—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Rivers Lakes ↔ relates to ↔ Biotech Life Sciences

17 Wikipedia bridge articles confirmed in both vertical ledgers. 268 deterministic cross-vertical edges. 7,069 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
268 Cross Edges
7,069 External Sources
299 Wikipedia Articles
19 🌲 Evergreen
200 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Rivers Lakes
× Biotech Life Sciences
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
268
External Sources Harvested
7,069
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
University of Idaho
score: 1.0000  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (17)
University of IdahoBoise metropolitan areaTreasure ValleyWater qualityBoise State UniversityCollege of Western IdahoDrinking waterIdaho Department of Environmental QualityBoise RiverSnake River PlainUnited States Environmental Protection AgencyBoise, IdahoNampa, IdahoCaldwell, IdahoAda County, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadacanyonmilespublichomenampatreasurevalleyriverwesterncollegeamongapproximatelyresearchuniversitymeridian
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:57:04 UTC
Content Hash
057a39264bf3417f
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (21): "among", "approximately", "boise", "campus", "classified", "division", "established", "graduate", "idaho", "later", "operates", "production", "professional", "public", "represented", "research", "statewide", "students", "uidaho", "undergraduate".... | EXACT TITLE in rivers_lakes: "University of Idaho". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
amongapproximatelyboisecampusclassifieddivisionestablishedgraduateidaholateroperatesproductionprofessionalpublicrepresentedresearchstatewidestudentsuidahoundergraduateuniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (19): "ada", "adds", "boise", "canyon", "commonly", "component", "currently", "designated", "encompasses", "home", "idaho", "meridian", "metropolitan", "nampa", "percent", "population", "section", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
adaaddsboisecanyoncommonlycomponentcurrentlydesignatedencompasseshomeidahomeridianmetropolitannampapercentpopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "lower", "metropolitan", "opportunities", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in rivers_lakes: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocallowermetropolitanopportunitiesregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Water quality
Q625376 EXACT TITLE 1.000
QID OVERLAP: Q625376 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (19): "against", "assessment", "biological", "chemical", "common", "compliance", "determines", "drinking", "generally", "health", "physical", "quality", "reference", "safety", "significant", "standards", "supply", "treatment", "water". | EXACT TITLE in rivers_lakes: "Water quality".
againstassessmentbiologicalchemicalcommoncompliancedeterminesdrinkinggenerallyhealthphysicalqualityreferencesafetysignificantstandardssupplytreatmentwater
Water quality refers to the chemical, physical, and biological characteristics of water based on the standards of its usage. It is most frequently used by reference to a set of standards against which compliance, generally achieved through treatment of the water, can be assessed. The most common standards used to monitor and assess water quality convey the health of ecosystems, safety of human contact, extent of water pollution and condition of drinking water.
Making these complex measurements can be expensive. Because direct measurements of water quality can be expensive, ongoing monitoring programs are typically conducted and results released by government agencies. However, there are local volunteer programs and resources available for some general assessment. Tools available to the general public include on-site test kits, commonly used for home fish tanks, and biological assessment procedures. Biosensors Biosensors have the potential for "high sensitivity, selectivity, reliability, simplicity, low-cost and real-time response".
Biological monitoring metrics have been developed in many places, and one widely used family of measurements for freshwater is the presence and abundance of members of the insect orders Ephemeroptera, Plecoptera and Trichoptera (EPT) (of benthic macroinvertebrates whose common names are, respectively, mayfly, stonefly and caddisfly). EPT indexes will naturally vary from region to region, but generally, within a region, the greater the number of taxa from these orders, the better the water quality. Organisations in the United States, such as EPA. offer guidance on developing a monitoring program and identifying members of these and other aquatic insect orders. Many US wastewater dischargers (e.g., factories, power plants, refineries, mines, municipal sewage treatment plants) are required to conduct periodic whole effluent toxicity (WET) tests. Individuals interested in monitoring water quality who cannot afford or manage lab scale analysis can also use biological indicators to get a general reading of water quality. One example is the IOWATER volunteer water monitoring program of Iowa, which includes an EPT indicator key. Bivalve molluscs are largely used as bioindicators to monitor the health of aquatic environments in both fresh water and the marine environments. Their population status or structure, physiology, behaviour or the level of contamination with elements or compounds can indicate the state of contamination status of the ecosystem. They are particularly useful since they are sessile so that they are representative of the environment where they are sampled or placed. A typical project is the U.S. Mussel Watch Programme, but today they are used worldwide. The Southern African Scoring System (SASS) method is a biological water quality monitoring system based on the presence of benthic macroinvertebrates (EPT). The SASS aquatic biomonitoring tool has been refined over the past 30 years and is now on the fifth version (SASS5) which has been specifically modified in accordance with international standards, namely the ISO/IEC 17025 protocol. The SASS5 method is used by the South African Department of Water Affairs as a standard method for River Health Assessment, which feeds the national River Health Programme and the national Rivers Database. Climate change impacts Standards and reports In the setting of standards, agencies make political and technical/scientific decisions based on how the water will be used. In the case of natural water bodies, agencies also make some reasonable estimate of pristine conditions. Natural water bodies will vary in response to a region's environmental conditions, whereby water composition is influenced by the surrounding geological features, sediments, and rock types, topography, hydrology, and climate. Environmental scientists and aqueous geochemists work to interpret the parameters and environmental conditions that impact the water quality of a region, which in turn helps to identify the sources and fates of contaminants. Environmental lawyers and policymakers work to define legislation with the intention that water is maintained at an appropriate quality for its identified use. Another general perception of water quality is that of a simple property that tells whether water is polluted or not. In fact, water quality is a complex subject, in part because water is a complex medium intrinsically tied to the ecology, geology, and anthropogenic activities of a region. Industrial and commercial activities (e.g.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (23): "activity", "among", "boise", "classified", "college", "degrees", "division", "doctoral", "education", "engineering", "graduate", "health", "idaho", "independent", "institution", "master", "million", "program", "programs", "public".... | EXACT TITLE in rivers_lakes: "Boise State University". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityamongboiseclassifiedcollegedegreesdivisiondoctoraleducationengineeringgraduatehealthidahoindependentinstitutionmastermillionprogramprogramspublicresearchuniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (23): "ada", "board", "boise", "campus", "canyon", "college", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "residents", "students", "technical", "transfer", "treasure".... | EXACT TITLE in rivers_lakes: "College of Western Idaho". | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
adaboardboisecampuscanyoncollegedevelopmenteducationgovernedidaholargenampapopulationprogramspublicresidentsstudentstechnicaltransfertreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Drinking water
Q7892 EXACT TITLE 0.980
QID OVERLAP: Q7892 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (14): "activity", "conditions", "developing", "directly", "drinking", "environmental", "form", "health", "maintain", "major", "physical", "supplied", "water", "work". | EXACT TITLE in rivers_lakes: "Drinking water". | EXACT TITLE in biotech_life_sciences: "Drinking water".
activityconditionsdevelopingdirectlydrinkingenvironmentalformhealthmaintainmajorphysicalsuppliedwaterwork
y through food preparation. It is often supplied through taps, in which case it is also called tap water. The amount of drinking water required to maintain good health varies, and depends on physical activity, age, health-related issues, and environmental conditions. For those who work in a hot climate, up to 16 liters (4.2 U.S. gal) a day may be required. As many as two billion people lack safe drinking water. Unsafe water can carry disease and is a major cause of death and illness worldwide.
In the United States, the typical water consumption per capita, at home, is 69.3 U.S. gallons (262 L; 57.7 imp gal) of water per day. Of this, only 1% of the water provided by public water suppliers is for drinking and cooking. Uses include (in decreasing order) toilets, washing machines, showers, baths, faucets, and leaks. Usage for drinking The recommended daily amount of drinking water for humans varies. It depends on activity, age, health, and environment. In the United States, the Adequate Intake for total water, based on median intakes, is 4.0 litres (141 imp fl oz; 135 US fl oz) per day for males older than 18, and 3.0 litres (106 imp fl oz; 101 US fl oz) per day for females over 18; it assumes about 80% from drink and 20% from food. The European Food Safety Authority recommends 2.0 litres (70 imp fl oz; 68 US fl oz) of total water per day for women and 2.5 litres (88 imp fl oz; 85 US fl oz) per day for men. The common advice to drink 8 glasses (1,900 mL or 64 US fl oz) of plain water per day is not scientific; thirst is a better guide for how much water to drink than is a specific, fixed amount. Americans aged 21 and older, on average, drink 1,043 mL (36.7 imp fl oz; 35.3 US fl oz) of drinking water a day, and 95% drink less than 2,958 mL (104.1 imp fl oz; 100.0 US fl oz) per day. Exercise and heat exposure cause loss of water and therefore may induce thirst and greater water intake. Active people in hot climates may need 6.0 litres (211 imp fl oz; 203 US fl oz) of water, or more, per day. How much drinking water contributes to the intake of mineral nutrients is unclear. Inorganic minerals generally enter surface water and groundwater via stormwater runoff and through the ground. Water treatment also adds some minerals, such as calcium, zinc, manganese, phosphate, fluoride, and sodium compounds. Water generated by the biochemical metabolism of nutrients provides a significant part of the daily water needs for some arthropods and desert animals, but provides only a small fraction of a human's necessary intake. There are trace elements in almost all potable water; some of these affect metabolism, such as sodium, potassium, and chloride, which are common in small amounts in most water. Other elements, such as fluoride, while beneficial in low concentrations, can cause dental and other problems at high levels. Fluid balance is important to health. Profuse sweating can increase the need to replace electrolytes (salts). Water intoxication (the consumption of too much water too quickly) causes hyponatremia, which can cause death in minutes or hours. Water makes up about 60% of the body weight in men and 55% of weight in women.
Sixty million people are estimated to have been poisoned by well water contaminated by excessive fluoride, which dissolved from granite rocks. The effects are particularly evident in the bone deformations of children. Similar or larger problems are anticipated in other countries including China, Uzbekistan, and Ethiopia. Although helpful for dental health in low dosage, fluoride in large amounts interferes with bone formation. Long-term consumption of water with high fluoride concentration (> 1.5 ppm F) can have serious undesirable consequences such as dental fluorosis, enamel mottle and skeletal fluorosis, bone deformities in children. Fluorosis severity depends on how much fluoride is present in the water, as well as people's diet and physical activity.
Idaho Department of Environmental Quality
Q5987351 EXACT TITLE 0.900
QID OVERLAP: Q5987351 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "boise", "department", "environmental", "federal", "government", "idaho", "maintained", "quality", "regional", "responsible". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
boisedepartmentenvironmentalfederalgovernmentidahomaintainedqualityregionalresponsible
tment of Environmental Quality is the department of the Idaho state government responsible for administering state and federal environmental laws and regulations. The department's main offices are in Boise, and six regional offices are also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act.
also maintained. History The department was established in 2000 upon the passing of amendments to the Idaho Environmental Protection and Health Act. Before 2000, DEQ in Idaho was a division of the Department of Health and Welfare. Structure and functions It is organized into five divisions: Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Air Quality: responsible for monitoring air pollution and permits relating to the same Water Quality: sets water quality standards and monitors ground, surface, and drinking water quality Waste Management and Remediation: responsible for all issues relating to waste disposal Environmental Management and Information: provides technical communications services, including publications Technical Services: the research and technical enforcement division, including inspection activities The department also exercises non-regulatory oversight of the Idaho National Laboratory. The director of the department reports to the governor.
Boise River
Q891080 EXACT TITLE 0.860
QID OVERLAP: Q891080 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (8): "agricultural", "approximately", "boise", "encompasses", "idaho", "miles", "river", "western". | EXACT TITLE in rivers_lakes: "Boise River". | EXACT TITLE in biotech_life_sciences: "Boise River".
agriculturalapproximatelyboiseencompassesidahomilesriverwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Snake River Plain
Q1396049 EXACT TITLE 0.840
QID OVERLAP: Q1396049 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (7): "agricultural", "covers", "idaho", "land", "major", "miles", "river". | EXACT TITLE in rivers_lakes: "Snake River Plain".
agriculturalcoversidaholandmajormilesriver
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
y within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
United States Environmental Protection Agency
QID OVERLAP 0.800
QID OVERLAP: Q460173 in rivers_lakes (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (38): "approved", "assessment", "conducts", "conservation", "department", "education", "employees", "energy", "enforcement", "engineers", "environmental", "epa", "establishment", "federal", "government", "governments", "independent", "information", "legal", "levels"....
approvedassessmentconductsconservationdepartmenteducationemployeesenergyenforcementengineersenvironmentalepaestablishmentfederalgovernmentgovernmentsindependentinformationlegallevelslocalmattersmonitoringnationaloperationpermittingpreventionprogramsproposedprotection+8
xon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "home", "idaho", "locally", "major", "metropolitan", "miles", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalhomeidaholocallymajormetropolitanmilespopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (14): "according", "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "miles", "nampa", "population", "principal", "university", "western".
accordingboisecanyoncollegehomeidahomeridianmetropolitanmilesnampapopulationprincipaluniversitywestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private".
adaboisecapitalhomeidahojurisdictionlocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in rivers_lakes (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
251 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP251 edges
🌲 EVERGREEN2 edges
0.650
adaapproximatelyboisecanyoncapacityfarmlandidahoirrigationmilesmultipleriversystemtreasurevalleywaterwestern
SHARED TOKENS (16): "ada", "approximately", "boise", "canyon", "capacity", "farmland", "idaho", "irrigation", "miles", "multiple", "river", "system", "treasure", "valley", "water", "western". | URL->A (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in rivers_lakes: "New York Canal".
0.650
adaboisebuiltbureauconstructioncontroldirectlyearlyengineersfederalidahoirrigationlightmilesmultipleoperatingoperationalprivatepurposeriver
SHARED TOKENS (22): "ada", "boise", "built", "bureau", "construction", "control", "directly", "early", "engineers", "federal", "idaho", "irrigation", "light", "miles", "multiple", "operating", "operational", "private", "purpose", "river".... | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in rivers_lakes: "Lucky Peak Dam".
🌿 BRANCH200 edges
0.500
administrationannualapproximatelyboardbudgetingeducationengineeringfederalfieldsgovernmenthealthindependentmajornationaloperationsplanningrequireresearchresponsiblescience
SHARED TOKENS (24): "administration", "annual", "approximately", "board", "budgeting", "education", "engineering", "federal", "fields", "government", "health", "independent", "major", "national", "operations", "planning", "require", "research", "responsible", "science".... | EXACT TITLE in rivers_lakes: "National Science Foundation".
0.500
Antibody ↗ Q79460 EXACT TITLE
allowingbecomebodycapacitychemicalcontainsdeliverydemonstratedescribesdifferentdirectlydistinctdistributiondividedessentialformfunctionfunctionsgeneralgenerally
SHARED TOKENS (35): "allowing", "become", "body", "capacity", "chemical", "contains", "delivery", "demonstrate", "describes", "different", "directly", "distinct", "distribution", "divided", "essential", "form", "function", "functions", "general", "generally".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
addressagricultureanotherapplicationsappliesapprovalartificialbiologicalbiologybreedingcertainchemicalcleanconsequentlycoredefinitionsdevelopeddevelopingdevelopmentdirectly
SHARED TOKENS (69): "address", "agriculture", "another", "applications", "applies", "approval", "artificial", "biological", "biology", "breeding", "certain", "chemical", "clean", "consequently", "core", "definitions", "developed", "developing", "development", "directly".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
activitycommoncommonlydatadependingdistributionecosysteminformationmovementpracticeprocesspurposesreportingresearchscientificspecializedstudytype
SHARED TOKENS (18): "activity", "common", "commonly", "data", "depending", "distribution", "ecosystem", "information", "movement", "practice", "process", "purposes", "reporting", "research", "scientific", "specialized", "study", "type". | EXACT TITLE in rivers_lakes: "Wildlife observation".
0.500
alongsideartificialcertainchannelscontainsdrinkingenergyformindustrialirrigationlandlargelevelsmajorprecipitationreportsresultstreamssurroundingtreatment
SHARED TOKENS (24): "alongside", "artificial", "certain", "channels", "contains", "drinking", "energy", "form", "industrial", "irrigation", "land", "large", "levels", "major", "precipitation", "reports", "result", "streams", "surrounding", "treatment".... | EXACT TITLE in rivers_lakes: "Surface water".
0.500
accordingappliedbecomecapablechemicalcomplexdeterminedifferentfieldfieldsfunctionidentifiedidentitystructurethem
SHARED TOKENS (15): "according", "applied", "become", "capable", "chemical", "complex", "determine", "different", "field", "fields", "function", "identified", "identity", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
allowinganotherbiologycollectioncreatedegreesdevelopmentessentialfieldinsideinteractionlifelightphysicalprocessremainssmallstudiestechnicaluses
SHARED TOKENS (21): "allowing", "another", "biology", "collection", "create", "degrees", "development", "essential", "field", "inside", "interaction", "life", "light", "physical", "process", "remains", "small", "studies", "technical", "uses".... | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingchannelscommonlydesignedembeddedfoundmaterialperformancepracticeprocessrequirementssoilstructuretypeupstreamwater
SHARED TOKENS (16): "allowing", "channels", "commonly", "designed", "embedded", "found", "material", "performance", "practice", "process", "requirements", "soil", "structure", "type", "upstream", "water". | EXACT TITLE in rivers_lakes: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedbasinbestboisecapitalcontainsdistinctdividedearlyeconomygeographicidahoisolatedlaboratorylandmilesmillion
SHARED TOKENS (34): "agricultural", "agriculture", "approximately", "associated", "basin", "best", "boise", "capital", "contains", "distinct", "divided", "early", "economy", "geographic", "idaho", "isolated", "laboratory", "land", "miles", "million".... | EXACT TITLE in rivers_lakes: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
0.500
activityanotherchemicalcommonlyconnectedconservationcontaminationdesigndesigneddevelopeddevelopingdistributionenergyengineeringflowgoverninginteractionlocalmaintainedmovement
SHARED TOKENS (30): "activity", "another", "chemical", "commonly", "connected", "conservation", "contamination", "design", "designed", "developed", "developing", "distribution", "energy", "engineering", "flow", "governing", "interaction", "local", "maintained", "movement".... | EXACT TITLE in rivers_lakes: "Hydrogeology".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addchangeclassifiedcommoncontaminationcreatecreatesdependdirecteconomiceffectsgrowthhealthlandland-uselevelsmanagementmaterialmodernperiods
SHARED TOKENS (30): "add", "change", "classified", "common", "contamination", "create", "creates", "depend", "direct", "economic", "effects", "growth", "health", "land", "land-use", "levels", "management", "material", "modern", "periods".... | EXACT TITLE in rivers_lakes: "Wildfire". | EXACT TITLE in biotech_life_sciences: "Wildfire".
0.500
Vaccine ↗ Q134808 EXACT TITLE
activeadministrationagainstalreadyassociatedbiologicalcontainsdescribeddevelopeddevelopmentdifferenteffectshealthlicensedorganizationpracticeproductionproposedreportsresponsible
SHARED TOKENS (24): "active", "administration", "against", "already", "associated", "biological", "contains", "described", "developed", "development", "different", "effects", "health", "licensed", "organization", "practice", "production", "proposed", "reports", "responsible".... | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
actaddadministrationauthoritycontrolfederalformimplementationinvestigationlawnationalprincipalprovisionsrequirementssafetystudy
SHARED TOKENS (16): "act", "add", "administration", "authority", "control", "federal", "form", "implementation", "investigation", "law", "national", "principal", "provisions", "requirements", "safety", "study". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomecapacitycentralchangechemicalscleancommonlycontainsdischargedistributiondrinkingeffectsenvironmentalfieldformformationindustrialinfluence
SHARED TOKENS (44): "agricultural", "agriculture", "become", "capacity", "central", "change", "chemicals", "clean", "commonly", "contains", "discharge", "distribution", "drinking", "effects", "environmental", "field", "form", "formation", "industrial", "influence".... | EXACT TITLE in rivers_lakes: "Groundwater".
0.500
approvalbiologicalcannotcontractcostsdesigneddevelopingdevelopmentevidenceexpertiseforminstitutionslargelifemaintainmanagementmarketsorganizationorganizationsprovide
SHARED TOKENS (31): "approval", "biological", "cannot", "contract", "costs", "designed", "developing", "development", "evidence", "expertise", "form", "institutions", "large", "life", "maintain", "management", "markets", "organization", "organizations", "provide".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
advancedagenciesapprovalsbiologicalbuildingcategorycomplexcomponentsconditionsdifferentdirectlyengineeredengineeringgeneralisolatedmarketoutsidepathwaysperformanceplant
SHARED TOKENS (36): "advanced", "agencies", "approvals", "biological", "building", "category", "complex", "components", "conditions", "different", "directly", "engineered", "engineering", "general", "isolated", "market", "outside", "pathways", "performance", "plant".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
amonganalysisappearsappliedassessmentbiologicalbiologychangecollectionconditionsdatadecisionsdescriptiondesigndistributioneffectsengineeringenvironmentalexposurefunction
SHARED TOKENS (47): "among", "analysis", "appears", "applied", "assessment", "biological", "biology", "change", "collection", "conditions", "data", "decisions", "description", "design", "distribution", "effects", "engineering", "environmental", "exposure", "function".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
Phosphorus ↗ Q674 EXACT TITLE
agriculturealoneapplicationschemicalcommoncomplexcomponentcontainingdiscoveryessentialexposureformfoundgenerallyindustrialintensivelevelslifemaintainedmakes
SHARED TOKENS (28): "agriculture", "alone", "applications", "chemical", "common", "complex", "component", "containing", "discovery", "essential", "exposure", "form", "found", "generally", "industrial", "intensive", "levels", "life", "maintained", "makes".... | EXACT TITLE in rivers_lakes: "Phosphorus".
0.500
actappliedbecomebuiltbureaucurrentlydeliverydepartmentdevelopmentestablishedfarmlandfederalgovernmentirrigationlawmanagementmillionoperationoversightprogram
SHARED TOKENS (28): "act", "applied", "become", "built", "bureau", "currently", "delivery", "department", "development", "established", "farmland", "federal", "government", "irrigation", "law", "management", "million", "operation", "oversight", "program".... | EXACT TITLE in rivers_lakes: "Bureau of Reclamation".
0.500
actadministrationappliescurrentlydrinkingenvironmentalepafederallawprivateprotectionpublicqualityregulatedstandardssystemsystemswater
SHARED TOKENS (18): "act", "administration", "applies", "currently", "drinking", "environmental", "epa", "federal", "law", "private", "protection", "public", "quality", "regulated", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeadvancedagainstapplicationsassociatedbecomebiologybodychemicalcomponentscoversearlyembeddedessentialexistencefieldshealthincreasinglatermaintain
SHARED TOKENS (31): "active", "advanced", "against", "applications", "associated", "become", "biology", "body", "chemical", "components", "covers", "early", "embedded", "essential", "existence", "fields", "health", "increasing", "later", "maintain".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityadvancedbehaviorbiologicalbiologycenteredchemicalcomplexcouncilcovereddescribeddetaileddiscoveryearlyfieldfunctiongoverninglaboratorylevelsmechanisms
SHARED TOKENS (34): "activity", "advanced", "behavior", "biological", "biology", "centered", "chemical", "complex", "council", "covered", "described", "detailed", "discovery", "early", "field", "function", "governing", "laboratory", "levels", "mechanisms".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
behaviorbiologicalbiologycombinesdescribeddifferentfunctionsindividualmodelingsciencescientificscopestatisticsstudiesstudysystem
SHARED TOKENS (16): "behavior", "biological", "biology", "combines", "described", "different", "functions", "individual", "modeling", "science", "scientific", "scope", "statistics", "studies", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.500
Cell biology ↗ Q7141 EXACT TITLE
behaviorbiologicalbiologycomponentsencompassesessentialfieldsfunctionliferesearchresponsiblestructurestudiesstudywork
SHARED TOKENS (15): "behavior", "biological", "biology", "components", "encompasses", "essential", "fields", "function", "life", "research", "responsible", "structure", "studies", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.500
Dam ↗ Q12323 EXACT TITLE
availabilitybuildingbuiltclassifiedcleanconstructioncriticaldesigndevelopedearlyengineeringfaceflowfunctionsgoverninghealthimproveincorporatedincreaseindustrial
SHARED TOKENS (51): "availability", "building", "built", "classified", "clean", "construction", "critical", "design", "developed", "early", "engineering", "face", "flow", "functions", "governing", "health", "improve", "incorporated", "increase", "industrial".... | EXACT TITLE in rivers_lakes: "Dam".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
biologycleancommonlyconcentrationcontainscontaminationdesignedengineeredfacilitiesindustrialinsidemaintainsmaterialmaterialspermitsprocessesproductionresearchscientificspace
SHARED TOKENS (21): "biology", "clean", "commonly", "concentration", "contains", "contamination", "designed", "engineered", "facilities", "industrial", "inside", "maintains", "material", "materials", "permits", "processes", "production", "research", "scientific", "space".... | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.500
Virology ↗ Q7215 EXACT TITLE
agricultureappliedbacterialbeginningbiologicalbiologybroadcomponentcoveringdetectiondifferentdistinctfieldfunctionshealthinteractionlaboratoryofficialpartsplant
SHARED TOKENS (30): "agriculture", "applied", "bacterial", "beginning", "biological", "biology", "broad", "component", "covering", "detection", "different", "distinct", "field", "functions", "health", "interaction", "laboratory", "official", "parts", "plant".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
Biosensor ↗ Q669391 EXACT TITLE
anotherassociatedbiologicalchemicalcombinescomponentconnectsdetectiondifferentengineeringinteractionmaterialpossibleresponsibleresultingstudyuserworkingworks
SHARED TOKENS (19): "another", "associated", "biological", "chemical", "combines", "component", "connects", "detection", "different", "engineering", "interaction", "material", "possible", "responsible", "resulting", "study", "user", "working", "works". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.500
allowingbuildingbuiltdevelopmentdischargeeventsirrigationlandmajormaterialsmunicipalparkingprecipitationremainssewersoilsourcestormwaterstreamssurfaces
SHARED TOKENS (23): "allowing", "building", "built", "development", "discharge", "events", "irrigation", "land", "major", "materials", "municipal", "parking", "precipitation", "remains", "sewer", "soil", "source", "stormwater", "streams", "surfaces".... | EXACT TITLE in rivers_lakes: "Urban runoff".
0.500
annualanotherbecomecapitalconsequentlycontroldecisionsdevelopmentearlyemployeesentityfacefinancefinancingfirmsformgrowthhistoryinformationinstitutional
SHARED TOKENS (42): "annual", "another", "become", "capital", "consequently", "control", "decisions", "development", "early", "employees", "entity", "face", "finance", "financing", "firms", "form", "growth", "history", "information", "institutional".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
alreadybecomechangeconditionsconservationcurrentdistinctecosystemessentialfunctionhistoricalhundredsidentifiedimproveincreasedlifelocalpointpopulationsprocess
SHARED TOKENS (30): "already", "become", "change", "conditions", "conservation", "current", "distinct", "ecosystem", "essential", "function", "historical", "hundreds", "identified", "improve", "increased", "life", "local", "point", "populations", "process".... | EXACT TITLE in rivers_lakes: "Ecological restoration".
0.500
analysisappliesapprovalbehaviorboardboardscertaincodescommonlydesignateddeterminefieldsformhealthimprovedindependentinstitutioninstitutionallegallymaterials
SHARED TOKENS (36): "analysis", "applies", "approval", "behavior", "board", "boards", "certain", "codes", "commonly", "designated", "determine", "fields", "form", "health", "improved", "independent", "institution", "institutional", "legally", "materials".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
agriculturalanotherbiologicalbodychemicalcommonenvironmentfacilityindustrialindustrymunicipalphaseplantprocessprocessespurposeresultingreturnsafelytreated
SHARED TOKENS (26): "agricultural", "another", "biological", "body", "chemical", "common", "environment", "facility", "industrial", "industry", "municipal", "phase", "plant", "process", "processes", "purpose", "resulting", "return", "safely", "treated".... | EXACT TITLE in rivers_lakes: "Wastewater treatment". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
approximatelybehaviorbuiltcommonlycomplexconcentrationcurrentdepartmentenergyengineeringenvironmentalfacilitiesfacilityhistoricallyhistoryidahoinstituteknowledgelaboratorynational
SHARED TOKENS (25): "approximately", "behavior", "built", "commonly", "complex", "concentration", "current", "department", "energy", "engineering", "environmental", "facilities", "facility", "historically", "history", "idaho", "institute", "knowledge", "laboratory", "national".... | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
adaboisebuiltbureaucanyonengineersidahoirrigationmilesrivertreasureupstreamvalleywaterwestern
SHARED TOKENS (15): "ada", "boise", "built", "bureau", "canyon", "engineers", "idaho", "irrigation", "miles", "river", "treasure", "upstream", "valley", "water", "western". | EXACT TITLE in rivers_lakes: "Boise River Diversion Dam".
0.500
categorycertaincreatedevelopedeconomicindividualinformationlandlawlegallowermodernownershipprocessespropertypurposerightssystemsthem
SHARED TOKENS (19): "category", "certain", "create", "developed", "economic", "individual", "information", "land", "law", "legal", "lower", "modern", "ownership", "processes", "property", "purpose", "rights", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
Toxicology ↗ Q7218 EXACT TITLE
biologychemicalcurrentlyeffectsenvironmentexposurefieldinfluencemovementpracticepracticesrelationshipresearchscientificstudysubjecttreatingtreatment
SHARED TOKENS (18): "biology", "chemical", "currently", "effects", "environment", "exposure", "field", "influence", "movement", "practice", "practices", "relationship", "research", "scientific", "study", "subject", "treating", "treatment". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.500
accumulationapproximatelyartificialbecomechangeclassifiedcommoncreatecreatescurrentdescribesdevelopeddevelopingdevelopmentdrinkingeconomiceducationenvironmentalessentialface
SHARED TOKENS (55): "accumulation", "approximately", "artificial", "become", "change", "classified", "common", "create", "creates", "current", "describes", "developed", "developing", "development", "drinking", "economic", "education", "environmental", "essential", "face".... | EXACT TITLE in rivers_lakes: "Urbanization". | EXACT TITLE in biotech_life_sciences: "Urbanization".
0.500
Microbiology ↗ Q7193 EXACT TITLE
bacterialbiologyclassifiedcommoncomplexcurrentcurrentlydesigndevelopedeffectsencompassesexistencelifematerialmeanspossessscientificsearchsmallstudy
SHARED TOKENS (23): "bacterial", "biology", "classified", "common", "complex", "current", "currently", "design", "developed", "effects", "encompasses", "existence", "life", "material", "means", "possess", "scientific", "search", "small", "study".... | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomechemicalclassifiedcommoncommonlydirectestablishmenthealthinformationinstitutionalinvestigationlinksmodernmonitoringofficepracticeproductsprofessionalrelatedsafety
SHARED TOKENS (26): "become", "chemical", "classified", "common", "commonly", "direct", "establishment", "health", "information", "institutional", "investigation", "links", "modern", "monitoring", "office", "practice", "products", "professional", "related", "safety".... | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
activitybreedingcanyoncenterconservationcontainsedgeidaholandnampanationaloutsideprojectsriversitesurroundingwater
SHARED TOKENS (17): "activity", "breeding", "canyon", "center", "conservation", "contains", "edge", "idaho", "land", "nampa", "national", "outside", "projects", "river", "site", "surrounding", "water". | EXACT TITLE in rivers_lakes: "Deer Flat National Wildlife Refuge".
0.500
agricultureboisebureaudesignatedengineeringengineersidahoirrigationnationalprovidepurposeriverupstreamwaterwestern
SHARED TOKENS (15): "agriculture", "boise", "bureau", "designated", "engineering", "engineers", "idaho", "irrigation", "national", "provide", "purpose", "river", "upstream", "water", "western". | EXACT TITLE in rivers_lakes: "Arrowrock Dam".
0.500
actadministrationagenciescertaincontrolcurrentlydecisionsdeterminedistributionenforcementfederalimplementingisolatedlawlistingnationalpolicypreventionregulatedsingle
SHARED TOKENS (22): "act", "administration", "agencies", "certain", "control", "currently", "decisions", "determine", "distribution", "enforcement", "federal", "implementing", "isolated", "law", "listing", "national", "policy", "prevention", "regulated", "single".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
activeanalysisapplicationsautomationbeginningbiologychannelscomponentscontroldesigndeterminedevelopmentfieldflowformhundredsinterdisciplinarymeansmediamovement
SHARED TOKENS (33): "active", "analysis", "applications", "automation", "beginning", "biology", "channels", "components", "control", "design", "determine", "development", "field", "flow", "form", "hundreds", "interdisciplinary", "means", "media", "movement".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
addressagriculturalappliedbiologicalbiologychemicalchemicalscontrolcreatedesignenergyengineeredengineeringengineersexpertisegenerallyimproveknowledgematerialsprocess
SHARED TOKENS (33): "address", "agricultural", "applied", "biological", "biology", "chemical", "chemicals", "control", "create", "design", "energy", "engineered", "engineering", "engineers", "expertise", "generally", "improve", "knowledge", "materials", "process".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Hydrology ↗ EXACT TITLE
basindatadistributionengineeringenvironmentalfieldsgeographymanagementmovementphysicalplanningpolicyqualityrelatedresearchresourcessciencescientificscientistsstudy
SHARED TOKENS (21): "basin", "data", "distribution", "engineering", "environmental", "fields", "geography", "management", "movement", "physical", "planning", "policy", "quality", "related", "research", "resources", "science", "scientific", "scientists", "study".... | EXACT TITLE in rivers_lakes: "Hydrology".
0.500
Patent ↗ Q253623 EXACT TITLE
accordingamongcapabledefinefieldsindustriallawlegalmakingnationalorganizationprivatepropertyprotectionpublicratherrequirementsrightsscopesubject
SHARED TOKENS (22): "according", "among", "capable", "define", "fields", "industrial", "law", "legal", "making", "national", "organization", "private", "property", "protection", "public", "rather", "requirements", "rights", "scope", "subject".... | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
agriculturalanalysisbiologicalbiologybuildingcomplexdatadevelopmentdevelopsengineeringfieldinformationintegratesinterdisciplinarylargemodelingpathwayspopulationsprocessprocessing
SHARED TOKENS (28): "agricultural", "analysis", "biological", "biology", "building", "complex", "data", "development", "develops", "engineering", "field", "information", "integrates", "interdisciplinary", "large", "modeling", "pathways", "populations", "process", "processing".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anotherbiologicalbiologybodydevelopmentdifferentencompassesengineeredengineeringfieldfunctiongrowthhistorylargematerialmaterialsproductsproposedpurposescience
SHARED TOKENS (23): "another", "biological", "biology", "body", "development", "different", "encompasses", "engineered", "engineering", "field", "function", "growth", "history", "large", "material", "materials", "products", "proposed", "purpose", "science".... | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
againstanalysisassessmentbestbuildingchangechangescontroleffectsengineeringeventsexposureincreaseincreasedindividualinfrastructurelevelsmanagementpracticepractices
SHARED TOKENS (32): "against", "analysis", "assessment", "best", "building", "change", "changes", "control", "effects", "engineering", "events", "exposure", "increase", "increased", "individual", "infrastructure", "levels", "management", "practice", "practices".... | EXACT TITLE in rivers_lakes: "Flood management".
0.500
accordingalreadyappliesbiologicalbiologybroadchemicalcontroldesignencompassesengineeringfieldfoundinterdisciplinarymaterialpartspurposessciencescientificsystems
SHARED TOKENS (21): "according", "already", "applies", "biological", "biology", "broad", "chemical", "control", "design", "encompasses", "engineering", "field", "found", "interdisciplinary", "material", "parts", "purposes", "science", "scientific", "systems".... | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondclassifiedenvironmentflowformationhomeindustriallandlayermajormaterialmaterialspurposesregionrelatedsourcestudywater
SHARED TOKENS (18): "beyond", "classified", "environment", "flow", "formation", "home", "industrial", "land", "layer", "major", "material", "materials", "purposes", "region", "related", "source", "study", "water". | EXACT TITLE in rivers_lakes: "Aquifer".
0.500
appliesbiologybroadchemicalconstructioncontrolcreatedesignencompassesengineeringengineersenvironmentenvironmentalevaluatehealthimproveindustriallawlicensinglife
SHARED TOKENS (40): "applies", "biology", "broad", "chemical", "construction", "control", "create", "design", "encompasses", "engineering", "engineers", "environment", "environmental", "evaluate", "health", "improve", "industrial", "law", "licensing", "life".... | EXACT TITLE in rivers_lakes: "Environmental engineering". | EXACT TITLE in biotech_life_sciences: "Environmental engineering".
0.500
activitiesaffectagriculturalanotherchangescommonconditionscontaminationcontroldischargesdrinkingecosystemformincreasedindustrialinfrastructureirrigationmanagementplantpoint
SHARED TOKENS (31): "activities", "affect", "agricultural", "another", "changes", "common", "conditions", "contamination", "control", "discharges", "drinking", "ecosystem", "form", "increased", "industrial", "infrastructure", "irrigation", "management", "plant", "point".... | EXACT TITLE in rivers_lakes: "Water pollution".
0.500
Fishing ↗ Q14373 EXACT TITLE
accordingactivitiesactivityappliedcommercialcommonlydevelopingdirectemploymentenvironmentfarmsidentifiedindustrialmillionmodernproductionprovidestatisticswater
SHARED TOKENS (19): "according", "activities", "activity", "applied", "commercial", "commonly", "developing", "direct", "employment", "environment", "farms", "identified", "industrial", "million", "modern", "production", "provide", "statistics", "water". | EXACT TITLE in rivers_lakes: "Fishing".
0.500
Nitrogen ↗ Q627 EXACT TITLE
actappearsapplicationsbodychemicalcommercialcommoncontainscontroldescribesenergyformfoundindustrialindustryisolatedlargelifemajormaking
SHARED TOKENS (29): "act", "appears", "applications", "body", "chemical", "commercial", "common", "contains", "control", "describes", "energy", "form", "found", "industrial", "industry", "isolated", "large", "life", "major", "making".... | EXACT TITLE in rivers_lakes: "Nitrogen".
0.500
actadministrationbureaudepartmentdistributionenforcementestablishedfederalgovernmentintelligenceinvestigationjurisdictionlawnationaloperationsprotectionratherreportsresponsibleuses
SHARED TOKENS (20): "act", "administration", "bureau", "department", "distribution", "enforcement", "established", "federal", "government", "intelligence", "investigation", "jurisdiction", "law", "national", "operations", "protection", "rather", "reports", "responsible", "uses". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
activityapprovalapprovedauthoritybecomecentercenterscentralcertaincollectioncontractcostsdatadependingdesigndesigneddevelopmentfunctionshealthlaboratory
SHARED TOKENS (41): "activity", "approval", "approved", "authority", "become", "center", "centers", "central", "certain", "collection", "contract", "costs", "data", "depending", "design", "designed", "development", "functions", "health", "laboratory".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
Swimming ↗ Q6388 EXACT TITLE
activitiesamongbodycurriculumdependingenergyenvironmentexposurefacilitieshealthincreasedlevelslocalmodernmovenationalperformancepublicpurposesrequires
SHARED TOKENS (23): "activities", "among", "body", "curriculum", "depending", "energy", "environment", "exposure", "facilities", "health", "increased", "levels", "local", "modern", "move", "national", "performance", "public", "purposes", "requires".... | EXACT TITLE in rivers_lakes: "Swimming".
0.500
advancedcomponentsconcentrationdevelopeddrinkingenergyenvironmentenvironmentalflowhealthincreasedindustrialirrigationmaintenancematerialsprocessprocessesqualityreceivingreduces
SHARED TOKENS (28): "advanced", "components", "concentration", "developed", "drinking", "energy", "environment", "environmental", "flow", "health", "increased", "industrial", "irrigation", "maintenance", "materials", "process", "processes", "quality", "receiving", "reduces".... | EXACT TITLE in rivers_lakes: "Water treatment". | EXACT TITLE in biotech_life_sciences: "Water treatment".
0.500
agriculturalappliedcentralchemicaldesigndevelopmentdirectlyearlyevaluationfieldintegratesinterdisciplinarylifematerialsmodernpracticesprocessesprocessingproductionproducts
SHARED TOKENS (28): "agricultural", "applied", "central", "chemical", "design", "development", "directly", "early", "evaluation", "field", "integrates", "interdisciplinary", "life", "materials", "modern", "practices", "processes", "processing", "production", "products".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
Wetland ↗ Q170321 EXACT TITLE
accordingactamongassessmentbasinbuildingchangeclassifiedconservationcontroldependingdifferentdistinctecosystemenvironmentalformfunctionfunctionshealthidentify
SHARED TOKENS (37): "according", "act", "among", "assessment", "basin", "building", "change", "classified", "conservation", "control", "depending", "different", "distinct", "ecosystem", "environmental", "form", "function", "functions", "health", "identify".... | EXACT TITLE in rivers_lakes: "Wetland".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciesalteredbasinbeginningcanyoncentralcommercialconstructioncontrolcovereddevelopedfarmlandgovernmentshistoryidahoirrigationlargelowermajor
SHARED TOKENS (40): "activities", "agencies", "altered", "basin", "beginning", "canyon", "central", "commercial", "construction", "control", "covered", "developed", "farmland", "governments", "history", "idaho", "irrigation", "large", "lower", "major".... | EXACT TITLE in rivers_lakes: "Snake River".
0.500
affectanalysisassociatedchemicalcomponentscostsdependingdifferentformlaboratorylatermaterialphasepresenceprocessproductionpurposeresultseparatesites
SHARED TOKENS (22): "affect", "analysis", "associated", "chemical", "components", "costs", "depending", "different", "form", "laboratory", "later", "material", "phase", "presence", "process", "production", "purpose", "result", "separate", "sites".... | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
boardscommondepartmentgovernedhealthinstitutionalinstitutionsoversightpublicresearchresearchersreviewrightssignificanttitle
SHARED TOKENS (15): "boards", "common", "department", "governed", "health", "institutional", "institutions", "oversight", "public", "research", "researchers", "review", "rights", "significant", "title". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
Floodplain ↗ EXACT TITLE
adjacentagriculturalbasebodycontroldevelopeddischargeincreasinglandnearperiodsriskriversoilvalleywaterwaters
SHARED TOKENS (17): "adjacent", "agricultural", "base", "body", "control", "developed", "discharge", "increasing", "land", "near", "periods", "risk", "river", "soil", "valley", "water", "waters". | EXACT TITLE in rivers_lakes: "Floodplain".
0.500
amongapplicationsbiologybroadcommoncurrentdesigndevelopmentengineeringfieldfieldsgrowthhealthindustryintegratesinterdisciplinarymaintenancemakingmanagementmonitoring
SHARED TOKENS (27): "among", "applications", "biology", "broad", "common", "current", "design", "development", "engineering", "field", "fields", "growth", "health", "industry", "integrates", "interdisciplinary", "maintenance", "making", "management", "monitoring".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
biologicalbiologychangescriticaldevelopmentengineeringfieldloadslowermajormechanismsmovementphysicalregulationrolesciencestructurework
SHARED TOKENS (18): "biological", "biology", "changes", "critical", "development", "engineering", "field", "loads", "lower", "major", "mechanisms", "movement", "physical", "regulation", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
actartificialassociatedcomplexcontrolsdesigndiscoveryengineeringestablishedfederalfieldgeneralgovernmentsincreaselaterlifemajormarketmodernoversight
SHARED TOKENS (28): "act", "artificial", "associated", "complex", "controls", "design", "discovery", "engineering", "established", "federal", "field", "general", "governments", "increase", "later", "life", "major", "market", "modern", "oversight".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
Pathology ↗ Q7208 EXACT TITLE
analysisbiologychangescommoncomponentsconditionsdevelopmentdifferentdistinctfieldfieldsgeneralmajormechanismsmodernphysicalpracticepracticesprocessesresearch
SHARED TOKENS (24): "analysis", "biology", "changes", "common", "components", "conditions", "development", "different", "distinct", "field", "fields", "general", "major", "mechanisms", "modern", "physical", "practice", "practices", "processes", "research".... | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
Bluegill ↗ Q1148148 EXACT TITLE
amonganothercommonlydependingecosystemfacefoundinsidemovepopulationrolesidesmallstreamswater
SHARED TOKENS (15): "among", "another", "commonly", "depending", "ecosystem", "face", "found", "inside", "move", "population", "role", "side", "small", "streams", "water". | EXACT TITLE in rivers_lakes: "Bluegill".
0.500
actaddressbiologicalchangeschemicalcleanconservationcontaminationcontrolcoordinationdirectlydrinkingengineersenvironmentalepafederalformgoverninggovernmentsimplementing
SHARED TOKENS (36): "act", "address", "biological", "changes", "chemical", "clean", "conservation", "contamination", "control", "coordination", "directly", "drinking", "engineers", "environmental", "epa", "federal", "form", "governing", "governments", "implementing".... | EXACT TITLE in rivers_lakes: "Clean Water Act".
0.500
actactivitiesaffectagriculturalanotherapplicationschangecommercialconservationcoverscurrentdemanddevelopmentgovernmentsgrowthincreasedirrigationlocalmakesmanagement
SHARED TOKENS (36): "act", "activities", "affect", "agricultural", "another", "applications", "change", "commercial", "conservation", "covers", "current", "demand", "development", "governments", "growth", "increased", "irrigation", "local", "makes", "management".... | EXACT TITLE in rivers_lakes: "Water conservation".
0.500
Levee ↗ Q105190 EXACT TITLE
adjacentagainstalongsideartificialbuiltcapacitydesignedfollowingformfoundlevelsmajorresultriversidetypevalleywater
SHARED TOKENS (18): "adjacent", "against", "alongside", "artificial", "built", "capacity", "designed", "following", "form", "found", "levels", "major", "result", "river", "side", "type", "valley", "water". | EXACT TITLE in rivers_lakes: "Levee".
0.500
actadministrationagainstavailabilitybeginningconstructioncontrolcostscovereddesigneddevelopmentenforcementfederalgenerallygovernmentinsurancelandmakingmanagementmillion
SHARED TOKENS (33): "act", "administration", "against", "availability", "beginning", "construction", "control", "costs", "covered", "designed", "development", "enforcement", "federal", "generally", "government", "insurance", "land", "making", "management", "million".... | EXACT TITLE in rivers_lakes: "National Flood Insurance Program".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
accumulationagricultureannualchangeconditionsdifferentdrinkingformationphysicalplantprovideremoteresourcescientistsstreamsstudywater
SHARED TOKENS (17): "accumulation", "agriculture", "annual", "change", "conditions", "different", "drinking", "formation", "physical", "plant", "provide", "remote", "resource", "scientists", "streams", "study", "water". | EXACT TITLE in rivers_lakes: "Snowpack".
0.500
accumulationactivityaddsadjacentbasinbodychangescreatesdevelopmentdifferenteconomicevenformformationfoundhistoryhundredsidentifiedincreasinglarge
SHARED TOKENS (34): "accumulation", "activity", "adds", "adjacent", "basin", "body", "changes", "creates", "development", "different", "economic", "even", "form", "formation", "found", "history", "hundreds", "identified", "increasing", "large".... | EXACT TITLE in rivers_lakes: "Sedimentary basin".
0.500
advancedanalysisappliedbiologycapabilitieschangeschemicalcommoncomponentsdevelopmentdifferentdivisionengineeringevaluationfieldformgenerallyhealthidentifyinterdisciplinary
SHARED TOKENS (38): "advanced", "analysis", "applied", "biology", "capabilities", "changes", "chemical", "common", "components", "development", "different", "division", "engineering", "evaluation", "field", "form", "generally", "health", "identify", "interdisciplinary".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
activitiesanalysisapplicationsautomationcommercialcommondatadegreedevelopmentdifferentengineersfieldgenerallygovernmentgraduateimprovedincreaseinstitutelaboratoryprocedures
SHARED TOKENS (35): "activities", "analysis", "applications", "automation", "commercial", "common", "data", "degree", "development", "different", "engineers", "field", "generally", "government", "graduate", "improved", "increase", "institute", "laboratory", "procedures".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagriculturealteredappliesartificialcentralchangeschemicalscollectioncommonconditionsconsolidationcontroldevelopeddirectlydischargedistributeddistributioneffectsenvironmental
SHARED TOKENS (54): "agricultural", "agriculture", "altered", "applies", "artificial", "central", "changes", "chemicals", "collection", "common", "conditions", "consolidation", "control", "developed", "directly", "discharge", "distributed", "distribution", "effects", "environmental".... | EXACT TITLE in rivers_lakes: "Irrigation". | EXACT TITLE in biotech_life_sciences: "Irrigation".
0.500
Canal ↗ Q12284 EXACT TITLE
artificialbasinbuildingbuiltcertainchannelscontrolcreatecurrentdischargesengineeredflowgenerallyincreaseirrigationlevelslinearmanagementmodernrequiring
SHARED TOKENS (27): "artificial", "basin", "building", "built", "certain", "channels", "control", "create", "current", "discharges", "engineered", "flow", "generally", "increase", "irrigation", "levels", "linear", "management", "modern", "requiring".... | EXACT TITLE in rivers_lakes: "Canal".
0.500
basinboisecanyoncoveringformationidahoidentifiedlifemillionnearperiodsriversourcesystemwestern
SHARED TOKENS (15): "basin", "boise", "canyon", "covering", "formation", "idaho", "identified", "life", "million", "near", "periods", "river", "source", "system", "western". | EXACT TITLE in rivers_lakes: "Lake Idaho".
0.500
agenciesbuiltcomponentsconstructiondepartmentsdesignengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicsystems
SHARED TOKENS (21): "agencies", "built", "components", "construction", "departments", "design", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public", "systems".... | EXACT TITLE in rivers_lakes: "Civil engineering".
0.500
actagricultureapproximatelybeginningboardboisebureaucapacitycenterconstructiondesignhomeidahoincreasedirrigationlaborlawmaterialsmilesnational
SHARED TOKENS (34): "act", "agriculture", "approximately", "beginning", "board", "boise", "bureau", "capacity", "center", "construction", "design", "home", "idaho", "increased", "irrigation", "labor", "law", "materials", "miles", "national".... | EXACT TITLE in rivers_lakes: "Anderson Ranch Dam".
0.500
cannotconnectdesigndesignedevenflowinfrastructureinsidelargemunicipalparkingpropertypublicreducesrequireresidentialrisksewersmallstormwater
SHARED TOKENS (24): "cannot", "connect", "design", "designed", "even", "flow", "infrastructure", "inside", "large", "municipal", "parking", "property", "public", "reduces", "require", "residential", "risk", "sewer", "small", "stormwater".... | EXACT TITLE in rivers_lakes: "Storm drain".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureappliedassociatedbecomebiologicalbiologychemicalcontroldevelopeddistinctdividedeffectsenergyengineeringenvironmentfieldsfunctionfunctionshealthindustrial
SHARED TOKENS (36): "agriculture", "applied", "associated", "become", "biological", "biology", "chemical", "control", "developed", "distinct", "divided", "effects", "energy", "engineering", "environment", "fields", "function", "functions", "health", "industrial".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
actadministrationassociatedauthoritycontrolcurrentdepartmentdirectlyemployeesfederalfieldhealthlaboratoryproductsprotectingpublicregulatedrelatedreportsresponsible
SHARED TOKENS (24): "act", "administration", "associated", "authority", "control", "current", "department", "directly", "employees", "federal", "field", "health", "laboratory", "products", "protecting", "public", "regulated", "related", "reports", "responsible".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
appliedassociatedcapacitycapitalcostsdirectlydivideddocumentearlyformgrowthinformationinstitutionallegallistedmarketpoolprivateprocessproposed
SHARED TOKENS (28): "applied", "associated", "capacity", "capital", "costs", "directly", "divided", "document", "early", "form", "growth", "information", "institutional", "legal", "listed", "market", "pool", "private", "process", "proposed".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
administrationboisebureaucanyoncapacitycreatesidahoinventoryirrigationmilesnationalownedprojectriversidestructurewater
SHARED TOKENS (17): "administration", "boise", "bureau", "canyon", "capacity", "creates", "idaho", "inventory", "irrigation", "miles", "national", "owned", "project", "river", "side", "structure", "water". | EXACT TITLE in rivers_lakes: "Black Canyon Diversion Dam".
0.500
agriculturecapitalchemicalscommercialcostsdependdifferentdrinkingenergyinstitutionalirrigationlargepersonnelpolicypopulationspracticepublicpurposesqualityregulation
SHARED TOKENS (30): "agriculture", "capital", "chemicals", "commercial", "costs", "depend", "different", "drinking", "energy", "institutional", "irrigation", "large", "personnel", "policy", "populations", "practice", "public", "purposes", "quality", "regulation".... | EXACT TITLE in rivers_lakes: "Water supply". | EXACT TITLE in biotech_life_sciences: "Water supply".
0.500
centercentralcertificationcriticaldegreesdoctoraleducationfacultyinstitutionsknowledgelifemissionprivateproductionpublicratherresearchscientificsitesstudents
SHARED TOKENS (25): "center", "central", "certification", "critical", "degrees", "doctoral", "education", "faculty", "institutions", "knowledge", "life", "mission", "private", "production", "public", "rather", "research", "scientific", "sites", "students".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.480
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommonlydrinkingindustrialmunicipalprocessessewerwastewastewaterwater
SHARED TOKENS (14): "activities", "agricultural", "another", "applications", "commercial", "commonly", "drinking", "industrial", "municipal", "processes", "sewer", "waste", "wastewater", "water". | EXACT TITLE in rivers_lakes: "Wastewater". | EXACT TITLE in biotech_life_sciences: "Wastewater".
0.480
Suez ↗ Q134514 EXACT TITLE
capitalcenterconnectfacilitiesfirmsformindustrialmajormetropolitanmodernnearplantrepresentedsmall
SHARED TOKENS (14): "capital", "center", "connect", "facilities", "firms", "form", "industrial", "major", "metropolitan", "modern", "near", "plant", "represented", "small". | EXACT TITLE in rivers_lakes: "Suez".
0.480
activityamongcampusclassifieddoctoralidahomeridianpercentprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (14): "activity", "among", "campus", "classified", "doctoral", "idaho", "meridian", "percent", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in rivers_lakes: "Idaho State University". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
0.480
Veolia ↗ Q1632461 EXACT TITLE
activitiesboardemployeesenergyenvironmentenvironmentalfollowingmajormanagementoperationspublicsinglewastewater
SHARED TOKENS (14): "activities", "board", "employees", "energy", "environment", "environmental", "following", "major", "management", "operations", "public", "single", "waste", "water". | EXACT TITLE in rivers_lakes: "Veolia".
0.460
councildepartmentdevelopmenteconomicfacilitygovernedlightmetropolitanmunicipaloperatepartspublictechnology
SHARED TOKENS (13): "council", "department", "development", "economic", "facility", "governed", "light", "metropolitan", "municipal", "operate", "parts", "public", "technology". | EXACT TITLE in rivers_lakes: "Seattle City Light".
0.450
approvedbodyboisebuildingcommonlyconstructionidahoisolatedmilesnationalpoolriversitesubstantialvalleywaterwestern
SHARED TOKENS (17): "approved", "body", "boise", "building", "commonly", "construction", "idaho", "isolated", "miles", "national", "pool", "river", "site", "substantial", "valley", "water", "western". | URL->A (1): http://www.usbr.gov/pn/hydromet/boipaytea.html.
0.440
accessanotherestateevenlegallightpropertyrightssimilarlytitleviewwater
SHARED TOKENS (12): "access", "another", "estate", "even", "legal", "light", "property", "rights", "similarly", "title", "view", "water". | EXACT TITLE in rivers_lakes: "Beneficial use".
0.440
actbodycleanenvironmentalidentifieslawplanqualityregulatorystandardswaterwaters
SHARED TOKENS (12): "act", "body", "clean", "environmental", "identifies", "law", "plan", "quality", "regulatory", "standards", "water", "waters". | EXACT TITLE in rivers_lakes: "Total maximum daily load".
0.440
activeassociatedcommonlyenergylargemovementrapidrepresentsresultsignificantsinglevolume
SHARED TOKENS (12): "active", "associated", "commonly", "energy", "large", "movement", "rapid", "represents", "result", "significant", "single", "volume". | EXACT TITLE in rivers_lakes: "Fault (geology)".
0.440
differentgenerallyirrigationlawlegalphysicalriversourcesystemsuseruserswater
SHARED TOKENS (12): "different", "generally", "irrigation", "law", "legal", "physical", "river", "source", "systems", "user", "users", "water". | EXACT TITLE in rivers_lakes: "Water right". | EXACT TITLE in biotech_life_sciences: "Water right".
0.440
channelscommonlyflowformfragmentedgenerallylargereachresultsoilvalleywater
SHARED TOKENS (12): "channels", "commonly", "flow", "form", "fragmented", "generally", "large", "reach", "result", "soil", "valley", "water". | EXACT TITLE in rivers_lakes: "Debris flow".
0.440
agriculturalirrigationlocalmanagementmeasurementmovementprocessesresourcerolesoilsurfaceswater
SHARED TOKENS (12): "agricultural", "irrigation", "local", "management", "measurement", "movement", "processes", "resource", "role", "soil", "surfaces", "water". | EXACT TITLE in rivers_lakes: "Evapotranspiration".
0.430
govgovernmenthealthnational
SHARED TOKENS (4): "gov", "government", "health", "national". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.400
analysisappliedbiologicalbiologydatafieldmodelingrelationshipssciencesystems
SHARED TOKENS (10): "analysis", "applied", "biological", "biology", "data", "field", "modeling", "relationships", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.400
Hazardous waste ↗ EXACT TITLE
commonenvironmenthealthlocalmaterialsmillionnationalproducesregulatedwaste
SHARED TOKENS (10): "common", "environment", "health", "local", "materials", "million", "national", "produces", "regulated", "waste". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.400
anotherestablishedflowformationinfluenceprocessrapidresultriverupstream
SHARED TOKENS (10): "another", "established", "flow", "formation", "influence", "process", "rapid", "result", "river", "upstream". | EXACT TITLE in rivers_lakes: "Avulsion (river)".
0.400
Seepage ↗ Q125392015 EXACT TITLE
accordingconditionsconsolidationincreasinglevelsmovementprocesssoiltypewater
SHARED TOKENS (10): "according", "conditions", "consolidation", "increasing", "levels", "movement", "process", "soil", "type", "water". | EXACT TITLE in rivers_lakes: "Seepage".
0.400
amongbecomecentraldescribedlargeregionalreportsscientificstreamsstudy
SHARED TOKENS (10): "among", "become", "central", "described", "large", "regional", "reports", "scientific", "streams", "study". | EXACT TITLE in rivers_lakes: "Largemouth bass".
0.400
departmentdevelopmenteconomicidahoinsurancelaborprocessesresponsibletechnologyworkforce
SHARED TOKENS (10): "department", "development", "economic", "idaho", "insurance", "labor", "processes", "responsible", "technology", "workforce". | EXACT TITLE in rivers_lakes: "Idaho Department of Labor". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.400
agriculturaldevelopeddifferentengineeringgrowthpossessproductssciencescientifictools
SHARED TOKENS (10): "agricultural", "developed", "different", "engineering", "growth", "possess", "products", "science", "scientific", "tools". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.400
artificialcommonencompassesentersenvironmentalplantprocessprocessessoilwater
SHARED TOKENS (10): "artificial", "common", "encompasses", "enters", "environmental", "plant", "process", "processes", "soil", "water". | EXACT TITLE in rivers_lakes: "Groundwater recharge".
0.400
agriculturecriticalhealthinfrastructurematerialproductssupplysystemstransportationwater
SHARED TOKENS (10): "agriculture", "critical", "health", "infrastructure", "material", "products", "supply", "systems", "transportation", "water". | EXACT TITLE in rivers_lakes: "Volcanic ash".
0.400
Histology ↗ Q7168 EXACT TITLE
biologicalbiologydividedfieldhistoricallymodernplacesstudiesstudyvisible
SHARED TOKENS (10): "biological", "biology", "divided", "field", "historically", "modern", "places", "studies", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.380
associationassociationscentersfirmsindustrialindustryorganizationrelatedresearch
SHARED TOKENS (9): "association", "associations", "centers", "firms", "industrial", "industry", "organization", "related", "research". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.380
Basalt ↗ Q43338 EXACT TITLE
chemicalcommonhundredsnearprocessesrapidresultingsystemtype
SHARED TOKENS (9): "chemical", "common", "hundreds", "near", "processes", "rapid", "resulting", "system", "type". | EXACT TITLE in rivers_lakes: "Basalt".
0.380
biologicaldifferentfacilityinformationlaboratorymaterialmaterialsresearchstudies
SHARED TOKENS (9): "biological", "different", "facility", "information", "laboratory", "material", "materials", "research", "studies". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.380
affectconditionseconomicenvironmentalmanagementpathogensplantscientificstudy
SHARED TOKENS (9): "affect", "conditions", "economic", "environmental", "management", "pathogens", "plant", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.360
Snowmelt ↗ Q1754697 EXACT TITLE
annualbasinconditionscontrolpartsprojectsrapidwater
SHARED TOKENS (8): "annual", "basin", "conditions", "control", "parts", "projects", "rapid", "water". | EXACT TITLE in rivers_lakes: "Snowmelt".
0.360
actchaptercodefederalhealthlawpublictitle
SHARED TOKENS (8): "act", "chapter", "code", "federal", "health", "law", "public", "title". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.360
Bull trout ↗ Q2429513 EXACT TITLE
acthistoricallylistedlowerpopulationpopulationsriskseparate
SHARED TOKENS (8): "act", "historically", "listed", "lower", "population", "populations", "risk", "separate". | EXACT TITLE in rivers_lakes: "Bull trout".
0.360
chemicalindustriallayerplacessoilwastewastewaterwater
SHARED TOKENS (8): "chemical", "industrial", "layer", "places", "soil", "waste", "wastewater", "water". | EXACT TITLE in rivers_lakes: "Injection well".
0.350
federalgovernmenthealthinstitutemillionnationalrelatedreportstechnicalworks
SHARED TOKENS (10): "federal", "government", "health", "institute", "million", "national", "related", "reports", "technical", "works". | URL->B (1): http://clinicaltrials.gov/.
0.340
Reservoir ↗ Q131681 EXACT TITLE
bodybuildingbuiltformspacestoragewater
SHARED TOKENS (7): "body", "building", "built", "form", "space", "storage", "water". | EXACT TITLE in rivers_lakes: "Reservoir". | EXACT TITLE in biotech_life_sciences: "Reservoir".
0.340
bridgecommonmajornearresultstructurewater
SHARED TOKENS (7): "bridge", "common", "major", "near", "result", "structure", "water". | EXACT TITLE in rivers_lakes: "Bridge scour".
0.340
Forage ↗ Q13377214 EXACT TITLE
annualbroaddefinedirectlyhistoricallymaterialplant
SHARED TOKENS (7): "annual", "broad", "define", "directly", "historically", "material", "plant". | EXACT TITLE in biotech_life_sciences: "Forage".
0.340
actconservationfederalgoverninglawresourcewaste
SHARED TOKENS (7): "act", "conservation", "federal", "governing", "law", "resource", "waste". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.340
approximatelybasincommonriversystemtypevalley
SHARED TOKENS (7): "approximately", "basin", "common", "river", "system", "type", "valley". | EXACT TITLE in rivers_lakes: "Smallmouth bass".
0.340
biologicalevenfunctionoperatesstructurestudysystems
SHARED TOKENS (7): "biological", "even", "function", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.320
administrationcannotdemandfieldformprovide
SHARED TOKENS (6): "administration", "cannot", "demand", "field", "form", "provide". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.320
Phlebotomy ↗ Q3595842 EXACT TITLE
makingprocesspurposetechnicianstreatmentvolume
SHARED TOKENS (6): "making", "process", "purpose", "technicians", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.320
adaboiseconstructionextendingidahoriver
SHARED TOKENS (6): "ada", "boise", "construction", "extending", "idaho", "river". | EXACT TITLE in rivers_lakes: "Lucky Peak Lake".
0.320
departmentnationalprotectedpublicsystemwaters
SHARED TOKENS (6): "department", "national", "protected", "public", "system", "waters". | EXACT TITLE in rivers_lakes: "National Wildlife Refuge".
0.300
Serology ↗ Q502159 EXACT TITLE
againstbodyresponsescientificstudy
SHARED TOKENS (5): "against", "body", "response", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.300
Algal bloom ↗ Q326139 KW CROSS HIGH
accumulationbacterialcommonlydependingecosystemeffectsencompassesenteringfollowinggrowthincreaselevelslifepopulationprocessrapidreachingresidentsresultrole
SHARED TOKENS (24): "accumulation", "bacterial", "commonly", "depending", "ecosystem", "effects", "encompasses", "entering", "following", "growth", "increase", "levels", "life", "population", "process", "rapid", "reaching", "residents", "result", "role"....
0.300
analysisappliedbeyondcommercialcomponentcomponentsdatadevelopmentdifferentenvironmentalevenfacilitiesfunctionsgenerallyhistoricallyimplementationinformationinfrastructurelaboratorymanagement
SHARED TOKENS (39): "analysis", "applied", "beyond", "commercial", "component", "components", "data", "development", "different", "environmental", "even", "facilities", "functions", "generally", "historically", "implementation", "information", "infrastructure", "laboratory", "management"....
0.300
accordingagriculturalagriculturebacterialbeginningcontroldevelopeddirectearlyenvironmentalexpansionfarmsgeneralgenerallygrowthhealthhistoryimprovedincreaseindustry
SHARED TOKENS (32): "according", "agricultural", "agriculture", "bacterial", "beginning", "control", "developed", "direct", "early", "environmental", "expansion", "farms", "general", "generally", "growth", "health", "history", "improved", "increase", "industry"....
0.300
appliedcapitalcenterscorporatedevelopmentemploymentgovernmentinstitutionslocalplacesplannersprivatepublicrelatedresearchresultsupportingtechnologyuniversitiesvalley
SHARED TOKENS (20): "applied", "capital", "centers", "corporate", "development", "employment", "government", "institutions", "local", "places", "planners", "private", "public", "related", "research", "result", "supporting", "technology", "universities", "valley".
0.300
activitiesanotherappliedappliesauthorityauthorizedboardcapacityconditionsdecisionsdefinitionsevidencefollowingformgenerallyindividualinformationinstitutionallawlegal
SHARED TOKENS (42): "activities", "another", "applied", "applies", "authority", "authorized", "board", "capacity", "conditions", "decisions", "definitions", "evidence", "following", "form", "generally", "individual", "information", "institutional", "law", "legal"....
0.300
actadministrationapprovalapprovedboardcertaincommercialcontroldatademonstratedesigndistributionestablishmentevaluationinformationinstitutionalinvestigationknowledgelegallymonitoring
SHARED TOKENS (42): "act", "administration", "approval", "approved", "board", "certain", "commercial", "control", "data", "demonstrate", "design", "distribution", "establishment", "evaluation", "information", "institutional", "investigation", "knowledge", "legally", "monitoring"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysisbodycoversdistinctfieldformationfunctionsgenerallyinterdisciplinarylargerequirementsscalescopesinglestructurestudysystem
SHARED TOKENS (18): "activity", "analysis", "body", "covers", "distinct", "field", "formation", "functions", "generally", "interdisciplinary", "large", "requirements", "scale", "scope", "single", "structure", "study", "system".
0.300
biologicalcertainchemicalcurrentlydifferentenvironmentenvironmentalforminteractionpathwaysrelationshiprelationshipsscientistsstudythem
SHARED TOKENS (15): "biological", "certain", "chemical", "currently", "different", "environment", "environmental", "form", "interaction", "pathways", "relationship", "relationships", "scientists", "study", "them".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsideapplicationsbiologicalbiologybodybroadcapabilitieschemicalchemicalsclassifieddesigndeterminediscoverydistributioneffectsencompassesfieldfunctionfunctionshealth
SHARED TOKENS (29): "alongside", "applications", "biological", "biology", "body", "broad", "capabilities", "chemical", "chemicals", "classified", "design", "determine", "discovery", "distribution", "effects", "encompasses", "field", "function", "functions", "health"....
0.300
activitiesaffectcategoriesdesignatedenvironmentalestablishedexposurehealthmillionmultipleprecipitationqualityresultriskstandardstype
SHARED TOKENS (16): "activities", "affect", "categories", "designated", "environmental", "established", "exposure", "health", "million", "multiple", "precipitation", "quality", "result", "risk", "standards", "type".
0.300
formriversignificantsoilwater
SHARED TOKENS (5): "form", "river", "significant", "soil", "water". | EXACT TITLE in rivers_lakes: "Bank erosion".
0.300
activitiesadvancedagriculturalagriculturecostsdirectdistributiondrinkingeffectsenvironmentalfieldsfollowingincreasingindustrialindustryirrigationmanagementmunicipalpathogensplanned
SHARED TOKENS (40): "activities", "advanced", "agricultural", "agriculture", "costs", "direct", "distribution", "drinking", "effects", "environmental", "fields", "following", "increasing", "industrial", "industry", "irrigation", "management", "municipal", "pathogens", "planned"....
0.300
actagenciesauthoritycodeconservationdependdescribeddesigneddevelopmentdifferenteconomicfederalgrowthguidelineslawlistedmeansmechanismsnationalpoint
SHARED TOKENS (27): "act", "agencies", "authority", "code", "conservation", "depend", "described", "designed", "development", "different", "economic", "federal", "growth", "guidelines", "law", "listed", "means", "mechanisms", "national", "point"....
0.300
componentexplainsfieldfollowinghistoryidentifyinformationmajorpatternsphysicalpointpossibleproceduresprocessprofessionalstatisticsstudyview
SHARED TOKENS (18): "component", "explains", "field", "following", "history", "identify", "information", "major", "patterns", "physical", "point", "possible", "procedures", "process", "professional", "statistics", "study", "view".
0.300
biologychemicalcomplexconcentrationeffectsenergyinfluencemodelplacesreferencerelationshipsrepresentsresponsestudytools
SHARED TOKENS (15): "biology", "chemical", "complex", "concentration", "effects", "energy", "influence", "model", "places", "reference", "relationships", "represents", "response", "study", "tools".
0.300
applicationsdetermineengineeringenvironmentalfieldsflowgeneralinfluenceknowledgemovemovementsurfacessystemstransportwater
SHARED TOKENS (15): "applications", "determine", "engineering", "environmental", "fields", "flow", "general", "influence", "knowledge", "move", "movement", "surfaces", "systems", "transport", "water".
0.300
alreadyanotherapplicationsassociatedbecomebiologicalbiologychangechemicalconditionscreatecurrentdevelopingdevelopmentfieldsfoundmajoropportunitiesphasephysical
SHARED TOKENS (32): "already", "another", "applications", "associated", "become", "biological", "biology", "change", "chemical", "conditions", "create", "current", "developing", "development", "fields", "found", "major", "opportunities", "phase", "physical"....
0.300
affectapplicationsconditionscontrolcoveringdependingdifferenthealthmaintainmanagementmonitoringpreventionprofessionalresearchsafetysciencescientistsscopespecializedsupply
SHARED TOKENS (24): "affect", "applications", "conditions", "control", "covering", "depending", "different", "health", "maintain", "management", "monitoring", "prevention", "professional", "research", "safety", "science", "scientists", "scope", "specialized", "supply"....
0.300
Catfish ↗ Q59576 EXACT TITLE
behaviorcommercialhistoricallyregionregional
SHARED TOKENS (5): "behavior", "commercial", "historically", "region", "regional". | EXACT TITLE in rivers_lakes: "Catfish".
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
accumulationagriculturebacterialbodychemicalscontrolsdevelopmentenvironmentenvironmentalgeneralgrowthincreasedindustrialpointpreventionprocessprogramreduceresultresulting
SHARED TOKENS (25): "accumulation", "agriculture", "bacterial", "body", "chemicals", "controls", "development", "environment", "environmental", "general", "growth", "increased", "industrial", "point", "prevention", "process", "program", "reduce", "result", "resulting"....
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
agenciesagriculturalapplicationsassociationsbiologicalbreedingcenterscomplexconditionscreatecurrentlydeterminedevelopingdevelopmentdifferentgovernmentimproveindustryinstitutionsknowledge
SHARED TOKENS (35): "agencies", "agricultural", "applications", "associations", "biological", "breeding", "centers", "complex", "conditions", "create", "currently", "determine", "developing", "development", "different", "government", "improve", "industry", "institutions", "knowledge"....
0.300
actapplicableappliedassessmentassociationauthoritybehaviorbestcentralchangechangesconditionsconflictsconservationcostsdependdesigndevelopmentdistrictseconomic
SHARED TOKENS (48): "act", "applicable", "applied", "assessment", "association", "authority", "behavior", "best", "central", "change", "changes", "conditions", "conflicts", "conservation", "costs", "depend", "design", "development", "districts", "economic"....
0.300
applicationsappliedartificialassociatedbiologicalbroadcertaindefinitionsdifferentengineeringfieldformationfunctionsimprovemaintainmaterialsportionspracticepurposerequire
SHARED TOKENS (24): "applications", "applied", "artificial", "associated", "biological", "broad", "certain", "definitions", "different", "engineering", "field", "formation", "functions", "improve", "maintain", "materials", "portions", "practice", "purpose", "require"....
0.300
Climate change ↗ Q125928 KW CROSS HIGH
activitiesagriculturalalreadybecomechangechangescommoncontroleconomiceffectsenergyenvironmentenvironmentalevenhealthincreaseincreasedincreasingindustriallarge
SHARED TOKENS (40): "activities", "agricultural", "already", "become", "change", "changes", "common", "control", "economic", "effects", "energy", "environment", "environmental", "even", "health", "increase", "increased", "increasing", "industrial", "large"....
0.300
accessactivitiesadministrationassociationcapacitycenterschangesconductscontroldepartmentdesigneddevelopingenvironmentalfederalgovernmenthealthimproveinformationinstituteinstitutional
SHARED TOKENS (39): "access", "activities", "administration", "association", "capacity", "centers", "changes", "conducts", "control", "department", "designed", "developing", "environmental", "federal", "government", "health", "improve", "information", "institute", "institutional"....
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
artificialbodycommonlyconditionscontainingdevelopmentenvironmentessentialformgenerallygrowthhistoricalisolatedlaboratorymaintainedoutsideplantpopulationpracticeprocess
SHARED TOKENS (27): "artificial", "body", "commonly", "conditions", "containing", "development", "environment", "essential", "form", "generally", "growth", "historical", "isolated", "laboratory", "maintained", "outside", "plant", "population", "practice", "process"....
0.300
activityamongapproximatelyassociationboisebureaucanyoncapacitycenterconservationcontainscreatesdirectlyedgefederalformationidaholocallowermiles
SHARED TOKENS (34): "activity", "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "conservation", "contains", "creates", "directly", "edge", "federal", "formation", "idaho", "local", "lower", "miles"....
0.300
accessagenciesannualapplicationsapproximatelyartificialcapitalcovereddevelopeddevelopmentdevelopsdiscoverydistinctdocumentededucationeffectsessentialevaluationexpansionfield
SHARED TOKENS (48): "access", "agencies", "annual", "applications", "approximately", "artificial", "capital", "covered", "developed", "development", "develops", "discovery", "distinct", "documented", "education", "effects", "essential", "evaluation", "expansion", "field"....
0.300
affectagenciesdistributionenvironmentalfunctionsimplementinglandmanagementplanningplantprocessprogramsprojectsqualityresourcesrightsspecialistsstormwaterstudysupply
SHARED TOKENS (23): "affect", "agencies", "distribution", "environmental", "functions", "implementing", "land", "management", "planning", "plant", "process", "programs", "projects", "quality", "resources", "rights", "specialists", "stormwater", "study", "supply"....
0.300
accordingadministrationannualapprovalbiologicalcenterchangescomplianceentityestablishmentevaluationeventsfacilitiesforminformationlegalphaseproductsregulatedreports
SHARED TOKENS (26): "according", "administration", "annual", "approval", "biological", "center", "changes", "compliance", "entity", "establishment", "evaluation", "events", "facilities", "form", "information", "legal", "phase", "products", "regulated", "reports"....
0.300
accessadministrationassetbuildingdepartmentdevelopmentfederalfieldsgovernmentgovernmentsinfrastructurelocalmajormanagementpersonnelplanpropertyprovidepurposerequirement
SHARED TOKENS (27): "access", "administration", "asset", "building", "department", "development", "federal", "fields", "government", "governments", "infrastructure", "local", "major", "management", "personnel", "plan", "property", "provide", "purpose", "requirement"....
0.300
addresscategoriescurrentdevelopedeconomiceconomyencompassesfinanceformhealthindustryinterdisciplinarypercentproductsreachingrequirementssystem
SHARED TOKENS (17): "address", "categories", "current", "developed", "economic", "economy", "encompasses", "finance", "form", "health", "industry", "interdisciplinary", "percent", "products", "reaching", "requirements", "system".
0.300
acquisitionactactivityanotherassetscapitalcentralcertainconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityfederalgovernedgovernment
SHARED TOKENS (40): "acquisition", "act", "activity", "another", "assets", "capital", "central", "certain", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "federal", "governed", "government"....
0.300
Owyhee River ↗ Q2042749 KW CROSS HIGH
annualbasincentraldischargeflowgenerallyidahomajormilesnearplacesregionremoteriverwestern
SHARED TOKENS (15): "annual", "basin", "central", "discharge", "flow", "generally", "idaho", "major", "miles", "near", "places", "region", "remote", "river", "western".
0.300
adjacentaffectagriculturalagriculturealteredbiologicalchangeconnectconservationconstructioncontaminationcontrolcriticalecosystememphasizesengineeredengineeringenteringenvironmentaleven
SHARED TOKENS (53): "adjacent", "affect", "agricultural", "agriculture", "altered", "biological", "change", "connect", "conservation", "construction", "contamination", "control", "critical", "ecosystem", "emphasizes", "engineered", "engineering", "entering", "environmental", "even"....
0.300
Water cycle ↗ Q81041 KW CROSS HIGH
activitiesaffectaffectingagricultureanotheravailabilitychangechangeschemicalcriticaldifferentenergyessentialeventsflowformincreasedlandlifemaintenance
SHARED TOKENS (37): "activities", "affect", "affecting", "agriculture", "another", "availability", "change", "changes", "chemical", "critical", "different", "energy", "essential", "events", "flow", "form", "increased", "land", "life", "maintenance"....
0.300
activeagainstapprovalbecomebiologicalchemicalcommercialcommoncomplexdevelopeddevelopmentdiscoveryeffectsentityfieldsgovernmentshealthhistoricallyidentifiedidentify
SHARED TOKENS (46): "active", "against", "approval", "become", "biological", "chemical", "commercial", "common", "complex", "developed", "development", "discovery", "effects", "entity", "fields", "governments", "health", "historically", "identified", "identify"....
0.300
activitiesappearsassociatedbiologicalbodycapablechemicalchemicalscommoncontainingdescribeddetaileddiffersdistinctenvironmentenvironmentalfacilitiesgeneralhealthhome
SHARED TOKENS (34): "activities", "appears", "associated", "biological", "body", "capable", "chemical", "chemicals", "common", "containing", "described", "detailed", "differs", "distinct", "environment", "environmental", "facilities", "general", "health", "home"....
0.300
broadcategorieschangechangesconditionsdevelopmentdifferentdividedeffectsengineeredenvironmentalhealthimprovemanagementmonitoringpartsphysicalprocessesprojectsremains
SHARED TOKENS (29): "broad", "categories", "change", "changes", "conditions", "development", "different", "divided", "effects", "engineered", "environmental", "health", "improve", "management", "monitoring", "parts", "physical", "processes", "projects", "remains"....
0.300
accessbiologicalcenterscontrolestablishedfacilitiesfacilityhealthlaboratorylevelsmultiplepersonnelpreventionproceduresprotectionpublicationreportsspecifiedsystemstraining
SHARED TOKENS (20): "access", "biological", "centers", "control", "established", "facilities", "facility", "health", "laboratory", "levels", "multiple", "personnel", "prevention", "procedures", "protection", "publication", "reports", "specified", "systems", "training".
0.300
affectingamongcapacitycleancomplexconstructiondemanddirectenergyenvironmentalincreasedlandlargemakingpatternspopulationproducesprovideregionremains
SHARED TOKENS (30): "affecting", "among", "capacity", "clean", "complex", "construction", "demand", "direct", "energy", "environmental", "increased", "land", "large", "making", "patterns", "population", "produces", "provide", "region", "remains"....
0.300
federallaboratoryregulatoryresearchstandards
SHARED TOKENS (5): "federal", "laboratory", "regulatory", "research", "standards". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.300
activitiesartificialcommercialcommonconservationevenformgenerallylargeoccupationalpracticespurposestoolsuseswater
SHARED TOKENS (15): "activities", "artificial", "commercial", "common", "conservation", "even", "form", "generally", "large", "occupational", "practices", "purposes", "tools", "uses", "water".
0.300
applicationscodedesigndetaileddevelopingengineeringevenfieldsfoundfunctiongeneralimproveindustrialknowledgemarketprocessproductionresearchresearchersstructure
SHARED TOKENS (21): "applications", "code", "design", "detailed", "developing", "engineering", "even", "fields", "found", "function", "general", "improve", "industrial", "knowledge", "market", "process", "production", "research", "researchers", "structure"....
0.300
advancedapproximatelyavailabilitybiologicalcentralizedconnectedconstructioncontainscostsdemanddesigndevelopeddevelopingdifferentdischargedischargesenergyengineersenvironmenteven
SHARED TOKENS (48): "advanced", "approximately", "availability", "biological", "centralized", "connected", "construction", "contains", "costs", "demand", "design", "developed", "developing", "different", "discharge", "discharges", "energy", "engineers", "environment", "even"....
0.300
administersagriculturalagricultureapproximatelycommercialcomponentcurrentdepartmentdirectlyfederalgovernmentnationalproductionprogramprogramsreportsresourcessafetyworks
SHARED TOKENS (19): "administers", "agricultural", "agriculture", "approximately", "commercial", "component", "current", "department", "directly", "federal", "government", "national", "production", "program", "programs", "reports", "resources", "safety", "works".
0.300
adjacentbasebasinchangescoveredcreateflowformincreasedlandlowerperiodspointriversystemvolume
SHARED TOKENS (16): "adjacent", "base", "basin", "changes", "covered", "create", "flow", "form", "increased", "land", "lower", "periods", "point", "river", "system", "volume".
0.300
actagenciesauthoritycouncildecisionsdesignedeffectsenvironmentenvironmentalestablishedevaluatefederalfinalgovernmentlawnationalpolicyproposedqualityreports
SHARED TOKENS (27): "act", "agencies", "authority", "council", "decisions", "designed", "effects", "environment", "environmental", "established", "evaluate", "federal", "final", "government", "law", "national", "policy", "proposed", "quality", "reports"....
0.300
accessalreadybestcannotcleancompetingcontrolcostsdifferentenergyentityessentialfederalgovernmentinfrastructureinstitutionlargelocalmaintainsmarket
SHARED TOKENS (40): "access", "already", "best", "cannot", "clean", "competing", "control", "costs", "different", "energy", "entity", "essential", "federal", "government", "infrastructure", "institution", "large", "local", "maintains", "market"....
0.300
actadministersadministrationcenterscertificationcommonlydepartmentfacilitiesfederalfinancinggovgovernmentshealthhomeinsurancelaboratoryoversightprocessprogramprograms
SHARED TOKENS (25): "act", "administers", "administration", "centers", "certification", "commonly", "department", "facilities", "federal", "financing", "gov", "governments", "health", "home", "insurance", "laboratory", "oversight", "process", "program", "programs"....
0.300
Alluvium ↗ Q6185405 EXACT TITLE
againstdescribedsoilsupportedwater
SHARED TOKENS (5): "against", "described", "soil", "supported", "water". | EXACT TITLE in rivers_lakes: "Alluvium".
0.300
biologychemicalcomponentscontainingdatadetectionengineeringflowfunctionhealthlightphysicalpopulationpracticeprocessresearchseparateuses
SHARED TOKENS (18): "biology", "chemical", "components", "containing", "data", "detection", "engineering", "flow", "function", "health", "light", "physical", "population", "practice", "process", "research", "separate", "uses".
0.300
actactiveactivitiesagenciesapproximatelyauthorityauthorizedbuildingcapacitycleancomponentsconstructioncontroldepartmentdesigndirectdirectlyeconomyecosystemenergy
SHARED TOKENS (61): "act", "active", "activities", "agencies", "approximately", "authority", "authorized", "building", "capacity", "clean", "components", "construction", "control", "department", "design", "direct", "directly", "economy", "ecosystem", "energy"....
0.300
analysisapplicationsbecomebroadbuildingchangescommonconstructiondetaileddetectiondevelopeddifferentessentialexposesisolatedjointlylaboratorymonitoringpathogensprocedures
SHARED TOKENS (27): "analysis", "applications", "become", "broad", "building", "changes", "common", "construction", "detailed", "detection", "developed", "different", "essential", "exposes", "isolated", "jointly", "laboratory", "monitoring", "pathogens", "procedures"....
0.300
actadministrationconditionscostsdepartmenteducationeffectsemploymentestablishedfederalhealthlaborlawmissionoccupationaloutreachreduceregulatorysafetystandards
SHARED TOKENS (22): "act", "administration", "conditions", "costs", "department", "education", "effects", "employment", "established", "federal", "health", "labor", "law", "mission", "occupational", "outreach", "reduce", "regulatory", "safety", "standards"....
0.300
agricultureanotherapplicationsbiologycertaincommonhealthinformationlifemajorphysicalqualityscalesciencescientificstudiesstudytype
SHARED TOKENS (18): "agriculture", "another", "applications", "biology", "certain", "common", "health", "information", "life", "major", "physical", "quality", "scale", "science", "scientific", "studies", "study", "type".
0.300
affectagriculturalagriculturecentralchangechangescomponentconcentratedcontaminationdevelopmentdirectdischargedrinkingeconomiceffectsenterenvironmentenvironmentalfieldsfound
SHARED TOKENS (44): "affect", "agricultural", "agriculture", "central", "change", "changes", "component", "concentrated", "contamination", "development", "direct", "discharge", "drinking", "economic", "effects", "enter", "environment", "environmental", "fields", "found"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activecapitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancingfirmsgeneralmanagementoperationalownershipprivateprivate-equityproductsprovidepublic
SHARED TOKENS (24): "active", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financing", "firms", "general", "management", "operational", "ownership", "private", "private-equity", "products", "provide", "public"....
0.300
actassociatedbestbiologicalbreedingchemicalconservationdescribeddescriptioneffectsessentialgrowthimplementinginformationlifemanagementphysicalpurposeregionalscientific
SHARED TOKENS (22): "act", "associated", "best", "biological", "breeding", "chemical", "conservation", "described", "description", "effects", "essential", "growth", "implementing", "information", "life", "management", "physical", "purpose", "regional", "scientific"....
0.300
Biophysics ↗ Q7100 EXACT TITLE
appliesbiologicalinterdisciplinarysciencestudy
SHARED TOKENS (5): "applies", "biological", "interdisciplinary", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.300
biologycentercurrentdatadepartmentfederalgeographygovernmentmajormakesnearorganizationpublicregulatoryresearchresourcesresponsibilitysciencescientificspace
SHARED TOKENS (23): "biology", "center", "current", "data", "department", "federal", "geography", "government", "major", "makes", "near", "organization", "public", "regulatory", "research", "resources", "responsibility", "science", "scientific", "space"....
0.300
Cold chain ↗ KW CROSS HIGH
activitiesagriculturalassociatedchemicalscommondistributeddistributionmaintainmanagementproductionproductsqualityrequiressafetystoragesupplyuseswaste
SHARED TOKENS (18): "activities", "agricultural", "associated", "chemicals", "common", "distributed", "distribution", "maintain", "management", "production", "products", "quality", "requires", "safety", "storage", "supply", "uses", "waste".
0.300
activitiesamonganalysisanotherbehaviorbiologicalbiologycentercomplexcomponentcomponentsconstructioncreatedatadescriptiondetaileddifferenteffectsengineersessential
SHARED TOKENS (54): "activities", "among", "analysis", "another", "behavior", "biological", "biology", "center", "complex", "component", "components", "construction", "create", "data", "description", "detailed", "different", "effects", "engineers", "essential"....
0.300
Technology transfer ↗ KW CROSS HIGH
activityanalysisanothercapacitycommercialconnectingcontrolcoredevelopmentenvironmentestablishesgovernmentindustrialinfluenceinstitutionsinterestsknowledgelevelslicensingmarket
SHARED TOKENS (40): "activity", "analysis", "another", "capacity", "commercial", "connecting", "control", "core", "development", "environment", "establishes", "government", "industrial", "influence", "institutions", "interests", "knowledge", "levels", "licensing", "market"....
0.300
agriculturalartificialchangecontaminationcreatedischargeenteringenvironmentalfarmsfieldsformgrowthincreasedinputslevelslimitproductionqualityreducesystem
SHARED TOKENS (26): "agricultural", "artificial", "change", "contamination", "create", "discharge", "entering", "environmental", "farms", "fields", "form", "growth", "increased", "inputs", "levels", "limit", "production", "quality", "reduce", "system"....
0.300
amongdecisionsdevelopmentdifferentengineeringhealthidentifiedindividualinitiativemodelnationalorganizationspracticesproductsproviderelatedresponserisksystemstherefore
SHARED TOKENS (21): "among", "decisions", "development", "different", "engineering", "health", "identified", "individual", "initiative", "model", "national", "organizations", "practices", "products", "provide", "related", "response", "risk", "systems", "therefore"....
🫐 BERRY49 edges
0.280
boiseidahonationalpoint
SHARED TOKENS (4): "boise", "idaho", "national", "point". | EXACT TITLE in rivers_lakes: "Boise Mountains".
0.280
centralizedcommercialcomponentsdistributionindustrialinfrastructurenetworkplantrequirementsresidentialsupplysystemtreatmentwater
SHARED TOKENS (14): "centralized", "commercial", "components", "distribution", "industrial", "infrastructure", "network", "plant", "requirements", "residential", "supply", "system", "treatment", "water".
0.280
changesconservationdiffersemphasizesessentialinfluencemakingpracticeproductspurposereducesmallwastewater
SHARED TOKENS (14): "changes", "conservation", "differs", "emphasizes", "essential", "influence", "making", "practice", "products", "purpose", "reduce", "small", "waste", "water".
0.280
departmenthealthidahopublic
SHARED TOKENS (4): "department", "health", "idaho", "public". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.280
beyonddevelopingearlyfacegrowthinfluencelargemodelprivateprojectpublicrapidsignificantuncertainty
SHARED TOKENS (14): "beyond", "developing", "early", "face", "growth", "influence", "large", "model", "private", "project", "public", "rapid", "significant", "uncertainty".
0.280
purposesresearchscientificstudy
SHARED TOKENS (4): "purposes", "research", "scientific", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.280
Biomarker ↗ EXACT TITLE
biologicalfieldsprocessesscientific
SHARED TOKENS (4): "biological", "fields", "processes", "scientific". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.260
Streamflow ↗ Q29425295 KW CROSS HIGH
adjacentcapacitychannelscomponentdischargeflowlandmajormovementrecordstreamsvolumewater
SHARED TOKENS (13): "adjacent", "capacity", "channels", "component", "discharge", "flow", "land", "major", "movement", "record", "streams", "volume", "water".
0.260
adjacentamongcommondetermineslandlawownershipownspossesspropertyrightssystemwater
SHARED TOKENS (13): "adjacent", "among", "common", "determines", "land", "law", "ownership", "owns", "possess", "property", "rights", "system", "water".
0.260
accumulationbecomedependingexistencefarmlandformlandmajormechanismsresultingsoiluseswater
SHARED TOKENS (13): "accumulation", "become", "depending", "existence", "farmland", "form", "land", "major", "mechanisms", "resulting", "soil", "uses", "water".
0.260
availabilityconsumergeneralinformationmultipleoperatorprocessproductionproductssinglesitetypeusers
SHARED TOKENS (13): "availability", "consumer", "general", "information", "multiple", "operator", "process", "production", "products", "single", "site", "type", "users".
0.260
authoritydesignateddistrictsentitygeographicgovernmentirrigationlargelocalobtainprojectspublicwater
SHARED TOKENS (13): "authority", "designated", "districts", "entity", "geographic", "government", "irrigation", "large", "local", "obtain", "projects", "public", "water".
0.260
Lake Cascade ↗ Q14687186 KW CROSS HIGH
boisebuiltbureauchangecommonfederalfollowingidahomilesnationalrivervalleywestern
SHARED TOKENS (13): "boise", "built", "bureau", "change", "common", "federal", "following", "idaho", "miles", "national", "river", "valley", "western".
0.240
allowingdependingdesigneddirectlyirrigationmaintainednetworksoilsystemsystemstypewater
SHARED TOKENS (12): "allowing", "depending", "designed", "directly", "irrigation", "maintained", "network", "soil", "system", "systems", "type", "water".
0.240
agriculturalindustriallegalmerelyownershippurposerightssourcesummarizedsystemuserswater
SHARED TOKENS (12): "agricultural", "industrial", "legal", "merely", "ownership", "purpose", "rights", "source", "summarized", "system", "users", "water".
0.240
controldistinctfieldgoverninglawownershippropertyqualityrelatedresourceresourceswater
SHARED TOKENS (12): "control", "distinct", "field", "governing", "law", "ownership", "property", "quality", "related", "resource", "resources", "water".
0.240
Seed testing ↗ Q7445654 KW CROSS HIGH
analysiscommondedicateddesigneddetermineevaluatepurposesqualityresearchscientificstoragetrained
SHARED TOKENS (12): "analysis", "common", "dedicated", "designed", "determine", "evaluate", "purposes", "quality", "research", "scientific", "storage", "trained".
0.240
administrationbodychemicalconcentrationdedicatedeffectsinfluencemodelingplacespointrelationshipstudy
SHARED TOKENS (12): "administration", "body", "chemical", "concentration", "dedicated", "effects", "influence", "modeling", "places", "point", "relationship", "study".
0.240
Water taxi ↗ Q5643 KW CROSS HIGH
demanddescribedenvironmentmultipleoperatingprivateprovidepublicrathertransporttransportationwater
SHARED TOKENS (12): "demand", "described", "environment", "multiple", "operating", "private", "provide", "public", "rather", "transport", "transportation", "water".
0.220
Boating ↗ Q2141830 EXACT TITLE
activitiesactivity
SHARED TOKENS (2): "activities", "activity". | EXACT TITLE in rivers_lakes: "Boating".
0.220
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturalbasindivisionidahomajormilesnationalnearriversectionvalley
SHARED TOKENS (11): "agricultural", "basin", "division", "idaho", "major", "miles", "national", "near", "river", "section", "valley".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
commonlyplant
SHARED TOKENS (2): "commonly", "plant". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.220
Crappie ↗ Q1063438 EXACT TITLE
amongcommon
SHARED TOKENS (2): "among", "common". | EXACT TITLE in rivers_lakes: "Crappie".
0.220
beyondriver
SHARED TOKENS (2): "beyond", "river". | EXACT TITLE in rivers_lakes: "Deadwood River".
0.220
Salmonidae ↗ Q184238 KW CROSS HIGH
amongdescribedevenlifereachingsinglesmallstreamstransferwaterswhose
SHARED TOKENS (11): "among", "described", "even", "life", "reaching", "single", "small", "streams", "transfer", "waters", "whose".
0.220
certaincomponentscurrentdemonstrateknowledgemodelprocessesrepresentationrepresentedstudentssystems
SHARED TOKENS (11): "certain", "components", "current", "demonstrate", "knowledge", "model", "processes", "representation", "represented", "students", "systems".
0.220
designgenerallargeprocessesqualityremainsewersmalltreatmentwastewaterwater
SHARED TOKENS (11): "design", "general", "large", "processes", "quality", "remain", "sewer", "small", "treatment", "wastewater", "water".
0.200
applicationscertaindesigneddevelopedfieldlaboratoryprogramregulatedresearchsingle
SHARED TOKENS (10): "applications", "certain", "designed", "developed", "field", "laboratory", "program", "regulated", "research", "single".
0.200
Water table ↗ Q3342272 KW CROSS HIGH
definedependingflowincreasinglowermaterialsprecipitationsoilsufficientwater
SHARED TOKENS (10): "define", "depending", "flow", "increasing", "lower", "materials", "precipitation", "soil", "sufficient", "water".
0.200
Clark's grebe ↗ Q432327 KW CROSS HIGH
behaviorcentrallargelocallowermaintainspopulationsrivervalleywestern
SHARED TOKENS (10): "behavior", "central", "large", "local", "lower", "maintains", "populations", "river", "valley", "western".
0.180
Select agent ↗ KW CROSS HIGH
affectingagriculturebiologicaldepartmentdividedhealthlawpublicsafety
SHARED TOKENS (9): "affecting", "agriculture", "biological", "department", "divided", "health", "law", "public", "safety".
0.180
Fecal coliform ↗ Q918223 KW CROSS HIGH
capablecontaminationdirectlyfoundgenerallygrowthpathogenspresencewater
SHARED TOKENS (9): "capable", "contamination", "directly", "found", "generally", "growth", "pathogens", "presence", "water".
0.180
basinconservationdemandeffectsenvironmentalphysicalpracticesupplieswater
SHARED TOKENS (9): "basin", "conservation", "demand", "effects", "environmental", "physical", "practice", "supplies", "water".
0.180
bachelordegreedegreeseducationgraduatephaseprofessionalstudentsundergraduate
SHARED TOKENS (9): "bachelor", "degree", "degrees", "education", "graduate", "phase", "professional", "students", "undergraduate".
0.180
artificialbecomebiologydifferentengineeredmultiplepossiblesitestreatment
SHARED TOKENS (9): "artificial", "become", "biology", "different", "engineered", "multiple", "possible", "sites", "treatment".
0.180
Rhyolite ↗ Q190727 KW CROSS HIGH
amongconstructioncontainingedgegenerallymakessoiltoolstype
SHARED TOKENS (9): "among", "construction", "containing", "edge", "generally", "makes", "soil", "tools", "type".
0.180
facilitieshealthhomeidahonetworkoperatesoperatingsupportsystem
SHARED TOKENS (9): "facilities", "health", "home", "idaho", "network", "operates", "operating", "support", "system".
0.160
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.160
Western grebe ↗ Q679154 KW CROSS HIGH
describeddistinctfoundlaterstudiesthemwaterwestern
SHARED TOKENS (8): "described", "distinct", "found", "later", "studies", "them", "water", "western".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "western".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahometropolitanpartspopulationshared
SHARED TOKENS (8): "ada", "boise", "canyon", "idaho", "metropolitan", "parts", "population", "shared".
0.160
changepointprocessproposedreferenceriverstreamstransport
SHARED TOKENS (8): "change", "point", "process", "proposed", "reference", "river", "streams", "transport".
0.140
administrationapprovedcouncilmeansproceduresprogramregulatory
SHARED TOKENS (7): "administration", "approved", "council", "means", "procedures", "program", "regulatory".
0.140
Granite ↗ Q41177 KW CROSS HIGH
classifiedcommonconstructionfoundhistoryhundredstype
SHARED TOKENS (7): "classified", "common", "construction", "found", "history", "hundreds", "type".
0.120
activeassociateddevelopmentfieldidahoriver
SHARED TOKENS (6): "active", "associated", "development", "field", "idaho", "river".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
Medical test ↗ Q2671652 KW CROSS HIGH
analysischemicaldeterminephysicalprocessestreatment
SHARED TOKENS (6): "analysis", "chemical", "determine", "physical", "processes", "treatment".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationsmall
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "population", "small".
0.120
departmentfederalgovernmentmanagementmissionworking
SHARED TOKENS (6): "department", "federal", "government", "management", "mission", "working".
◈ Frequently Asked Questions
Rivers Lakes × Biotech Life Sciences — Treasure Valley
HAIKU · HIGH GATE
How does Boise River water quality affect biotech research facilities in the Treasure Valley?
Biotech and life sciences companies operating in Boise, Nampa, and Caldwell rely on consistent water quality standards monitored by the Idaho Department of Environmental Quality and enforced under EPA regulations. The Boise River's water composition directly influences laboratory protocols and manufacturing processes for firms developing pharmaceuticals and medical devices across Ada County.
What role do Treasure Valley universities play in connecting water research to biotech development?
Boise State University and the University of Idaho conduct water quality research that informs biotech innovation in the Boise metropolitan area, while College of Western Idaho provides workforce training for life sciences professionals. These institutions collaborate with local environmental agencies to ensure drinking water standards support both public health and the technical requirements of biotech manufacturing in the region.
Why is Snake River Plain hydrology relevant to biotech operations in Nampa and Caldwell?
The Snake River Plain aquifer system supplies drinking water to biotech facilities across the Treasure Valley's western cities, making groundwater availability and contamination prevention critical to operations. Companies in Nampa and Caldwell must comply with EPA water quality standards and Idaho Department of Environmental Quality regulations to protect both their production processes and public water supplies.
How do Boise area water resources support biotech cluster development in Ada County?
Access to reliable water from the Boise River and Snake River Plain enables biotech and pharmaceutical manufacturing to scale operations across the Boise metropolitan population centers. The Idaho Department of Environmental Quality's management of water rights and quality ensures that life sciences companies can meet production demands while maintaining compliance with federal EPA standards.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Rivers Lakes × Biotech Life Sciences 17 QID bridges 268 edges 7,069 ext links 2026-07-17 22:57:04 UTC 495af56cf12a2cd0
Rivers Lakes corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Rivers Lakes ↗ boisestandard.org/standard ↗
Parent Corridors
Rivers Lakes × All Other Verticals