "title". | EXACT TITLE in mortgage_lending: "Closing costs".
0.320
Bankruptcy ↗ Q152074 EXACT TITLE
cannotentitieslegalmeaningpersonprocess
SHARED TOKENS (6): "cannot", "entities", "legal", "meaning", "person", "process". | EXACT TITLE in mortgage_lending: "Bankruptcy".
0.300
administrationaffectaffectingaloneamongassociationbankbillionestateevenfederalgovernmenthistoryhomehousingincreasedincreasingindexinstitutionallarge
SHARED TOKENS (36): "administration", "affect", "affecting", "alone", "among", "association", "bank", "billion", "estate", "even", "federal", "government", "history", "home", "housing", "increased", "increasing", "index", "institutional", "large"....
0.300
abilityaccordingendgenerallypersonpresentrateratesrealremainsrisksingleunlessvaluevalues
SHARED TOKENS (15): "ability", "according", "end", "generally", "person", "present", "rate", "rates", "real", "remains", "risk", "single", "unless", "value", "values".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomebuildingcommercialcorecostscurrentlydescribeddevelopmentenvironmentalexpansionformgeographicgrowthhousingincreasedindustrialinfrastructurelandlarge
SHARED TOKENS (37): "associated", "become", "building", "commercial", "core", "costs", "currently", "described", "development", "environmental", "expansion", "form", "geographic", "growth", "housing", "increased", "industrial", "infrastructure", "land", "large"....
0.300
assetscommercialentityestateinvestmentlawnatureperiodpropertyprotectprotectionprovisionsrateratherrealresidentialrisksecuritystructuresubject
SHARED TOKENS (22): "assets", "commercial", "entity", "estate", "investment", "law", "nature", "period", "property", "protect", "protection", "provisions", "rate", "rather", "real", "residential", "risk", "security", "structure", "subject"....
0.300
bridgecommonnearstructurewater
SHARED TOKENS (5): "bridge", "common", "near", "structure", "water". | EXACT TITLE in rivers_lakes: "Bridge scour".
0.300
accordingamongassociatedbankbankingbecomecommercialdifferentestateflowgeneralgenerallyindividualinvestmentlargelongermakingmarketobligationsperformance
SHARED TOKENS (34): "according", "among", "associated", "bank", "banking", "become", "commercial", "different", "estate", "flow", "general", "generally", "individual", "investment", "large", "longer", "making", "market", "obligations", "performance"....
0.300
accordingamongbasechangechangescommondirectdistinctfederalgenerallygovernmentindexlegallylinkmarketmarketsobtainoutsideplacesrate
SHARED TOKENS (30): "according", "among", "base", "change", "changes", "common", "direct", "distinct", "federal", "generally", "government", "index", "legally", "link", "market", "markets", "obtain", "outside", "places", "rate"....
0.300
accessactadministrationagainstconstructioncurrentlydepartmentdevelopmentdifferentfacilitiesfederalfinancegovernmenthousinginsurancemarketnationalofficeorganizationprincipal
SHARED TOKENS (27): "access", "act", "administration", "against", "construction", "currently", "department", "development", "different", "facilities", "federal", "finance", "government", "housing", "insurance", "market", "national", "office", "organization", "principal"....
0.300
accessapplicationassetsassociatedcommonlycostsestateevaluationfeegeneralguidelineshomeperiodpermitpointprimaryprocessingpropertyratesreal
SHARED TOKENS (30): "access", "application", "assets", "associated", "commonly", "costs", "estate", "evaluation", "fee", "general", "guidelines", "home", "period", "permit", "point", "primary", "processing", "property", "rates", "real"....
0.300
activitiesagriculturalagriculturecostsdirectdistributioneastenvironmentalfieldsincreasingindustrialindustryirrigationmanagementmeaningmunicipalparticularlypossiblepracticeprocess
SHARED TOKENS (33): "activities", "agricultural", "agriculture", "costs", "direct", "distribution", "east", "environmental", "fields", "increasing", "industrial", "industry", "irrigation", "management", "meaning", "municipal", "particularly", "possible", "practice", "process"....
0.300
boiseidahomountainnationalpoint
SHARED TOKENS (5): "boise", "idaho", "mountain", "national", "point". | EXACT TITLE in rivers_lakes: "Boise Mountains".
0.300
actagenciesauthoritycodeconsequencedependdescribeddevelopmentdifferentfederalgrowthguidelineslawlistednationnationalpointprimaryprotectprovisions
SHARED TOKENS (26): "act", "agencies", "authority", "code", "consequence", "depend", "described", "development", "different", "federal", "growth", "guidelines", "law", "listed", "nation", "national", "point", "primary", "protect", "provisions"....
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmentemploymentexpansionfinancinggenerallygovernmentlawlocalmanagednationalobtainpermitpermits
SHARED TOKENS (26): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "employment", "expansion", "financing", "generally", "government", "law", "local", "managed", "national", "obtain", "permit", "permits"....
0.300
Federal Reserve ↗ Q53536 KW CROSS HIGH
accountactactionsactivityamongannualapprovedapproximatelybankbankingbillioncapitalcentralcommercialcontroldecisionsdepartmentemploymententityestablished
SHARED TOKENS (48): "account", "act", "actions", "activity", "among", "annual", "approved", "approximately", "bank", "banking", "billion", "capital", "central", "commercial", "control", "decisions", "department", "employment", "entity", "established"....
0.300
activitiesadministrationbankcommercialdepartmententitiesestatefederalfeefirmgenerallygovernmenthousinginsuranceprincipalprivateprocessraterealreporting
SHARED TOKENS (25): "activities", "administration", "bank", "commercial", "department", "entities", "estate", "federal", "fee", "firm", "generally", "government", "housing", "insurance", "principal", "private", "process", "rate", "real", "reporting"....
0.300
actactionsassessmentsassetsbankbankingbillioncapitalcentralcombinedcommercialconsumercreatedemanddepartmentdevelopmentestatefederalfinancinggovernment
SHARED TOKENS (57): "act", "actions", "assessments", "assets", "bank", "banking", "billion", "capital", "central", "combined", "commercial", "consumer", "create", "demand", "department", "development", "estate", "federal", "financing", "government"....
0.300
actadministrationagainstagenciesassetsauthoritybillionbureaucertainchangescollectioncommonlycomplianceconsumercostsdataendestablishedfederalgrowth
SHARED TOKENS (41): "act", "administration", "against", "agencies", "assets", "authority", "billion", "bureau", "certain", "changes", "collection", "commonly", "compliance", "consumer", "costs", "data", "end", "established", "federal", "growth"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
actionsagriculturecontrolsdevelopmentenvironmentalgeneralgrowthincreasedindustrialpointpreventionprocessprogramreducesourcesourcessubstantialwater
SHARED TOKENS (18): "actions", "agriculture", "controls", "development", "environmental", "general", "growth", "increased", "industrial", "point", "prevention", "process", "program", "reduce", "source", "sources", "substantial", "water".
0.300
abilityavailabilitybankcentraldescribedestatefuturehousinglocallossmarketmarketsnationalnearpolicypropertypublicrapidrealregional
SHARED TOKENS (22): "ability", "availability", "bank", "central", "described", "estate", "future", "housing", "local", "loss", "market", "markets", "national", "near", "policy", "property", "public", "rapid", "real", "regional"....
0.300
accessanotherapplicationapprovedassociatedcapitalchangescommonlydescribeddevelopmentdifferentdirectformgeographichomehouseholdimproveindividuallargelegal
SHARED TOKENS (29): "access", "another", "application", "approved", "associated", "capital", "changes", "commonly", "described", "development", "different", "direct", "form", "geographic", "home", "household", "improve", "individual", "large", "legal"....
0.300
againstcertainconditionconsumerdirectlyeducationgenerallyhomeimprovementsindustryinvestmentitselfmaintainperiodproductspropertyratesrequirerequirementsthem
SHARED TOKENS (22): "against", "certain", "condition", "consumer", "directly", "education", "generally", "home", "improvements", "industry", "investment", "itself", "maintain", "period", "products", "property", "rates", "require", "requirements", "them"....
0.300
approximatelycommonsystemtypevalley
SHARED TOKENS (5): "approximately", "common", "system", "type", "valley". | EXACT TITLE in rivers_lakes: "Smallmouth bass".
0.300
Climate change ↗ Q125928 KW CROSS HIGH
abilityactionactivitiesagriculturalbecomechangechangescommoncontrolendenvironmentalevenfloodfuturegeneratedincreaseincreasedincreasingindustriallarge
SHARED TOKENS (40): "ability", "action", "activities", "agricultural", "become", "change", "changes", "common", "control", "end", "environmental", "even", "flood", "future", "generated", "increase", "increased", "increasing", "industrial", "large"....
0.300
actagenciesbureaucollectionconsumerdataendfederalfilesinformationprivateprotectionregulatesreportingreports
SHARED TOKENS (15): "act", "agencies", "bureau", "collection", "consumer", "data", "end", "federal", "files", "information", "private", "protection", "regulates", "reporting", "reports".
0.300
applicationapprovalcertainchaptercodeconsolidationformgeneralgoverningindividualpersonplansprioritypropertyprotectionprovidepurposerecentrequirementssection
SHARED TOKENS (24): "application", "approval", "certain", "chapter", "code", "consolidation", "form", "general", "governing", "individual", "person", "plans", "priority", "property", "protection", "provide", "purpose", "recent", "requirements", "section"....
0.300
activityamongapproximatelyassociationboisebureaucanyoncapacitycentercompletedcontainscountiescreatesdirectlyeastedgefederalflatformationidaho
SHARED TOKENS (31): "activity", "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "completed", "contains", "counties", "creates", "directly", "east", "edge", "federal", "flat", "formation", "idaho"....
0.300
affectagenciescreatingdistributionenvironmentalfunctionslandmanagemanagementplanningplansprocessprogramsqualityresourcesrightsspecialistsstudysupplytype
SHARED TOKENS (21): "affect", "agencies", "creating", "distribution", "environmental", "functions", "land", "manage", "management", "planning", "plans", "process", "programs", "quality", "resources", "rights", "specialists", "study", "supply", "type"....
0.300
accountapplicationappliescertaindifferentfacegenerallyhomeindustrymarketmarketsnetworkplanningpolicyprocessprocessesregulatorresearchriskspecialized
SHARED TOKENS (21): "account", "application", "applies", "certain", "different", "face", "generally", "home", "industry", "market", "markets", "network", "planning", "policy", "process", "processes", "regulator", "research", "risk", "specialized"....
0.300
accessadministrationaffectsbuildingdepartmentdevelopmententitiesfederalfieldsgovernmenthousinginfrastructurelocalmanagementpersonnelplaceprimarypropertyprovidepurpose
SHARED TOKENS (27): "access", "administration", "affects", "building", "department", "development", "entities", "federal", "fields", "government", "housing", "infrastructure", "local", "management", "personnel", "place", "primary", "property", "provide", "purpose"....
0.300
accordingaccountactagainstbankbankingbillioncapitalcertaincommercialcommonconditionsconsumerfederalfinancingfunctionsgovernmentincreasedinstitutionsinsurance
SHARED TOKENS (34): "according", "account", "act", "against", "bank", "banking", "billion", "capital", "certain", "commercial", "common", "conditions", "consumer", "federal", "financing", "functions", "government", "increased", "institutions", "insurance"....
0.300
acquisitionactactivityanotherassetscapitalcentralcertaincombinecombinedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesentityfederal
SHARED TOKENS (43): "acquisition", "act", "activity", "another", "assets", "capital", "central", "certain", "combine", "combined", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "entity", "federal"....
0.300
actagainstamongauthoritybankbankingcommercialfederalfirmformgroupinstitutioninsuranceinvestmentlargelaterlawmarketpdfprohibitions
SHARED TOKENS (24): "act", "against", "among", "authority", "bank", "banking", "commercial", "federal", "firm", "form", "group", "institution", "insurance", "investment", "large", "later", "law", "market", "pdf", "prohibitions"....
0.300
anotherassetsbankbillioncollectioncommercialcommonlydifferentestatefacegenerallygovernmentgroupinvestmentmarketobligationsofficeperiodsprincipalpriority
SHARED TOKENS (37): "another", "assets", "bank", "billion", "collection", "commercial", "commonly", "different", "estate", "face", "generally", "government", "group", "investment", "market", "obligations", "office", "periods", "principal", "priority"....
0.300
approveddepartmenteducationemployeesenforcementengineersenvironmentalfederalgovernmentindependentinformationlawslegallocalmattersnationaloperationpowerspreventionprograms
SHARED TOKENS (28): "approved", "department", "education", "employees", "enforcement", "engineers", "environmental", "federal", "government", "independent", "information", "laws", "legal", "local", "matters", "national", "operation", "powers", "prevention", "programs"....
0.300
againstcommercialcommoncommonlycontractcurrentendestatefinallargelongermarketparticularperiodsprincipalpropertyprovisionsrateratesreal
SHARED TOKENS (25): "against", "commercial", "common", "commonly", "contract", "current", "end", "estate", "final", "large", "longer", "market", "particular", "periods", "principal", "property", "provisions", "rate", "rates", "real"....
0.300
affectinganalysisapplicationchangesdemandestatefieldfinancehousingindustrymarketspatternsrealrelatedresearchresidentialscopesupplyurban
SHARED TOKENS (19): "affecting", "analysis", "application", "changes", "demand", "estate", "field", "finance", "housing", "industry", "markets", "patterns", "real", "related", "research", "residential", "scope", "supply", "urban".
0.300
actionaffectagriculturalagriculturebankchangeconnectconstructioncontaminationcontrolemphasizesenvironmentalevenfieldsfloodflowinfluencelandland-uselandscape
SHARED TOKENS (43): "action", "affect", "agricultural", "agriculture", "bank", "change", "connect", "construction", "contamination", "control", "emphasizes", "environmental", "even", "fields", "flood", "flow", "influence", "land", "land-use", "landscape"....
0.300
administersassistancedevelopmentdistricthousingindependentlocalmitigationnationalneighborhoodnetworknonprofitorganizationpreserveprofessionalprogramresearchservingstabilitysuburban
SHARED TOKENS (24): "administers", "assistance", "development", "district", "housing", "independent", "local", "mitigation", "national", "neighborhood", "network", "nonprofit", "organization", "preserve", "professional", "program", "research", "serving", "stability", "suburban"....
0.300
Water cycle ↗ Q81041 KW CROSS HIGH
actionsactivitiesaffectaffectingagricultureanotheravailabilitychangechangesdifferenteventsflowformincreasedlandpatternsphysicalpresentprocessprocesses
SHARED TOKENS (29): "actions", "activities", "affect", "affecting", "agriculture", "another", "availability", "change", "changes", "different", "events", "flow", "form", "increased", "land", "patterns", "physical", "present", "process", "processes"....
0.300
departmentmanagednationalpublicsystem
SHARED TOKENS (5): "department", "managed", "national", "public", "system". | EXACT TITLE in rivers_lakes: "National Wildlife Refuge".
0.300
VA loan ↗ Q7906577 KW CROSS HIGH
applicationapprovedconstructioncurrentlydepartmentdirectlyfeefinancedfinancingguidelineshomeimprovementsinsurancelargerlawslimitpercentprivateprogramproperties
SHARED TOKENS (30): "application", "approved", "construction", "currently", "department", "directly", "fee", "financed", "financing", "guidelines", "home", "improvements", "insurance", "larger", "laws", "limit", "percent", "private", "program", "properties"....
0.300
analysiscommercialcostsdefinitionsdevelopeddevelopmentdifferentincreaseindustriallandpolicypresencepresentpreviouslypurposesredevelopmentrequirerequiresrisksite
SHARED TOKENS (22): "analysis", "commercial", "costs", "definitions", "developed", "development", "different", "increase", "industrial", "land", "policy", "presence", "present", "previously", "purposes", "redevelopment", "require", "requires", "risk", "site"....
0.300
bankchangechangeschannelconditionsdevelopmentdifferentdividedenvironmentalfloodimprovelandscapemanagementpartlyphysicalprocessesremainsrequirementsresponsescale
SHARED TOKENS (24): "bank", "change", "changes", "channel", "conditions", "development", "different", "divided", "environmental", "flood", "improve", "landscape", "management", "partly", "physical", "processes", "remains", "requirements", "response", "scale"....
0.300
acquisitionagainstavailabilitycenterconsumerformerinstitutionslargelawlegalnationalperiodsprincipalproceduresproducepropertypublicrecordrequirerights
SHARED TOKENS (25): "acquisition", "against", "availability", "center", "consumer", "former", "institutions", "large", "law", "legal", "national", "periods", "principal", "procedures", "produce", "property", "public", "record", "require", "rights"....
0.300
administrationassistancebillioncostsdepartmenteducationestablishedfacilitiesfederalfuturegovernmenthomeinsurancelong-termmissionnationalprogram
SHARED TOKENS (17): "administration", "assistance", "billion", "costs", "department", "education", "established", "facilities", "federal", "future", "government", "home", "insurance", "long-term", "mission", "national", "program".
0.300
abilityadministrationauthoritydepartmentdevelopmententitiesfederalfinancehomehousingindependentinsurancelegalmissionofficeplacepowersregulatesregulatorregulatory
SHARED TOKENS (25): "ability", "administration", "authority", "department", "development", "entities", "federal", "finance", "home", "housing", "independent", "insurance", "legal", "mission", "office", "place", "powers", "regulates", "regulator", "regulatory"....
0.300
affectingamongcapacitycombinedconstructedconstructioncreatingdemanddirectenvironmentalgeneratedgenerationincreasedlandlargelimitslossmakingpatternspopulation
SHARED TOKENS (32): "affecting", "among", "capacity", "combined", "constructed", "construction", "creating", "demand", "direct", "environmental", "generated", "generation", "increased", "land", "large", "limits", "loss", "making", "patterns", "population"....
0.300
actapplicableappliescodecommonlydevelopmentdifferentenforcementfederalfinancinghousinglawmakesnationalparticipateprivateprogramsprovisionsrightssection
SHARED TOKENS (23): "act", "applicable", "applies", "code", "commonly", "development", "different", "enforcement", "federal", "financing", "housing", "law", "makes", "national", "participate", "private", "programs", "provisions", "rights", "section"....
0.300
Credit score ↗ Q1787103 KW CROSS HIGH
analysisdatadepartmentsdetermineevaluatefilesfinancegovernmentindividualinformationinsurancelimitsmobilepersonpotentialratereportrisksources
SHARED TOKENS (19): "analysis", "data", "departments", "determine", "evaluate", "files", "finance", "government", "individual", "information", "insurance", "limits", "mobile", "person", "potential", "rate", "report", "risk", "sources".
0.300
buildingcertainconditionscontainingcreatesevengenerallyhazardmaterialspersonnelphysicalpropertypublicriskriskssubjectsystemthem
SHARED TOKENS (18): "building", "certain", "conditions", "containing", "creates", "even", "generally", "hazard", "materials", "personnel", "physical", "property", "public", "risk", "risks", "subject", "system", "them".
0.300
accountadministrationagenciesassetscentralcommercialdevelopmentexclusivelyfederalgovernmentindependentinstitutionsinsurancenationaloperatesoperatingoperationsprovide
SHARED TOKENS (18): "account", "administration", "agencies", "assets", "central", "commercial", "development", "exclusively", "federal", "government", "independent", "institutions", "insurance", "national", "operates", "operating", "operations", "provide".
0.300
Financial literacy ↗ KW CROSS HIGH
abilityagenciesauthoritybehaviorcannotcommonconceptscostsdecisionsdevelopmenteducationestablishedfinancefocusfuturegovernmentimproveindividualinformationknowledge
SHARED TOKENS (31): "ability", "agencies", "authority", "behavior", "cannot", "common", "concepts", "costs", "decisions", "development", "education", "established", "finance", "focus", "future", "government", "improve", "individual", "information", "knowledge"....
0.300
Home equity loan ↗ KW CROSS HIGH
actualagainstcannotcollegecombinedcreatesdeterminededucationendfinancehistoryhomeinstitutionlawlimitlongerpersonplacepossibleproperty
SHARED TOKENS (25): "actual", "against", "cannot", "college", "combined", "creates", "determined", "education", "end", "finance", "history", "home", "institution", "law", "limit", "longer", "person", "place", "possible", "property"....
0.300
accountapplicationapproximatelyavailabilitycentralizedcombinedconnectedconstructioncontainscostsdemanddevelopeddifferentengineersevenfieldfieldsindustriallandlarge
SHARED TOKENS (42): "account", "application", "approximately", "availability", "centralized", "combined", "connected", "construction", "contains", "costs", "demand", "developed", "different", "engineers", "even", "field", "fields", "industrial", "land", "large"....
0.300
actactionactionsagenciesassessmentsauthoritydecisionsenvironmentalestablishedevaluatefederalfinalgovernmentlawlawsmodelednationalpersonpolicypotential
SHARED TOKENS (28): "act", "action", "actions", "agencies", "assessments", "authority", "decisions", "environmental", "established", "evaluate", "federal", "final", "government", "law", "laws", "modeled", "national", "person", "policy", "potential"....
0.300
accessbestcannotcontrolcostsdifferententityfederalgovernmentinfrastructureinstitutionlargelocalmaintainsmarketmodernoperatesorganizationpointproduce
SHARED TOKENS (33): "access", "best", "cannot", "control", "costs", "different", "entity", "federal", "government", "infrastructure", "institution", "large", "local", "maintains", "market", "modern", "operates", "organization", "point", "produce"....
0.300
Bridge loan ↗ Q2079582 KW CROSS HIGH
applicationsbridgecommoncostsdocumentationfinancefinancinggenerallyindividuallargerparticipationperiodraterequirerisksouthtype
SHARED TOKENS (17): "applications", "bridge", "common", "costs", "documentation", "finance", "financing", "generally", "individual", "larger", "participation", "period", "rate", "require", "risk", "south", "type".
0.300
actactiveactivitiesagenciesapproximatelyauthorityauthorizedbillionbuildingcapacitycombinedconstructioncontroldepartmentdirectdirectlyeastengineersenvironmentalfacilities
SHARED TOKENS (61): "act", "active", "activities", "agencies", "approximately", "authority", "authorized", "billion", "building", "capacity", "combined", "construction", "control", "department", "direct", "directly", "east", "engineers", "environmental", "facilities"....
0.300
administrationagenciesagricultureassociationcostsdefaultdepartmentdevelopmentevenfederalfinancinggovernmenthomehousingnationalofficeprivatelypublicratesrisk
SHARED TOKENS (24): "administration", "agencies", "agriculture", "association", "costs", "default", "department", "development", "even", "federal", "financing", "government", "home", "housing", "national", "office", "privately", "public", "rates", "risk"....
0.300
actagenciesamonganotherapproximatelybankingbillionchangesdefaultdifferentdomesticestimateevenfinancedflowgovernmenthouseholdhousingincreaseinstitutions
SHARED TOKENS (32): "act", "agencies", "among", "another", "approximately", "banking", "billion", "changes", "default", "different", "domestic", "estimate", "even", "financed", "flow", "government", "household", "housing", "increase", "institutions"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anothercapitalcertainchainconditionscontrollingcorporatedirectentityexpansiongrowthindividualinvestmentlargelawslegallicenseslicensingmarketmodel
SHARED TOKENS (31): "another", "capital", "certain", "chain", "conditions", "controlling", "corporate", "direct", "entity", "expansion", "growth", "individual", "investment", "large", "laws", "legal", "licenses", "licensing", "market", "model"....
0.300
actionsaddressingaffectagriculturalagricultureapplyingcentralchangechangescomponentconcentratedcontaminationdevelopmentdirectenterenvironmentalfieldshousinginterestsland
SHARED TOKENS (39): "actions", "addressing", "affect", "agricultural", "agriculture", "applying", "central", "change", "changes", "component", "concentrated", "contamination", "development", "direct", "enter", "environmental", "fields", "housing", "interests", "land"....
0.300
H-1B visa ↗ Q974595 KW CROSS HIGH
administrationagricultureapplicantsapplicationapprovedbeyondcertainchangeconditionsconsumercurrentlydefinesdepartmentemploymentfeegrowthimplementationinstitutionknowledgeoccupation
SHARED TOKENS (33): "administration", "agriculture", "applicants", "application", "approved", "beyond", "certain", "change", "conditions", "consumer", "currently", "defines", "department", "employment", "fee", "growth", "implementation", "institution", "knowledge", "occupation"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activecapitalchangescontroldescribeddevelopmentexpansionfinancefinancingfirmgeneralinvestmentlong-termmanagementoperationalownershipprivateproductsprovidepublic
SHARED TOKENS (23): "active", "capital", "changes", "control", "described", "development", "expansion", "finance", "financing", "firm", "general", "investment", "long-term", "management", "operational", "ownership", "private", "products", "provide", "public"....
0.300
actassociatedbestdatedescribeddescriptiongrowthinformationmanagedmanagementphysicalpropertiespurposeregionalworks
SHARED TOKENS (15): "act", "associated", "best", "date", "described", "description", "growth", "information", "managed", "management", "physical", "properties", "purpose", "regional", "works".
0.300
abilityassociatedbankcommercialdatedefaultestatefuturehomeimprovelatermakingmarketparticularlyprocesspropertyrealremainresidentialsubstantial
SHARED TOKENS (21): "ability", "associated", "bank", "commercial", "date", "default", "estate", "future", "home", "improve", "later", "making", "market", "particularly", "process", "property", "real", "remain", "residential", "substantial"....
0.300
centercurrentdatadepartmentfederalgeographygovernmentlandscapemakesnearorganizationpublicregulatoryresearchresourcesspansstudywhosework
SHARED TOKENS (19): "center", "current", "data", "department", "federal", "geography", "government", "landscape", "makes", "near", "organization", "public", "regulatory", "research", "resources", "spans", "study", "whose", "work".
0.300
adaboiseeagleidahopopulation
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population". | EXACT TITLE in mortgage_lending: "Eagle, Idaho".
0.300
agriculturalchangecontaminationcreateendenvironmentalfarmfieldsformgrowthheavilyincreasedlimitmeaningpermitprimaryproductionqualityreduceseptic
SHARED TOKENS (25): "agricultural", "change", "contamination", "create", "end", "environmental", "farm", "fields", "form", "growth", "heavily", "increased", "limit", "meaning", "permit", "primary", "production", "quality", "reduce", "septic"....
0.300
actapprovalapprovalsapprovedassumebuildingcommercialconstructioncontextcostscreatesdeterminedevelopmentdifferentengineersenvironmentalestatefinancinggrowthhousing
SHARED TOKENS (44): "act", "approval", "approvals", "approved", "assume", "building", "commercial", "construction", "context", "costs", "creates", "determine", "development", "different", "engineers", "environmental", "estate", "financing", "growth", "housing"....
🫐 BERRY73 edges
0.280
bankformratewater
SHARED TOKENS (4): "bank", "form", "rate", "water". | EXACT TITLE in rivers_lakes: "Bank erosion".
0.280
changesdiffersemphasizesfocusinfluencelandscapemakingparticularpracticeproductspurposereducesmallwater
SHARED TOKENS (14): "changes", "differs", "emphasizes", "focus", "influence", "landscape", "making", "particular", "practice", "products", "purpose", "reduce", "small", "water".
0.280
agriculturaldoctrinehouseholdindustriallegalmerelyownershipperiodpersonpurposerightssourcesystemwater
SHARED TOKENS (14): "agricultural", "doctrine", "household", "industrial", "legal", "merely", "ownership", "period", "person", "purpose", "rights", "source", "system", "water".
0.280
bankdetaileddocumentationguidelinesinstitutionslargelimitnatureprivatepropertyreal-estaterequiresufficienttype
SHARED TOKENS (14): "bank", "detailed", "documentation", "guidelines", "institutions", "large", "limit", "nature", "private", "property", "real-estate", "require", "sufficient", "type".
0.280
adaboiseconstructionidaho
SHARED TOKENS (4): "ada", "boise", "construction", "idaho". | EXACT TITLE in rivers_lakes: "Lucky Peak Lake".
0.280
conditionestateformhomelandlivingmarketprocesspropertyrealreportreportsrolevalue
SHARED TOKENS (14): "condition", "estate", "form", "home", "land", "living", "market", "process", "property", "real", "report", "reports", "role", "value".
0.280
industriallayerplaceswater
SHARED TOKENS (4): "industrial", "layer", "places", "water". | EXACT TITLE in rivers_lakes: "Injection well".
0.280
administersdepartmentdepartmentsdevelopmentdirectlyfederalfinancinggovernmenthomehousinglawsprogramreportsurban
SHARED TOKENS (14): "administers", "department", "departments", "development", "directly", "federal", "financing", "government", "home", "housing", "laws", "program", "reports", "urban".
0.260
Algal bloom ↗ Q326139 KW CROSS HIGH
affectscommonlygrowthincreasepopulationprocessrapidrolesourcessupportssystemsystemswater
SHARED TOKENS (13): "affects", "commonly", "growth", "increase", "population", "process", "rapid", "role", "sources", "supports", "system", "systems", "water".
0.260
Boating ↗ Q2141830 EXACT TITLE
activitiesactivityitself
SHARED TOKENS (3): "activities", "activity", "itself". | EXACT TITLE in rivers_lakes: "Boating".
0.260
actagenciesbankbureaudepartmentestablishedfederalindependentinstitutionslicensednationalofficeregulatory
SHARED TOKENS (13): "act", "agencies", "bank", "bureau", "department", "established", "federal", "independent", "institutions", "licensed", "national", "office", "regulatory".
0.260
centralizedcommercialdistributionindustrialinfrastructurenetworkrequirementsresidentialsupplysystemtreatmentwaterwells
SHARED TOKENS (13): "centralized", "commercial", "distribution", "industrial", "infrastructure", "network", "requirements", "residential", "supply", "system", "treatment", "water", "wells".
0.260
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturalcombineddivisioneastflowsidaholargernationalnearsectionsouthvalleywest
SHARED TOKENS (13): "agricultural", "combined", "division", "east", "flows", "idaho", "larger", "national", "near", "section", "south", "valley", "west".
0.260
controldistinctfieldgoverninglawlawsownershippropertyqualityrelatedresourceresourceswater
SHARED TOKENS (13): "control", "distinct", "field", "governing", "law", "laws", "ownership", "property", "quality", "related", "resource", "resources", "water".
0.260
actamongchangeschaptercodeconsumerlawoctoberpdfpreventionprotectionprovisionssigned
SHARED TOKENS (13): "act", "among", "changes", "chapter", "code", "consumer", "law", "october", "pdf", "prevention", "protection", "provisions", "signed".
0.260
activitiescommercialcommonevenformgenerallylargeoccupationalpracticespurposesreleaseuseswater
SHARED TOKENS (13): "activities", "commercial", "common", "even", "form", "generally", "large", "occupational", "practices", "purposes", "release", "uses", "water".
0.260
basechangeschannelcoveredcreateflowformincreasedlandperiodspointsystemvolume
SHARED TOKENS (13): "base", "changes", "channel", "covered", "create", "flow", "form", "increased", "land", "periods", "point", "system", "volume".
0.260
Trailer park ↗ Q1426493 KW CROSS HIGH
constructioncoursehomehousinglivingmobilemodernparksplacestatementstructurestechnologytemporary
SHARED TOKENS (13): "construction", "course", "home", "housing", "living", "mobile", "modern", "parks", "place", "statement", "structures", "technology", "temporary".
0.260
Alluvium ↗ Q6185405 EXACT TITLE
againstdescribedwater
SHARED TOKENS (3): "against", "described", "water". | EXACT TITLE in rivers_lakes: "Alluvium".
0.260
amongassetsestatehousingincreaselargelargermakingmarketparticipateperiodrealreal-estate
SHARED TOKENS (13): "among", "assets", "estate", "housing", "increase", "large", "larger", "making", "market", "participate", "period", "real", "real-estate".
0.240
accordingagainstcertaindirectdistrictestategeographicidentifiedprojectpublicratherreal
SHARED TOKENS (12): "according", "against", "certain", "direct", "district", "estate", "geographic", "identified", "project", "public", "rather", "real".
0.240
agenciesincreasingindividuallargelargerlimitlimitsqualityratesresidentialthemvalue
SHARED TOKENS (12): "agencies", "increasing", "individual", "large", "larger", "limit", "limits", "quality", "rates", "residential", "them", "value".
0.240
actaddressauthorizedcapitalcommonlygovernmenthousingincreasinglargemarketpracticespressure
SHARED TOKENS (12): "act", "address", "authorized", "capital", "commonly", "government", "housing", "increasing", "large", "market", "practices", "pressure".
0.240
allocationdifferentestatehousinglandmarketpersonpurposesrealreal-estateresidentialsingle
SHARED TOKENS (12): "allocation", "different", "estate", "housing", "land", "market", "person", "purposes", "real", "real-estate", "residential", "single".
0.240
accessagainstbankextendsfinancemaintainmarketpracticequalityratesriskuniversity
SHARED TOKENS (12): "access", "against", "bank", "extends", "finance", "maintain", "market", "practice", "quality", "rates", "risk", "university".
0.240
constructiondateimproveitselflaborlinkmaterialsmeaningpropertyrealsecuritytitle
SHARED TOKENS (12): "construction", "date", "improve", "itself", "labor", "link", "materials", "meaning", "property", "real", "security", "title".
0.230
currentgovernmentidahooffice
SHARED TOKENS (4): "current", "government", "idaho", "office". | URL->B (1): https://sos.idaho.gov/.
0.220
flathomeobtainprincipalpropertyprovideresidentialsecurityseparatesmallsupport
SHARED TOKENS (11): "flat", "home", "obtain", "principal", "property", "provide", "residential", "security", "separate", "small", "support".
0.220
applicationsdetermineenvironmentalfieldsflowgeneralinfluenceknowledgemovesystemswater
SHARED TOKENS (11): "applications", "determine", "environmental", "fields", "flow", "general", "influence", "knowledge", "move", "systems", "water".
0.220
Mobile home ↗ Q1434998 KW CROSS HIGH
basedifferenthomelegalmobilemoveplacesitestructuretemporarywork
SHARED TOKENS (11): "base", "different", "home", "legal", "mobile", "move", "place", "site", "structure", "temporary", "work".
0.220
directlyirrigationmaintainednetworkoperatedplacepotentialsystemsystemstypewater
SHARED TOKENS (11): "directly", "irrigation", "maintained", "network", "operated", "place", "potential", "system", "systems", "type", "water".
0.220
Crappie ↗ Q1063438 EXACT TITLE
amongcommon
SHARED TOKENS (2): "among", "common". | EXACT TITLE in rivers_lakes: "Crappie".
0.220
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastidahometropolitanpopulationsharedstarwest
SHARED TOKENS (11): "ada", "boise", "canyon", "district", "east", "idaho", "metropolitan", "population", "shared", "star", "west".
0.220
beyondextends
SHARED TOKENS (2): "beyond", "extends". | EXACT TITLE in rivers_lakes: "Deadwood River".
0.220
capitalcommercialestatefinancingprivatepropertyratesrealresidentialrisktype
SHARED TOKENS (11): "capital", "commercial", "estate", "financing", "private", "property", "rates", "real", "residential", "risk", "type".
0.220
Rhyolite ↗ Q190727 KW CROSS HIGH
amongconstructioncontainingedgeflowsgenerallylargermakespresentshapedtype
SHARED TOKENS (11): "among", "construction", "containing", "edge", "flows", "generally", "larger", "makes", "present", "shaped", "type".
0.220
annualappliedconsumerdefinitionsfeefinanceformlegalprotectionraterather
SHARED TOKENS (11): "annual", "applied", "consumer", "definitions", "fee", "finance", "form", "legal", "protection", "rate", "rather".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in rivers_lakes: "Subdivision". | EXACT TITLE in mortgage_lending: "Subdivision".
0.200
amongcommondetermineslandlawownershippropertyrightssystemwater
SHARED TOKENS (10): "among", "common", "determines", "land", "law", "ownership", "property", "rights", "system", "water".
0.200
activeassociateddevelopmenteastendfieldidahomountainsouthwest
SHARED TOKENS (10): "active", "associated", "development", "east", "end", "field", "idaho", "mountain", "south", "west".
0.200
Appraisal ↗ Q4781689 EXACT TITLE
topics
EXACT TITLE in mortgage_lending: "Appraisal".
0.200
boisedepartmentenvironmentalfederalgovernmentidaholawsmaintainedqualityregional
SHARED TOKENS (10): "boise", "department", "environmental", "federal", "government", "idaho", "laws", "maintained", "quality", "regional".
0.200
boisebureaudepartmentgovernmentidahonationalpotentialprotectsecuritystaff
SHARED TOKENS (10): "boise", "bureau", "department", "government", "idaho", "national", "potential", "protect", "security", "staff".
0.200
Lake Cascade ↗ Q14687186 KW CROSS HIGH
boisebureauchangecommoncompletedfederalidahonationalvalleywestern
SHARED TOKENS (10): "boise", "bureau", "change", "common", "completed", "federal", "idaho", "national", "valley", "western".
0.200
Owyhee River ↗ Q2042749 KW CROSS HIGH
annualcentralflowgenerallyidahonearplacesregionremotewestern
SHARED TOKENS (10): "annual", "central", "flow", "generally", "idaho", "near", "places", "region", "remote", "western".
0.200
boundariesconveyancedescribeddescriptionlandlawlegalpropertyrealstatement
SHARED TOKENS (10): "boundaries", "conveyance", "described", "description", "land", "law", "legal", "property", "real", "statement".
0.180
Streamflow ↗ Q29425295 KW CROSS HIGH
capacitychannelchannelscomponentflowlandrecordvolumewater
SHARED TOKENS (9): "capacity", "channel", "channels", "component", "flow", "land", "record", "volume", "water".
0.180
adaboisegovernmentidahometropolitanmunicipalpopulationretainsseparate
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "retains", "separate".
0.180
Fecal coliform ↗ Q918223 KW CROSS HIGH
capablecontaminationdirectlygenerallygrowthpresencepresentproducewater
SHARED TOKENS (9): "capable", "contamination", "directly", "generally", "growth", "presence", "present", "produce", "water".
0.180
Salmonidae ↗ Q184238 KW CROSS HIGH
amongchaindescribedevenlargermigrationsinglesmallwhose
SHARED TOKENS (9): "among", "chain", "described", "even", "larger", "migration", "single", "small", "whose".
0.180
Water taxi ↗ Q5643 KW CROSS HIGH
demanddescribedoperatingprivateprovidepublicratherurbanwater
SHARED TOKENS (9): "demand", "described", "operating", "private", "provide", "public", "rather", "urban", "water".
0.180
chaptercodecommonfederalformlawsprocesssectiontitle
SHARED TOKENS (9): "chapter", "code", "common", "federal", "form", "laws", "process", "section", "title".
0.180
buildingcommonlycovereddeterminedestatepropertyrealrecentvalue
SHARED TOKENS (9): "building", "commonly", "covered", "determined", "estate", "property", "real", "recent", "value".
0.180
generallargeprocessesqualityremainsewersmalltreatmentwater
SHARED TOKENS (9): "general", "large", "processes", "quality", "remain", "sewer", "small", "treatment", "water".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "western".
0.160
certaincurrentknowledgemodelprocessesrepresentationstudentssystems
SHARED TOKENS (8): "certain", "current", "knowledge", "model", "processes", "representation", "students", "systems".
0.160
Water table ↗ Q3342272 KW CROSS HIGH
actionactualflowincreasingmaterialspressuresufficientwater
SHARED TOKENS (8): "action", "actual", "flow", "increasing", "materials", "pressure", "sufficient", "water".
0.160
estateformfunctionshomehousinginvestmentpersonreal
SHARED TOKENS (8): "estate", "form", "functions", "home", "housing", "investment", "person", "real".
0.140
USDA home loan ↗ KW CROSS HIGH
agriculturedepartmentdevelopmenthomehousingprogramproperty
SHARED TOKENS (7): "agriculture", "department", "development", "home", "housing", "program", "property".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboisegainidahometropolitanpercentpopulation
SHARED TOKENS (7): "ada", "boise", "gain", "idaho", "metropolitan", "percent", "population".
0.140
boisecanyonestimateidahometropolitannampapopulation
SHARED TOKENS (7): "boise", "canyon", "estimate", "idaho", "metropolitan", "nampa", "population".
0.140
Granite ↗ Q41177 KW CROSS HIGH
commonconstructionhistorylargerpropertiesstructurestype
SHARED TOKENS (7): "common", "construction", "history", "larger", "properties", "structures", "type".
0.140
Clark's grebe ↗ Q432327 KW CROSS HIGH
behaviorcentrallargelocalmaintainsvalleywestern
SHARED TOKENS (7): "behavior", "central", "large", "local", "maintains", "valley", "western".
0.140
bankchangechannelmigrationparticularlypointprocess
SHARED TOKENS (7): "bank", "change", "channel", "migration", "particularly", "point", "process".
0.140
continuingdepartmentfederalgovernmentmanagementmissionprotect
SHARED TOKENS (7): "continuing", "department", "federal", "government", "management", "mission", "protect".
0.140
Negative equity ↗ KW CROSS HIGH
assetsestateoccurringparticularlyrealvaluewhose
SHARED TOKENS (7): "assets", "estate", "occurring", "particularly", "real", "value", "whose".
0.140
anotherconvertendperiodpreviouslyprincipaltype
SHARED TOKENS (7): "another", "convert", "end", "period", "previously", "principal", "type".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationsmall
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "population", "small".
0.120
becomeexistenceformlanduseswater
SHARED TOKENS (6): "become", "existence", "form", "land", "uses", "water".
0.120
affectingcontractgenerallegaloutsideprocess
SHARED TOKENS (6): "affecting", "contract", "general", "legal", "outside", "process".
0.120
Western grebe ↗ Q679154 KW CROSS HIGH
describeddistinctlaterthemwaterwestern
SHARED TOKENS (6): "described", "distinct", "later", "them", "water", "western".
0.120
demandenvironmentalphysicalpracticesupplieswater
SHARED TOKENS (6): "demand", "environmental", "physical", "practice", "supplies", "water".
0.120
costsinsuranceprivatepropertypurposetype
SHARED TOKENS (6): "costs", "insurance", "private", "property", "purpose", "type".
◈ Frequently Asked Questions
Rivers Lakes × Mortgage Lending — Treasure Valley
HAIKU · HIGH GATE
How do water rights from the Boise River affect property valuations for mortgage lending in Ada County?
Lenders in Ada County evaluate mortgages partly on whether parcels hold documented water rights from the Boise River, which directly impact agricultural and residential land values across the Treasure Valley. Properties with senior water rights command higher appraisals because irrigation districts in Ada County depend on Snake River Plain aquifer access and surface water allocation through the river system.
Why do mortgage lenders in Nampa and Caldwell require flood zone assessments related to irrigation districts?
Mortgage lending in Nampa and Caldwell requires flood risk evaluation because irrigation districts operate canal systems fed by the Boise River and Snake River Plain groundwater that can affect land drainage and seasonal water levels. Lenders in Canyon County must account for these water management operations when underwriting properties, as they influence insurance costs and long-term property stability.
How do land-use planning decisions in the Boise metropolitan area influence mortgage lending criteria?
Municipal land-use planning in Boise, Nampa, and surrounding Ada and Canyon County jurisdictions determines whether parcels can support agricultural water rights or residential development, which directly shapes mortgage terms and down payment requirements. Lenders review Treasure Valley land-use classifications to assess whether properties maintain access to Boise River water rights or depend on groundwater from the Snake River Plain aquifer system.
What role do water rights transfers play in mortgage refinancing across the Treasure Valley?
When property owners in Ada County or Canyon County refinance mortgages, lenders reassess whether water rights held under irrigation district agreements remain attached to the land, as these rights significantly affect collateral value. The Boise River water allocation system and Snake River Plain groundwater availability determine whether refinanced properties retain their original appraisal basis in the Treasure Valley market.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Rivers Lakes × Mortgage Lending 16 QID bridges 279 edges 6,709 ext links 2026-07-17 22:59:32 UTC acec2198d92cad81
Rivers Lakes corridor ↗ Mortgage Lending corridor ↗ Mortgage Lending × Rivers Lakes ↗ boisestandard.org/standard ↗
Parent Corridors
Rivers Lakes × All Other Verticals