—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Outdoor Recreation ↔ relates to ↔ Transportation Infrastructure

10 Wikipedia bridge articles confirmed in both vertical ledgers. 191 deterministic cross-vertical edges. 5,309 external source links harvested. Every edge provenance-stamped. Every claim auditable.

10 QID Bridge Articles
191 Cross Edges
5,309 External Sources
220 Wikipedia Articles
14 🌲 Evergreen
126 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Outdoor Recreation
× Transportation Infrastructure
QID Bridge Articles
10
confirmed Wikipedia overlap
Total Cross Edges
191
External Sources Harvested
5,309
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Treasure Valley
score: 0.9600  ·  type: exact_title_cross  ·  13 shared tokens
QID Bridge Titles (10)
Treasure ValleyShared-use pathUnited States Army Corps of EngineersBoise, IdahoAda County, IdahoGarden City, IdahoMeridian, IdahoEagle, IdahoKuna, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahoadacapitalsecondlocalnameopportunitiesoregonrivertreasurevalleydepartmentprimaryprovideroutegovernmentrangedowntownhome
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:36:22 UTC
Content Hash
1732928570ea30db
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
10 BRIDGES
Treasure Valley
Q7836726 EXACT TITLE 0.960
QID OVERLAP: Q7836726 in outdoor_recreation (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (13): "boise", "idaho", "land", "local", "name", "opportunities", "oregon", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in outdoor_recreation: "Treasure Valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley".
boiseidaholandlocalnameopportunitiesoregonregionresourcesrivertreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Shared-use path
Q12670591 QID OVERLAP 0.800
QID OVERLAP: Q12670591 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (17): "accommodate", "conflicts", "creating", "department", "designed", "different", "even", "lanes", "paths", "pathway", "primary", "provide", "route", "travel", "urban", "user", "users".
accommodateconflictscreatingdepartmentdesigneddifferentevenlanespathspathwayprimaryprovideroutetravelurbanuserusers
A shared-use path, mixed-use path or multi-use pathway is a path which is "designed to accommodate the movement of pedestrians and cyclists". Examples of shared-use paths include sidewalks designated as shared-use, bridleways and rail trails. A shared-use path typically has a surface that is asphalt, concrete or firmly packed crushed aggregate. Shared-use paths differ from cycle tracks and cycle paths in that they are designed to accommodate pedestrians, even if the primary anticipated users are cyclists. The path may also permit other users such as inline skating. Contrastingly, motorcycles and mopeds are normally prohibited. Shared-use paths sometimes provide different lanes for users who travel at different speeds to prevent conflicts between user groups on high-use trails. In some cases, paths are divided into lanes shared by pedestrians and cyclists traveling in the same direction. Shared-use paths are criticised for creating conflict between different users.
trails. A shared-use path typically has a surface that is asphalt, concrete or firmly packed crushed aggregate. Shared-use paths differ from cycle tracks and cycle paths in that they are designed to accommodate pedestrians, even if the primary anticipated users are cyclists. The path may also permit other users such as inline skating. Contrastingly, motorcycles and mopeds are normally prohibited. Shared-use paths sometimes provide different lanes for users who travel at different speeds to prevent conflicts between user groups on high-use trails. In some cases, paths are divided into lanes shared by pedestrians and cyclists traveling in the same direction. Shared-use paths are criticised for creating conflict between different users.
her users such as inline skating. Contrastingly, motorcycles and mopeds are normally prohibited. Shared-use paths sometimes provide different lanes for users who travel at different speeds to prevent conflicts between user groups on high-use trails. In some cases, paths are divided into lanes shared by pedestrians and cyclists traveling in the same direction. Shared-use paths are criticised for creating conflict between different users.
United States Army Corps of Engineers
Q1049334 QID OVERLAP 0.800
QID OVERLAP: Q1049334 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (51): "agencies", "approximately", "army", "authority", "business", "capacity", "clean", "construction", "control", "corps", "department", "design", "direct", "directly", "economy", "engineers", "environment", "environmental", "facilities", "federal"....
agenciesapproximatelyarmyauthoritybusinesscapacitycleanconstructioncontrolcorpsdepartmentdesigndirectdirectlyeconomyengineersenvironmentenvironmentalfacilitiesfederalformgovernmentinfrastructurejunemaintenancemanagedmanagementmilitarymissionnational+21
gineer Regiment, military construction, and civil works. USACE has 37,000 civilian and military personnel, making it one of the world's largest public engineering, design, and construction management agencies. The USACE workforce is approximately 97% civilian and 3% active duty military. The civilian workforce is mainly located in the United States, Europe, and in select Middle East office locations. Civilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
Planning, designing, building, and operating locks and dams. Other civil engineering projects include flood control, beach nourishment, and dredging for waterway navigation. Design and construction of flood protection systems through various federal mandates. Design and construction management of military facilities for the Army, Air Force, Army Reserve, and Air Force Reserve as well as other Department of Defense and federal government agencies. Environmental regulation and ecosystem restoration. History 18th century The history of United States Army Corps of Engineers can be traced back to the American Revolution. On 16 June 1775, the Continental Congress organized the Corps of Engineers, whose initial staff included a chief engineer and two assistants. Colonel Richard Gridley became General George Washington's first chief engineer. One of his first tasks was to build fortifications near Boston at Bunker Hill. The Continental Congress recognized the need for engineers trained in military fortifications and asked the government of King Louis XVI of France for assistance. Many of the early engineers in the Continental Army were former French officers. Louis Lebègue Duportail, a lieutenant colonel in the French Royal Corps of Engineers, was secretly sent to North America in March 1777 to serve in George Washington's Continental Army. In July 1777 he was appointed colonel and commander of all engineers in the Continental Army and, on 17 November 1777, he was promoted to brigadier general. When the Continental Congress created a separate Corps of Engineers in May 1779, Duportail was appointed as its commander. In late 1781 he directed the construction of the allied U.S.–French siege works at the Battle of Yorktown. On 26 February 1783, the corps was disbanded.
Homeland security USACE supports the United States' Department of Homeland Security and the Federal Emergency Management Agency (FEMA) through its security planning, force protection, research and development, disaster preparedness efforts, and quick response to emergencies and disasters. The CoE conducts its emergency response activities under two basic authorities — the Flood Control and Coastal Emergency Act (Pub. L. 84–99), and the Stafford Disaster Relief and Emergency Assistance Act (Pub. L. 93–288). In a typical year, the Corps of Engineers responds to more than 30 Presidential disaster declarations, plus numerous state and local emergencies. Emergency responses usually involve cooperation with other military elements and Federal agencies in support of State and local efforts. Infrastructure support Work comprises engineering and management support to military installations, global real estate support, civil works support (including risk and priorities), operations and maintenance of Federal navigation and flood control projects, and monitoring of dams and levees. More than 67 percent of the goods consumed by Americans and more than half of the nation's oil imports are processed through deepwater ports maintained by the Corps of Engineers, which maintains more than 12,000 miles (19,000 km) of commercially navigable channels across the U.S. In both its Civil Works mission and Military Construction program, the Corps of Engineers is responsible for billions of dollars of the nation's infrastructure. For example, USACE maintains direct control of 609 dams, maintains or operates 257 navigation locks, and operates 75 hydroelectric facilities generating 24% of the nation's hydropower and three percent of its total electricity. USACE inspects over 2,000 Federal and non-Federal levees every two years. Four billion gallons of water per day are drawn from the Corps of Engineers' 136 multi-use flood control projects comprising 9,800,000 acre-feet (12.1 km3) of water storage, making it one of the United States' largest water supply agencies. The 249th Engineer Battalion (Prime Power), the only active duty unit in USACE, generates and distributes prime electrical power in support of warfighting, disaster relief, stability and support operations as well as provides advice and technical assistance in all aspects of electrical power and distribution systems. The battalion deployed in support of recovery operations after 9/11 and was instrumental in getting Wall Street back up and running within a week.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (14): "ada", "boise", "capital", "downtown", "feet", "home", "idaho", "locally", "major", "miles", "oregon", "river", "treasure", "valley".
adaboisecapitaldowntownfeethomeidaholocallymajormilesoregonrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in outdoor_recreation (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "private", "range", "roads", "second".
adaboisecapitaldistricthomeidahojurisdictionlocalprivaterangeroadssecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
Q1516892 QID OVERLAP 0.680
QID OVERLAP: Q1516892 in outdoor_recreation (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "garden", "government", "idaho", "municipal", "name", "second", "street".
adaboisegardengovernmentidahomunicipalnamesecondstreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "meridian", "second".
adaamongboisecapitalidahomeridiansecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "miles".
adaboisedowntowneagleidahomiles
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Kuna, Idaho
Q1515177 QID OVERLAP 0.600
QID OVERLAP: Q1515177 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "kuna".
adaadditionalboiseidahokuna
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in outdoor_recreation (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "nampa".
boisecaldwellcanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
181 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP181 edges
🌲 EVERGREEN4 edges
0.650
boiseconditionsforestidaholandmilesmountainnationaloperatedorganizationprivaterecreationroadsnowwestern
SHARED TOKENS (15): "boise", "conditions", "forest", "idaho", "land", "miles", "mountain", "national", "operated", "organization", "private", "recreation", "road", "snow", "western". | URL->A (1): http://www.bogusbasin.org/. | EXACT TITLE in outdoor_recreation: "Bogus Basin".
0.650
acresadaadditionalboisecanyoncreatingdifferentfeetgoldenhistoricalhomeidaholandmanagedmanagementmilesmilitarymillionnationalnatural
SHARED TOKENS (29): "acres", "ada", "additional", "boise", "canyon", "creating", "different", "feet", "golden", "historical", "home", "idaho", "land", "managed", "management", "miles", "military", "million", "national", "natural".... | URL->A (1): https://www.blm.gov/programs/national-conservation-lands/idaho/morley-nelson-snake-river-birds-of-prey. | EXACT TITLE in outdoor_recreation: "Morley Nelson Snake River Birds of Prey National Conservation Area".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamonganotherauthoritiesauthoritybestboisecanyoncapacitycapitalcentercommutingdestinationdistricteagleearlyenvironmentalfederal
SHARED TOKENS (62): "ada", "additional", "agencies", "among", "another", "authorities", "authority", "best", "boise", "canyon", "capacity", "capital", "center", "commuting", "destination", "district", "eagle", "early", "environmental", "federal".... | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.630
administrationcommercialfederallandmanagedplanningpublicrampsrevenuesafetysignagesoldtrustweather
SHARED TOKENS (14): "administration", "commercial", "federal", "land", "managed", "planning", "public", "ramps", "revenue", "safety", "signage", "sold", "trust", "weather". | URL->B (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
🌿 BRANCH126 edges
0.570
agencybegancreatingdepartmentenforcementidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (11): "agency", "began", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "public", "statewide". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.570
agencyconstructioneconomicfederalgovernmentjurisdictionmattersregulatorytraffictransportationwater
SHARED TOKENS (11): "agency", "construction", "economic", "federal", "government", "jurisdiction", "matters", "regulatory", "traffic", "transportation", "water". | URL->B (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.530
agencydepartmentgovernmentidahomanagesparksprogramsrecreationthroughout
SHARED TOKENS (9): "agency", "department", "government", "idaho", "manages", "parks", "programs", "recreation", "throughout". | URL->A (1): https://parksandrecreation.idaho.gov/. | EXACT TITLE in outdoor_recreation: "Idaho Department of Parks and Recreation".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherbikedesignfeatureslandlaneslocalpathsplaceprimaryprivatepublicroadroadsroutestreettrafficurban
SHARED TOKENS (19): "access", "another", "bike", "design", "features", "land", "lanes", "local", "paths", "place", "primary", "private", "public", "road", "roads", "route", "street", "traffic", "urban". | EXACT TITLE in outdoor_recreation: "Road". | EXACT TITLE in transportation_infrastructure: "Road".
0.500
acresagenciesagencyamongapproximatelydepartmentdescribedestateexistingfederalgovernmentidaholandmanagementmanagesmilesmillionmissionnationaloffice
SHARED TOKENS (28): "acres", "agencies", "agency", "among", "approximately", "department", "described", "estate", "existing", "federal", "government", "idaho", "land", "management", "manages", "miles", "million", "mission", "national", "office".... | EXACT TITLE in outdoor_recreation: "Bureau of Land Management".
0.500
Idaho ↗ Q1221 EXACT TITLE
approximatelybestboisecapitalearlyeconomyforestidaholandmethodsmilesmillionmountainnationalofficialoregonpeopleproductsriversmall
SHARED TOKENS (24): "approximately", "best", "boise", "capital", "early", "economy", "forest", "idaho", "land", "methods", "miles", "million", "mountain", "national", "official", "oregon", "people", "products", "river", "small".... | EXACT TITLE in outdoor_recreation: "Idaho". | EXACT TITLE in transportation_infrastructure: "Idaho".
0.500
Wildfire ↗ Q169950 EXACT TITLE
createcreatesdirecteconomicequipmentespeciallyeventforestgrowthinterfaceslandmanagementmitigationnaturalopenoregonphysicalspacesurbanwater
SHARED TOKENS (21): "create", "creates", "direct", "economic", "equipment", "especially", "event", "forest", "growth", "interfaces", "land", "management", "mitigation", "natural", "open", "oregon", "physical", "spaces", "urban", "water".... | EXACT TITLE in outdoor_recreation: "Wildfire".
0.500
canyonconstructionemergencyhomeidahomilitarymissionmountainmunicipalnampanationalprivatepublicriversystemstraining
SHARED TOKENS (16): "canyon", "construction", "emergency", "home", "idaho", "military", "mission", "mountain", "municipal", "nampa", "national", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
centercommercialconsumersdedicateddirectlydistributionequipmentfacilitymarketnamenetworkoperatesorganizationsproductsresourcesretailservingsinglespacespecialized
SHARED TOKENS (22): "center", "commercial", "consumers", "dedicated", "directly", "distribution", "equipment", "facility", "market", "name", "network", "operates", "organizations", "products", "resources", "retail", "serving", "single", "space", "specialized".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Zoning ↗ Q702232 EXACT TITLE
determinedevelopeddevelopmentdifferentformgovernmentgrowthlandlocalplacesplanningregulatoryrulesscaleshapesinglesystemsurban
SHARED TOKENS (18): "determine", "developed", "development", "different", "form", "government", "growth", "land", "local", "places", "planning", "regulatory", "rules", "scale", "shape", "single", "systems", "urban". | EXACT TITLE in transportation_infrastructure: "Zoning".
0.500
accessauthoritiescooperativeexistingfederalformationgovernedgovernmentlawlocalorganizationparticipationplanningprogramspublicregionalstatewidetransportation
SHARED TOKENS (18): "access", "authorities", "cooperative", "existing", "federal", "formation", "governed", "government", "law", "local", "organization", "participation", "planning", "programs", "public", "regional", "statewide", "transportation". | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
bestclassescontrolcriticalenforcementeventimprovingmethodspedestrianpublicrequiringroadroadssafesafetysecondsidesystemthemtraffic
SHARED TOKENS (22): "best", "classes", "control", "critical", "enforcement", "event", "improving", "methods", "pedestrian", "public", "requiring", "road", "roads", "safe", "safety", "second", "side", "system", "them", "traffic".... | EXACT TITLE in outdoor_recreation: "Road safety".
0.500
acresagencybecomebuiltdepartmentdevelopmentfederalgovernmentjunelawmanagementmillionpeopleresourcerevenuesecondsourcethroughoutwaterwestern
SHARED TOKENS (20): "acres", "agency", "become", "built", "department", "development", "federal", "government", "june", "law", "management", "million", "people", "resource", "revenue", "second", "source", "throughout", "water", "western". | EXACT TITLE in outdoor_recreation: "Bureau of Reclamation".
0.500
broaderdevelopmenteconomicenvironmentalgrowthinfrastructurelandlargermanagemanagementmilitarynationalnetworkplanningregionregionalrequirerequiresscalespace
SHARED TOKENS (25): "broader", "development", "economic", "environmental", "growth", "infrastructure", "land", "larger", "manage", "management", "military", "national", "network", "planning", "region", "regional", "require", "requires", "scale", "space".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciescommunityconditionsconnectivitydevelopmentdifferenteconomiceconomyemergencyenforcementenvironmentenvironmentalespeciallyfacilitiesinfrastructurelawmanagementofficialparks
SHARED TOKENS (33): "access", "agencies", "community", "conditions", "connectivity", "development", "different", "economic", "economy", "emergency", "enforcement", "environment", "environmental", "especially", "facilities", "infrastructure", "law", "management", "official", "parks".... | EXACT TITLE in outdoor_recreation: "Infrastructure". | EXACT TITLE in transportation_infrastructure: "Infrastructure".
0.500
State park ↗ Q1761072 EXACT TITLE
administrationdesignedentitiesfederalgovernmenthistorylocalmanagednationalnaturalopportunitiesparkparkspreservepreservingprogramsratherrecreationalregionalresources
SHARED TOKENS (24): "administration", "designed", "entities", "federal", "government", "history", "local", "managed", "national", "natural", "opportunities", "park", "parks", "preserve", "preserving", "programs", "rather", "recreational", "regional", "resources".... | EXACT TITLE in outdoor_recreation: "State park".
0.500
annuallydevelopeddevelopmentdirectenvironmentenvironmentalfreegroupgrowthmillionnaturalpeopleresourcesstandardthough
SHARED TOKENS (15): "annually", "developed", "development", "direct", "environment", "environmental", "free", "group", "growth", "million", "natural", "people", "resources", "standard", "though". | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
acresadaarmyboisecorpsdiscoveryengineersgreenbelthomeidahomilesnearparkpublicrampsrecreationriver
SHARED TOKENS (17): "acres", "ada", "army", "boise", "corps", "discovery", "engineers", "greenbelt", "home", "idaho", "miles", "near", "park", "public", "ramps", "recreation", "river". | EXACT TITLE in outdoor_recreation: "Lucky Peak State Park".
0.500
bicyclecommutingcontrolequipmentespeciallylicensinglocalmotorizedneedphysicalrangeratherrequiresafetythemtreatedusers
SHARED TOKENS (17): "bicycle", "commuting", "control", "equipment", "especially", "licensing", "local", "motorized", "need", "physical", "range", "rather", "require", "safety", "them", "treated", "users". | EXACT TITLE in transportation_infrastructure: "Electric bicycle".
0.500
beyondbikeboiseconnectsdedicatedeaglegreenbeltidahomilesmotorizedmunicipalitiesparkspartspathsrecreationalriverroadroutessystemtrail
SHARED TOKENS (23): "beyond", "bike", "boise", "connects", "dedicated", "eagle", "greenbelt", "idaho", "miles", "motorized", "municipalities", "parks", "parts", "paths", "recreational", "river", "road", "routes", "system", "trail".... | EXACT TITLE in outdoor_recreation: "Boise River Greenbelt". | EXACT TITLE in transportation_infrastructure: "Boise River Greenbelt".
0.500
chainconsumerscreatingdirectdirectlydistributionfacilitiesmanagementnetworkproductsstructuresupplierssystemsystemsthemvalue
SHARED TOKENS (16): "chain", "consumers", "creating", "direct", "directly", "distribution", "facilities", "management", "network", "products", "structure", "suppliers", "system", "systems", "them", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
Picnic ↗ Q506294 EXACT TITLE
differentearlyespeciallyeventfoodformfreehomeoutdoorparkparksplacepublicrequiresviewwater
SHARED TOKENS (16): "different", "early", "especially", "event", "food", "form", "free", "home", "outdoor", "park", "parks", "place", "public", "requires", "view", "water". | EXACT TITLE in outdoor_recreation: "Picnic".
0.500
administrationagencyapproximatelyauthorityconnectingdatadepartmentenforcementfacilitiesfederalgovernmentlawlocalmissionoperatedpartnersprimaryregulatoryresponsesystem
SHARED TOKENS (23): "administration", "agency", "approximately", "authority", "connecting", "data", "department", "enforcement", "facilities", "federal", "government", "law", "local", "mission", "operated", "partners", "primary", "regulatory", "response", "system".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
anotherarmychaindedicatedequipmentfacilityfoodinformationmaintainingmanagedmanagementmilitaryoperationalpartsphysicalplanningproductsprovidepublicresource
SHARED TOKENS (23): "another", "army", "chain", "dedicated", "equipment", "facility", "food", "information", "maintaining", "managed", "management", "military", "operational", "parts", "physical", "planning", "products", "provide", "public", "resource".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencydepartmentdistrictexistingfederalfinancialgovernmentlocalofficeoperatorspeopleprogramsproviderspublicregionalrequirementssystemstransportation
SHARED TOKENS (21): "administration", "agencies", "agency", "department", "district", "existing", "federal", "financial", "government", "local", "office", "operators", "people", "programs", "providers", "public", "regional", "requirements", "systems", "transportation".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
Fishing ↗ Q14373 EXACT TITLE
activityadditionalcommercialdirectemploymentenvironmentfoodlong-termmillionnaturalparkpeopleproviderecreationaltermswater
SHARED TOKENS (16): "activity", "additional", "commercial", "direct", "employment", "environment", "food", "long-term", "million", "natural", "park", "people", "provide", "recreational", "terms", "water". | EXACT TITLE in outdoor_recreation: "Fishing".
0.500
assetsbroadercapitalcategorycommunityconstructiondirectlyeconomicemploymentenvironmentalfacilitiesgovernmenthabitatinfrastructurelong-termmunicipaloperatorparksphysicalpreservation
SHARED TOKENS (30): "assets", "broader", "capital", "category", "community", "construction", "directly", "economic", "employment", "environmental", "facilities", "government", "habitat", "infrastructure", "long-term", "municipal", "operator", "parks", "physical", "preservation".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
Hunting ↗ EXACT TITLE
againstbecomecapacitycontrolenvironmentespeciallyevenfoodformlawmaintenancemanagemanagementmeansnaturalparksprimaryproductsprogramsprovide
SHARED TOKENS (26): "against", "become", "capacity", "control", "environment", "especially", "even", "food", "form", "law", "maintenance", "manage", "management", "means", "natural", "parks", "primary", "products", "programs", "provide".... | EXACT TITLE in outdoor_recreation: "Hunting".
0.500
accessauthoritiescoordinationcorridorsdevelopmenteconomicestatefinancialgovernmenthistoricalinfrastructurelocalmunicipalnetworkoperatedoperatingoperationaloperationsoperatorsplanning
SHARED TOKENS (38): "access", "authorities", "coordination", "corridors", "development", "economic", "estate", "financial", "government", "historical", "infrastructure", "local", "municipal", "network", "operated", "operating", "operational", "operations", "operators", "planning".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciescanyoncentralcommercialconstructioncontroldevelopeddownstreamfeaturesflowsfurtherhabitathistoryidahomajormilesmilitarynationalnearoregon
SHARED TOKENS (35): "agencies", "canyon", "central", "commercial", "construction", "control", "developed", "downstream", "features", "flows", "further", "habitat", "history", "idaho", "major", "miles", "military", "national", "near", "oregon".... | EXACT TITLE in outdoor_recreation: "Snake River".
0.500
acresboisedistrictsearlyfacilitiesfeetforesthomeidaholandmanagedmilesmotorizedmountainmultiplenationalpeoplerangerecreationresources
SHARED TOKENS (23): "acres", "boise", "districts", "early", "facilities", "feet", "forest", "home", "idaho", "land", "managed", "miles", "motorized", "mountain", "multiple", "national", "people", "range", "recreation", "resources".... | EXACT TITLE in outdoor_recreation: "Boise National Forest".
0.500
departmentfacilitiesfederalimprovinglocalmajormilitarynationalnetworkorganizationsplanningroadssafetyservingsystemtransportation
SHARED TOKENS (16): "department", "facilities", "federal", "improving", "local", "major", "military", "national", "network", "organizations", "planning", "roads", "safety", "serving", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
authoritybegandifferentdistrictdistrictsentitiesexistingformfurthergovernmentlawlocallocallymultiplemunicipalitiesplacesregionalsubdivisionthemvary
SHARED TOKENS (20): "authority", "began", "different", "district", "districts", "entities", "existing", "form", "further", "government", "law", "local", "locally", "multiple", "municipalities", "places", "regional", "subdivision", "them", "vary". | EXACT TITLE in outdoor_recreation: "County (United States)". | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
additionalagenciesdatadevelopedfacilitiesfederalgovgovernmentinformationmanagedpermitsplanningplatformrecreationreservationsitesitessystemtravel
SHARED TOKENS (19): "additional", "agencies", "data", "developed", "facilities", "federal", "gov", "government", "information", "managed", "permits", "planning", "platform", "recreation", "reservation", "site", "sites", "system", "travel". | EXACT TITLE in outdoor_recreation: "Recreation.gov".
0.500
Surveying ↗ Q816425 EXACT TITLE
communicationsconstructiondevelopmentdigitalenvironmentequipmentfeaturesgovernmenthistorylandlawmapsownershipplanningpointsstructuralthemtransportation
SHARED TOKENS (18): "communications", "construction", "development", "digital", "environment", "equipment", "features", "government", "history", "land", "law", "maps", "ownership", "planning", "points", "structural", "them", "transportation". | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
adaboisecentercommercialdepartmentdowntownfacilityforestidahointeragencymilesmilitarymillionnationaloperatedoperatesrequiringsouthsupportwestern
SHARED TOKENS (20): "ada", "boise", "center", "commercial", "department", "downtown", "facility", "forest", "idaho", "interagency", "miles", "military", "million", "national", "operated", "operates", "requiring", "south", "support", "western". | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
administrationagenciesagencycorridordepartmentdevelopmentfederalfinancialgovernmentmanagementnationalnortheastoperatesprogramsprovidepublicsafetysupporttransportation
SHARED TOKENS (19): "administration", "agencies", "agency", "corridor", "department", "development", "federal", "financial", "government", "management", "national", "northeast", "operates", "programs", "provide", "public", "safety", "support", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
agencyarmycleancontrolcoordinationcorpsdirectlyengineersenvironmentalfederalformlawmaintainingmajornamepartsphysicalprimaryqualityresource
SHARED TOKENS (23): "agency", "army", "clean", "control", "coordination", "corps", "directly", "engineers", "environmental", "federal", "form", "law", "maintaining", "major", "name", "parts", "physical", "primary", "quality", "resource".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
builtcommunityconnectingconstructioncreatedesigndesignedearlyengineersenvironmentlocalmajormilesnetworkphysicalproviderequirementsriverstructurestructures
SHARED TOKENS (24): "built", "community", "connecting", "construction", "create", "design", "designed", "early", "engineers", "environment", "local", "major", "miles", "network", "physical", "provide", "requirements", "river", "structure", "structures".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Irrigation ↗ Q11453 EXACT TITLE
centralconditionscontroldevelopeddirectlydistributeddistributiondownstreamenvironmentalformgrowthlandmanagementmethodsnaturalnetworkoperationspartsqualityrequiring
SHARED TOKENS (28): "central", "conditions", "control", "developed", "directly", "distributed", "distribution", "downstream", "environmental", "form", "growth", "land", "management", "methods", "natural", "network", "operations", "parts", "quality", "requiring".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
accessbegancommunicationsdatadevelopmentdigitalearlyforestformfurtherinformationmeansphysicalsignalssingleusers
SHARED TOKENS (16): "access", "began", "communications", "data", "development", "digital", "early", "forest", "form", "further", "information", "means", "physical", "signals", "single", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Open space ↗ Q1451377 EXACT TITLE
businesschaincommunitycorridordesigndevelopmentespeciallylandmakesopenparkpeopleplanningpublicrecreationalreservesmallspacespacesstructures
SHARED TOKENS (21): "business", "chain", "community", "corridor", "design", "development", "especially", "land", "makes", "open", "park", "people", "planning", "public", "recreational", "reserve", "small", "space", "spaces", "structures".... | EXACT TITLE in outdoor_recreation: "Open space". | EXACT TITLE in transportation_infrastructure: "Open space".
0.500
agenciesbuiltconstructiondepartmentsdesignenvironmentgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysicalplaceprivatepublicroadsstructuralsystems
SHARED TOKENS (20): "agencies", "built", "construction", "departments", "design", "environment", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical", "place", "private", "public", "roads", "structural", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalapproximatelybusinesscorridordailydirectlyfederalmanagedmileagemilesmillionnationalnetworknortheastoperatesoperatororganizationpartsreportingrevenue
SHARED TOKENS (27): "additional", "approximately", "business", "corridor", "daily", "directly", "federal", "managed", "mileage", "miles", "million", "national", "network", "northeast", "operates", "operator", "organization", "parts", "reporting", "revenue".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
adaboisecanyonclassescommunitydevelopmenteducationgovernedidahonampaprimaryprogramspublicresidentssouthwestthroughouttreasurevalleywestern
SHARED TOKENS (19): "ada", "boise", "canyon", "classes", "community", "development", "education", "governed", "idaho", "nampa", "primary", "programs", "public", "residents", "southwest", "throughout", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
agenciesapplybikebusinessesdesignfacilitiesgovernmentlanespeopleplanningprivatepublicrangesystemtransportation
SHARED TOKENS (15): "agencies", "apply", "bike", "businesses", "design", "facilities", "government", "lanes", "people", "planning", "private", "public", "range", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessagenciesbeyondcommunitydailydesigneddestinationdevelopedeconomicformgovernmentlocalmobilityoperatedoperatesoperatorsorganizationspeopleprivateprovide
SHARED TOKENS (31): "access", "agencies", "beyond", "community", "daily", "designed", "destination", "developed", "economic", "form", "government", "local", "mobility", "operated", "operates", "operators", "organizations", "people", "private", "provide".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
communitydescribesdevelopmenteconomicespeciallygrowthinfrastructurelocalmarketpeoplequalityregiontermswest
SHARED TOKENS (14): "community", "describes", "development", "economic", "especially", "growth", "infrastructure", "local", "market", "people", "quality", "region", "terms", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.460
boisedepartmenteventsfacilitiesidahomanagedoutdoorparkparkspeoplerecreationriverurban
SHARED TOKENS (13): "boise", "department", "events", "facilities", "idaho", "managed", "outdoor", "park", "parks", "people", "recreation", "river", "urban". | EXACT TITLE in outdoor_recreation: "Ann Morrison Park".
0.460
corridorsenvironmentalespeciallylandlanesmobilitymultipleparkparkspeoplerecreationalurbanusers
SHARED TOKENS (13): "corridors", "environmental", "especially", "land", "lanes", "mobility", "multiple", "park", "parks", "people", "recreational", "urban", "users". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.460
Trail ↗ Q628179 EXACT TITLE
communitieslanemotorizednaturaloregonpedestrianplacesroadroutesmallthoughtrailtravel
SHARED TOKENS (13): "communities", "lane", "motorized", "natural", "oregon", "pedestrian", "places", "road", "route", "small", "though", "trail", "travel". | EXACT TITLE in outdoor_recreation: "Trail". | EXACT TITLE in transportation_infrastructure: "Trail".
0.460
administrationagencyassetsauthoritycommercialcontroldepartmentfederalgovernmentorganizationspacetraffictransportation
SHARED TOKENS (13): "administration", "agency", "assets", "authority", "commercial", "control", "department", "federal", "government", "organization", "space", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.460
additionalallianceformformationhistorymajornetworkoperatesoperatingregionalroutestarthroughout
SHARED TOKENS (13): "additional", "alliance", "form", "formation", "history", "major", "network", "operates", "operating", "regional", "route", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.460
constructioncontextcontroldescribeddesignedequipmentinformationoperationspeopleprimarysourcestructuresystems
SHARED TOKENS (13): "construction", "context", "control", "described", "designed", "equipment", "information", "operations", "people", "primary", "source", "structure", "systems". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.460
Pedestrian ↗ Q221488 EXACT TITLE
creatingdrivingearlymobilitynetworkpathspedestrianpeopleroadssafetytrafficurbanwalking
SHARED TOKENS (13): "creating", "driving", "early", "mobility", "network", "paths", "pedestrian", "people", "roads", "safety", "traffic", "urban", "walking". | EXACT TITLE in outdoor_recreation: "Pedestrian". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.460
activitybecomeconditionsdevelopedequipmentfeaturesfeetparticipationrecreationalsinglesnowspecializedwinter
SHARED TOKENS (13): "activity", "become", "conditions", "developed", "equipment", "features", "feet", "participation", "recreational", "single", "snow", "specialized", "winter". | EXACT TITLE in outdoor_recreation: "Snowboarding".
0.440
Culvert ↗ Q4168092 EXACT TITLE
designeditselfnaturalneedpedestrianrequirementsroadroadsshapestructuretrafficwater
SHARED TOKENS (12): "designed", "itself", "natural", "need", "pedestrian", "requirements", "road", "roads", "shape", "structure", "traffic", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.440
administrationagencydepartmentfederalmajorofficeprogramspublicroadroadsroletransportation
SHARED TOKENS (12): "administration", "agency", "department", "federal", "major", "office", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.420
assetbuiltconstructiondesigndevelopmenteconomicfacilitiesinfrastructuremaintenanceplanningproducts
SHARED TOKENS (11): "asset", "built", "construction", "design", "development", "economic", "facilities", "infrastructure", "maintenance", "planning", "products". | EXACT TITLE in outdoor_recreation: "Construction". | EXACT TITLE in transportation_infrastructure: "Construction".
0.420
Campsite ↗ Q832778 EXACT TITLE
facilitiesgroupmeansmilitaryoutdoorparkpeopleplaceroadsimplyterms
SHARED TOKENS (11): "facilities", "group", "means", "military", "outdoor", "park", "people", "place", "road", "simply", "terms". | EXACT TITLE in outdoor_recreation: "Campsite".
0.420
activityamongboisebusinesseducationidahomillionmountainprogramspublicwest
SHARED TOKENS (11): "activity", "among", "boise", "business", "education", "idaho", "million", "mountain", "programs", "public", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University".
0.400
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalnetworkplannedproviderequirementssignals
SHARED TOKENS (10): "access", "context", "data", "different", "digital", "network", "planned", "provide", "requirements", "signals". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.400
acresboisecanyondepartmentfloodplainsidahomanagementnearriverwater
SHARED TOKENS (10): "acres", "boise", "canyon", "department", "floodplains", "idaho", "management", "near", "river", "water". | EXACT TITLE in outdoor_recreation: "Fort Boise Wildlife Management Area".
0.400
Floodplain ↗ Q193110 EXACT TITLE
controldevelopedfloodplainfloodplainslandnearriverurbanvalleywater
SHARED TOKENS (10): "control", "developed", "floodplain", "floodplains", "land", "near", "river", "urban", "valley", "water". | EXACT TITLE in outdoor_recreation: "Floodplain". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.400
Sidewalk ↗ Q177749 EXACT TITLE
designedlandlanesmobilitypedestrianprivateroadsidesouthstreet
SHARED TOKENS (10): "designed", "land", "lanes", "mobility", "pedestrian", "private", "road", "side", "south", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.400
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseforestidahomilesnortheastrangeriverurbanwestern
SHARED TOKENS (10): "approximately", "boise", "forest", "idaho", "miles", "northeast", "range", "river", "urban", "western". | EXACT TITLE in outdoor_recreation: "Boise River". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.380
designdifferentintersectionslanemajorreflectsroadroadstraffic
SHARED TOKENS (9): "design", "different", "intersections", "lane", "major", "reflects", "road", "roads", "traffic". | EXACT TITLE in outdoor_recreation: "Intersection (road)". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.380
Splash pad ↗ Q7578390 EXACT TITLE
featuresneedparkpublicqualityrecreationtreateduserswater
SHARED TOKENS (9): "features", "need", "park", "public", "quality", "recreation", "treated", "users", "water". | EXACT TITLE in outdoor_recreation: "Splash pad".
0.380
Bike lane ↗ Q1378400 EXACT TITLE
bikebusinesseseconomiclanelanesroadsafetyshowstraffic
SHARED TOKENS (9): "bike", "businesses", "economic", "lane", "lanes", "road", "safety", "shows", "traffic". | EXACT TITLE in outdoor_recreation: "Bike lane".
0.360
centralgovernmentlandlocalnationalpublicrangesystem
SHARED TOKENS (8): "central", "government", "land", "local", "national", "public", "range", "system". | EXACT TITLE in outdoor_recreation: "Public land".
0.360
groupinformationmountainnationalpeoplerescueurbanwater
SHARED TOKENS (8): "group", "information", "mountain", "national", "people", "rescue", "urban", "water". | EXACT TITLE in transportation_infrastructure: "Search and rescue".
0.360
boiseexpansionidahooperatingoregonrestorationroutethough
SHARED TOKENS (8): "boise", "expansion", "idaho", "operating", "oregon", "restoration", "route", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.360
environmentgovernedmountainoutdoorplaceprimaryroadtrail
SHARED TOKENS (8): "environment", "governed", "mountain", "outdoor", "place", "primary", "road", "trail". | EXACT TITLE in outdoor_recreation: "Trail running".
0.360
Rafting ↗ Q207238 EXACT TITLE
activitybecomedifferenteventoutdoorrecreationalriverwater
SHARED TOKENS (8): "activity", "become", "different", "event", "outdoor", "recreational", "river", "water". | EXACT TITLE in outdoor_recreation: "Rafting".
0.340
Hiking ↗ Q12014035 EXACT TITLE
activitydescribesdevelopedorganizationsparkurbanwalking
SHARED TOKENS (7): "activity", "describes", "developed", "organizations", "park", "urban", "walking". | EXACT TITLE in outdoor_recreation: "Hiking".
0.340
roadroadsroutesstandardsystemthoughtraffic
SHARED TOKENS (7): "road", "roads", "routes", "standard", "system", "though", "traffic". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.340
Snowplow ↗ Q14976 EXACT TITLE
clearespeciallyoutdoorservingsnowtransportationwinter
SHARED TOKENS (7): "clear", "especially", "outdoor", "serving", "snow", "transportation", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.340
Outdoor gym ↗ Q692630 EXACT TITLE
builtconstructionequipmentfitnessoutdoorparkpublic
SHARED TOKENS (7): "built", "construction", "equipment", "fitness", "outdoor", "park", "public". | EXACT TITLE in outdoor_recreation: "Outdoor gym".
0.340
landmanagedmanagementmotorizednationalsoldvary
SHARED TOKENS (7): "land", "managed", "management", "motorized", "national", "sold", "vary". | EXACT TITLE in outdoor_recreation: "National Conservation Area".
0.340
Disc golf ↗ Q876737 EXACT TITLE
accessiblecomescompletedifferentfreerulestoward
SHARED TOKENS (7): "accessible", "comes", "complete", "different", "free", "rules", "toward". | EXACT TITLE in outdoor_recreation: "Disc golf".
0.340
Warehouse ↗ Q181623 EXACT TITLE
businessesdesigneddirectlyfacilityparkspartsstandard
SHARED TOKENS (7): "businesses", "designed", "directly", "facility", "parks", "parts", "standard". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.320
Utility ↗ Q466707 EXACT TITLE
amongcontextdevelopedmaintainingrelationshipsource
SHARED TOKENS (6): "among", "context", "developed", "maintaining", "relationship", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.320
completelicensepeoplesystemtrainingvary
SHARED TOKENS (6): "complete", "license", "people", "system", "training", "vary". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.320
environmentalparkingrampssmallspacewater
SHARED TOKENS (6): "environmental", "parking", "ramps", "small", "space", "water". | EXACT TITLE in outdoor_recreation: "Boat ramp".
0.320
Trout ↗ Q2258881 EXACT TITLE
adultsfoodlargernameprovidesource
SHARED TOKENS (6): "adults", "food", "larger", "name", "provide", "source". | EXACT TITLE in outdoor_recreation: "Trout".
0.320
bicycledesignedfeatureslargermountaintrail
SHARED TOKENS (6): "bicycle", "designed", "features", "larger", "mountain", "trail". | EXACT TITLE in outdoor_recreation: "Mountain biking".
0.320
activityrecreationrecreationalshapesnowwater
SHARED TOKENS (6): "activity", "recreation", "recreational", "shape", "snow", "water". | EXACT TITLE in outdoor_recreation: "Tubing (recreation)".
0.310
canyonconnectingeagleidahomeridiannamparivervalley
SHARED TOKENS (8): "canyon", "connecting", "eagle", "idaho", "meridian", "nampa", "river", "valley". | URL->A (1): https://www.fs.usda.gov/r04/boise.
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencybecomecommercialdescribeddevelopmentenvironmentenvironmentalexistingexpansionformgrowthinfrastructurelandmaintainingpeopleplanningprivaterequirerevenueroads
SHARED TOKENS (24): "agency", "become", "commercial", "described", "development", "environment", "environmental", "existing", "expansion", "form", "growth", "infrastructure", "land", "maintaining", "people", "planning", "private", "require", "revenue", "roads"....
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
becomecentralcomesdesignengineersenvironmentintersectionsmakesneedpedestrianrequireroadrulessafetysignalssignsthemthroughouttraffic
SHARED TOKENS (19): "become", "central", "comes", "design", "engineers", "environment", "intersections", "makes", "need", "pedestrian", "require", "road", "rules", "safety", "signals", "signs", "them", "throughout", "traffic".
0.300
agencyamongbeyondcommunitycontroldedicatedgovernmentlicenselicenseslicensingmanagementnaturalrecreationalregulatoryrequirerequiringresourcerevenue
SHARED TOKENS (18): "agency", "among", "beyond", "community", "control", "dedicated", "government", "license", "licenses", "licensing", "management", "natural", "recreational", "regulatory", "require", "requiring", "resource", "revenue".
0.300
businesscentercentraldedicateddesigneddevelopmentformgrowthlandnetworkplanningprivatepublicrelationshipscaleservingspaceurbanwalking
SHARED TOKENS (19): "business", "center", "central", "dedicated", "designed", "development", "form", "growth", "land", "network", "planning", "private", "public", "relationship", "scale", "serving", "space", "urban", "walking".
0.300
acresagencybusinessdepartmentdevelopmentfederalforestlandmajormanagementmanagesmillionnationalofficeoperationsparkprivatesystem
SHARED TOKENS (18): "acres", "agency", "business", "department", "development", "federal", "forest", "land", "major", "management", "manages", "million", "national", "office", "operations", "park", "private", "system".
0.300
alreadybecomeconditionconditionscurrentfoodhabitathistoricallocalmaintainingmethodsplacequalityratherrepairrestorationspacesupportwater
SHARED TOKENS (19): "already", "become", "condition", "conditions", "current", "food", "habitat", "historical", "local", "maintaining", "methods", "place", "quality", "rather", "repair", "restoration", "space", "support", "water".
0.300
accessibleadministrationagencyanothercommercialconstructiondepartmentdistributiondrivedrivingeconomyeducationenginesenvironmentalfederalhomeknowledgelandlicenseoperations
SHARED TOKENS (30): "accessible", "administration", "agency", "another", "commercial", "construction", "department", "distribution", "drive", "driving", "economy", "education", "engines", "environmental", "federal", "home", "knowledge", "land", "license", "operations"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritybicycledifferentestatefacilitygovernmentlandlocalownershippartspathspeoplephysicalprivaterealroadroadsrouteroutessimply
SHARED TOKENS (24): "authority", "bicycle", "different", "estate", "facility", "government", "land", "local", "ownership", "parts", "paths", "people", "physical", "private", "real", "road", "roads", "route", "routes", "simply"....
0.300
authoritybestcentralcommunitiescommunityconditionsconflictscreatingdependsdesigndevelopmentdistrictseconomicenvironmentalexposurefacilitiesfurtherlandmanagemeans
SHARED TOKENS (34): "authority", "best", "central", "communities", "community", "conditions", "conflicts", "creating", "depends", "design", "development", "districts", "economic", "environmental", "exposure", "facilities", "further", "land", "manage", "means"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelybecomecommunitiesconditioncreatecreatescurrentdescribesdevelopeddevelopmenteconomiceducationenvironmentalgeographygrowthinstitutionallandlargermajormerely
SHARED TOKENS (38): "approximately", "become", "communities", "condition", "create", "creates", "current", "describes", "developed", "development", "economic", "education", "environmental", "geography", "growth", "institutional", "land", "larger", "major", "merely"....
0.300
addinganotherbecomecapacityconditiondepartmentsdrivingintersectionslaneplanningpublicroadroadsroutetraffictransportationurban
SHARED TOKENS (17): "adding", "another", "become", "capacity", "condition", "departments", "driving", "intersections", "lane", "planning", "public", "road", "roads", "route", "traffic", "transportation", "urban".
0.300
capacitycapitalconnectingcorridorsdailydedicateddesigndesignedfeaturesintersectionslanesmillionnetworkpublicqualityridesinglesystemsystemstraffic
SHARED TOKENS (21): "capacity", "capital", "connecting", "corridors", "daily", "dedicated", "design", "designed", "features", "intersections", "lanes", "million", "network", "public", "quality", "ride", "single", "system", "systems", "traffic"....
0.300
advancedcapacityconditionsdifferentemergencyinformationinfrastructureinterfacesmanagementmobilityprovideroadroadssafetysignssystemsystemstraffictransportationusers
SHARED TOKENS (20): "advanced", "capacity", "conditions", "different", "emergency", "information", "infrastructure", "interfaces", "management", "mobility", "provide", "road", "roads", "safety", "signs", "system", "systems", "traffic", "transportation", "users".
0.300
accommodateconditionsdesigneddifferentemergencyenterequipmentevenformproviderequiresafetysmallspecializedsupportthemuserwaterwest
SHARED TOKENS (19): "accommodate", "conditions", "designed", "different", "emergency", "enter", "equipment", "even", "form", "provide", "require", "safety", "small", "specialized", "support", "them", "user", "water", "west".
0.300
appearsespeciallyevenfacilitiesfeaturesintersectionspedestrianplacepointsroadroadsrulessafetysignagesignalssignsstreettogethertrafficusers
SHARED TOKENS (20): "appears", "especially", "even", "facilities", "features", "intersections", "pedestrian", "place", "points", "road", "roads", "rules", "safety", "signage", "signals", "signs", "street", "together", "traffic", "users".
0.300
approximatelycompletedfeetformmilesmountainnationalnearofficialoregonparkparksroutesouthsystemtrailwestern
SHARED TOKENS (17): "approximately", "completed", "feet", "form", "miles", "mountain", "national", "near", "official", "oregon", "park", "parks", "route", "south", "system", "trail", "western".
0.300
activityformmethodspublicrecreational
SHARED TOKENS (5): "activity", "form", "methods", "public", "recreational". | EXACT TITLE in outdoor_recreation: "Birdwatching".
0.300
Trailhead ↗ Q7832815 KW CROSS HIGH
accessdefinesdistributionentityfeaturesmaintainingmajormapsmountainoutdoorparkingpathwaysspacetraffictrailwalking
SHARED TOKENS (16): "access", "defines", "distribution", "entity", "features", "maintaining", "major", "maps", "mountain", "outdoor", "parking", "pathways", "space", "traffic", "trail", "walking".
0.300
accessibilityactivityapproximatelybecomebicyclebikedesigneddistributionenvironmentalexpansionmaintenancemobilityoperatingoperationalphysicalprovidepublicregulatoryservingsystem
SHARED TOKENS (24): "accessibility", "activity", "approximately", "become", "bicycle", "bike", "designed", "distribution", "environmental", "expansion", "maintenance", "mobility", "operating", "operational", "physical", "provide", "public", "regulatory", "serving", "system"....
0.300
accessadvancedbuiltcapacitycentralcompletedconflictsconnectconnectedconnectingdesignedevenfreeintersectionsnetworkparkingpathspedestrianplannedprovide
SHARED TOKENS (35): "access", "advanced", "built", "capacity", "central", "completed", "conflicts", "connect", "connected", "connecting", "designed", "even", "free", "intersections", "network", "parking", "paths", "pedestrian", "planned", "provide"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellidahomajormilesnationalnearofficialoregonparkplannedpositioningriverroadroadsrouterulesthroughoutwestwestern
SHARED TOKENS (19): "caldwell", "idaho", "major", "miles", "national", "near", "official", "oregon", "park", "planned", "positioning", "river", "road", "roads", "route", "rules", "throughout", "west", "western".
0.300
agencybegandepartmenteducationenforcementengineersenvironmentalestablishingfederalfinancialgovernmentinformationlocalmaintainingmattersmonitoringnationalprogramspublicregional
SHARED TOKENS (20): "agency", "began", "department", "education", "enforcement", "engineers", "environmental", "establishing", "federal", "financial", "government", "information", "local", "maintaining", "matters", "monitoring", "national", "programs", "public", "regional".
0.300
communitiesconnectconnectivityconstructioncontrolcorridorcriticalcyclingenvironmentalevenfoodhabitatlandlocalmaintainingmanagementnationalnaturalpartsplace
SHARED TOKENS (30): "communities", "connect", "connectivity", "construction", "control", "corridor", "critical", "cycling", "environmental", "even", "food", "habitat", "land", "local", "maintaining", "management", "national", "natural", "parts", "place"....
0.300
connectsconsumerscurrentdirectdirectlydistributionevenformlocalmajormarketnetworksitethoughwestern
SHARED TOKENS (15): "connects", "consumers", "current", "direct", "directly", "distribution", "even", "form", "local", "major", "market", "network", "site", "though", "western".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedbicyclecapacitycontrolflowsinformationintersectionslanelocalnationalneedpedestrianroadsignalssouthsystemsystemstrafficusers
SHARED TOKENS (19): "advanced", "bicycle", "capacity", "control", "flows", "information", "intersections", "lane", "local", "national", "need", "pedestrian", "road", "signals", "south", "system", "systems", "traffic", "users".
0.300
announcedcentercreateitselfmilesnetworkoperatesoperatingprojectreportingroadrouteroutessystemtransportationwestwestern
SHARED TOKENS (17): "announced", "center", "create", "itself", "miles", "network", "operates", "operating", "project", "reporting", "road", "route", "routes", "system", "transportation", "west", "western".
0.300
accessadditionaladministrationannuallyapproximatelybeganbuiltcompleteconstructioncreatingdesigndesigneddevelopedfederalgovernmentintersectionsitselflanesmilesmillion
SHARED TOKENS (39): "access", "additional", "administration", "annually", "approximately", "began", "built", "complete", "construction", "creating", "design", "designed", "developed", "federal", "government", "intersections", "itself", "lanes", "miles", "million"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationanotherbroaderbuiltbusinesscapitalcategorycommunicationscommunitiescommunitycreatingdesigndevelopmentdifferentdistributionearlyeconomicenvironmentenvironmental
SHARED TOKENS (45): "accessibility", "administration", "another", "broader", "built", "business", "capital", "category", "communications", "communities", "community", "creating", "design", "development", "different", "distribution", "early", "economic", "environment", "environmental"....
0.300
activitybecomesdesignengineersenvironmentgovernmentlicenselocalmaintenancepartsproductsprojectprovidepublicrepairreportsrequiresafetysimply
SHARED TOKENS (19): "activity", "becomes", "design", "engineers", "environment", "government", "license", "local", "maintenance", "parts", "products", "project", "provide", "public", "repair", "reports", "require", "safety", "simply".
0.300
Skiing ↗ Q130949 EXACT TITLE
activityeventsrecreationalsnowwinter
SHARED TOKENS (5): "activity", "events", "recreational", "snow", "winter". | EXACT TITLE in outdoor_recreation: "Skiing".
0.300
Cycling ↗ Q53121 EXACT TITLE
activitybicyclebicyclingcyclingrecreation
SHARED TOKENS (5): "activity", "bicycle", "bicycling", "cycling", "recreation". | EXACT TITLE in outdoor_recreation: "Cycling". | EXACT TITLE in transportation_infrastructure: "Cycling".
0.300
additionaladvancedagenciesauthoritiesbeganbusinessescontactcorpsdepartmentdriveemergencyemsfacilitiespartsplacesprimaryprovidepublicrescueresources
SHARED TOKENS (28): "additional", "advanced", "agencies", "authorities", "began", "businesses", "contact", "corps", "department", "drive", "emergency", "ems", "facilities", "parts", "places", "primary", "provide", "public", "rescue", "resources"....
0.300
administrationagenciesamongcommunitiescontentcontrolcurrentdefinesdepartmentdesigndesigneddevelopedfederallawlocalnationalopenparkingpublicrequires
SHARED TOKENS (28): "administration", "agencies", "among", "communities", "content", "control", "current", "defines", "department", "design", "designed", "developed", "federal", "law", "local", "national", "open", "parking", "public", "requires"....
0.300
chaincorridorscreatesdevelopmenteasementsentityestatefederalfinancialforestgovernmentgrowthhabitatlandlocalmanagemanagedmarketnonprofitorganization
SHARED TOKENS (36): "chain", "corridors", "creates", "development", "easements", "entity", "estate", "federal", "financial", "forest", "government", "growth", "habitat", "land", "local", "manage", "managed", "market", "nonprofit", "organization"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
connectdesigndesigneddestinationeveninfrastructureinsidemanagemunicipalparkingparkspublicrequireroadssmallstreetsystemsvarywater
SHARED TOKENS (19): "connect", "design", "designed", "destination", "even", "infrastructure", "inside", "manage", "municipal", "parking", "parks", "public", "require", "roads", "small", "street", "systems", "vary", "water".
0.300
Ski resort ↗ Q130003 EXACT TITLE
activitydestinationdevelopedsystemwinter
SHARED TOKENS (5): "activity", "destination", "developed", "system", "winter". | EXACT TITLE in outdoor_recreation: "Ski resort".
0.300
classificationconditionscontentdifferentespeciallyeventeventsformhistorylargermethodsnearpatternshapesnowstructuresvaryweather
SHARED TOKENS (18): "classification", "conditions", "content", "different", "especially", "event", "events", "form", "history", "larger", "methods", "near", "pattern", "shape", "snow", "structures", "vary", "weather".
0.300
accesscommunitycompletecyclingdesigndesigneddrivingeconomicengineersenvironmentalhomeoperatedplannedpublicrequiressafesafetytraffictransportationtravel
SHARED TOKENS (23): "access", "community", "complete", "cycling", "design", "designed", "driving", "economic", "engineers", "environmental", "home", "operated", "planned", "public", "requires", "safe", "safety", "traffic", "transportation", "travel"....
🫐 BERRY51 edges
0.280
Boating ↗ Q2141830 EXACT TITLE
activityitselfrecreationaltravel
SHARED TOKENS (4): "activity", "itself", "recreational", "travel". | EXACT TITLE in outdoor_recreation: "Boating".
0.280
builtbusinessescentraldevelopmentdriveeconomicenvironmentalexpansionformationgrowthplannedresidentssouthurban
SHARED TOKENS (14): "built", "businesses", "central", "development", "drive", "economic", "environmental", "expansion", "formation", "growth", "planned", "residents", "south", "urban".
0.280
bikecompletecontextcontinuousequipmentfeaturesfeetfitnessmotorizedmountainsecondsidesingletravel
SHARED TOKENS (14): "bike", "complete", "context", "continuous", "equipment", "features", "feet", "fitness", "motorized", "mountain", "second", "side", "single", "travel".
0.280
contextdecisionsdefinesdevelopmentenvironmentalgovernedmajormanagementparticipationprojectpublicratherrequirerules
SHARED TOKENS (14): "context", "decisions", "defines", "development", "environmental", "governed", "major", "management", "participation", "project", "public", "rather", "require", "rules".
0.280
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdifferentformmultipleoperatesoperatingoperationssystemsystemstogethertrafficurban
SHARED TOKENS (14): "broader", "capacity", "conditions", "different", "form", "multiple", "operates", "operating", "operations", "system", "systems", "together", "traffic", "urban".
0.280
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcommunitiesconnectingdifferentdistrictsfeaturesinsidemultipleoperatespricingregionalsystemsurban
SHARED TOKENS (14): "business", "central", "communities", "connecting", "different", "districts", "features", "inside", "multiple", "operates", "pricing", "regional", "systems", "urban".
0.260
eagleidahopark
SHARED TOKENS (3): "eagle", "idaho", "park". | EXACT TITLE in outdoor_recreation: "Eagle Island State Park".
0.260
Snowshoe ↗ Q214724 KW CROSS HIGH
equipmentmotorizedoutdoorratherrecreationrolesnowspecializedthemtraveluserwalkingwinter
SHARED TOKENS (13): "equipment", "motorized", "outdoor", "rather", "recreation", "role", "snow", "specialized", "them", "travel", "user", "walking", "winter".
0.260
createenginesnatural
SHARED TOKENS (3): "create", "engines", "natural". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
becomedesigndrivingengineersespeciallymotorizedphysicalroadroadssafetysignstrafficurban
SHARED TOKENS (13): "become", "design", "driving", "engineers", "especially", "motorized", "physical", "road", "roads", "safety", "signs", "traffic", "urban".
0.260
departmentdepartmentsdirectlyeconomyfederalgovernmentmissionpeoplereportssafeservingsystemtransportation
SHARED TOKENS (13): "department", "departments", "directly", "economy", "federal", "government", "mission", "people", "reports", "safe", "serving", "system", "transportation".
0.260
networktraffictransportation
SHARED TOKENS (3): "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.260
Eminent domain ↗ Q166332 KW CROSS HIGH
anotherconnectdevelopmenteasementsevengovernmentlandmunicipalitiesownershipprivatepublicrequireroads
SHARED TOKENS (13): "another", "connect", "development", "easements", "even", "government", "land", "municipalities", "ownership", "private", "public", "require", "roads".
0.260
boisedowntownhomeidahomajormilesmountainnearoregonrangeriverrouteroutes
SHARED TOKENS (13): "boise", "downtown", "home", "idaho", "major", "miles", "mountain", "near", "oregon", "range", "river", "route", "routes".
0.240
accesschaindestinationdirectespeciallygroupitselfoperatingregionspecializedtransportationvary
SHARED TOKENS (12): "access", "chain", "destination", "direct", "especially", "group", "itself", "operating", "region", "specialized", "transportation", "vary".
0.240
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
boisecanyoncomeshomeidahomeridianmilesnamenampasecondwestwestern
SHARED TOKENS (12): "boise", "canyon", "comes", "home", "idaho", "meridian", "miles", "name", "nampa", "second", "west", "western".
0.240
creatingformnetworkpeopleprivateprogramsprovidepublicratherrouteroutesusers
SHARED TOKENS (12): "creating", "form", "network", "people", "private", "programs", "provide", "public", "rather", "route", "routes", "users".
0.240
Sagebrush steppe ↗ KW CROSS HIGH
becomecommunityformhabitatlandlocalopenqualityrecreationsourcewaterwest
SHARED TOKENS (12): "become", "community", "form", "habitat", "land", "local", "open", "quality", "recreation", "source", "water", "west".
0.240
conditionscreatesenvironmentevenhazardpeoplephysicalpublicsafetysignagesystemthem
SHARED TOKENS (12): "conditions", "creates", "environment", "even", "hazard", "people", "physical", "public", "safety", "signage", "system", "them".
0.230
agencydepartmentidahopreserving
SHARED TOKENS (4): "agency", "department", "idaho", "preserving". | URL->A (1): https://idfg.idaho.gov/.
0.220
activitydatadatedistributionequipmenthabitatinformationprimaryrecreationreportingspecialized
SHARED TOKENS (11): "activity", "data", "date", "distribution", "equipment", "habitat", "information", "primary", "recreation", "reporting", "specialized".
0.220
advancedbackcommunitydesigneddifferentequipmentfurtheroutdoorrequiresriverwater
SHARED TOKENS (11): "advanced", "back", "community", "designed", "different", "equipment", "further", "outdoor", "requires", "river", "water".
0.220
managementrecreational
SHARED TOKENS (2): "management", "recreational". | EXACT TITLE in outdoor_recreation: "Wildlife management area".
0.220
accessibilityadaagainstbusinesslawnationalprovidepublicrecommendedrequirementsrequires
SHARED TOKENS (11): "accessibility", "ada", "against", "business", "law", "national", "provide", "public", "recommended", "requirements", "requires".
0.220
Kayaking ↗ Q2094083 EXACT TITLE
sidewater
SHARED TOKENS (2): "side", "water". | EXACT TITLE in outdoor_recreation: "Kayaking".
0.220
constructiondesignengineersflowsintersectionsmaintenanceplanningroadsstructuraltraffictransportation
SHARED TOKENS (11): "construction", "design", "engineers", "flows", "intersections", "maintenance", "planning", "roads", "structural", "traffic", "transportation".
0.200
Nordic skiing ↗ Q216613 KW CROSS HIGH
comeseventeventsjurisdictionrecreationalrequirementsrequiresrulesskillstraining
SHARED TOKENS (10): "comes", "event", "events", "jurisdiction", "recreational", "requirements", "requires", "rules", "skills", "training".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahonamepartsschoolsstarwest
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "idaho", "name", "parts", "schools", "star", "west".
0.200
Bicycle safety ↗ Q516366 KW CROSS HIGH
bicyclebicyclingcyclingenvironmenteventinfrastructuremultipleroadsafetytraffic
SHARED TOKENS (10): "bicycle", "bicycling", "cycling", "environment", "event", "infrastructure", "multiple", "road", "safety", "traffic".
0.180
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
idahomilesoregonroutesouthsystemtrailwestwestern
SHARED TOKENS (9): "idaho", "miles", "oregon", "route", "south", "system", "trail", "west", "western".
0.180
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyconditionsdeterminedigitalmaintenancepartsrepairrolesigns
SHARED TOKENS (9): "already", "conditions", "determine", "digital", "maintenance", "parts", "repair", "role", "signs".
0.180
Native species ↗ Q169480 KW CROSS HIGH
economicenvironmentalhistorylocalnaturalplaceregiontermsthough
SHARED TOKENS (9): "economic", "environmental", "history", "local", "natural", "place", "region", "terms", "though".
0.180
Park and ride ↗ Q738031 KW CROSS HIGH
marketingparkparkingpeoplepublicrideroadsignssystem
SHARED TOKENS (9): "marketing", "park", "parking", "people", "public", "ride", "road", "signs", "system".
0.180
accessconnectingdesignedlocalmajorprovideroadroadstraffic
SHARED TOKENS (9): "access", "connecting", "designed", "local", "major", "provide", "road", "roads", "traffic".
0.180
approximatelyboisecaldwellcanyonidaholocallymilesoregonwest
SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "idaho", "locally", "miles", "oregon", "west".
0.180
Swimming hole ↗ Q7658373 KW CROSS HIGH
activitybecomeespeciallyhistorynaturalpartsplaceriverwater
SHARED TOKENS (9): "activity", "become", "especially", "history", "natural", "parts", "place", "river", "water".
0.160
beyondconstructiondrivingeventsforestrecreationalroadstransportation
SHARED TOKENS (8): "beyond", "construction", "driving", "events", "forest", "recreational", "roads", "transportation".
0.160
Leave No Trace ↗ Q559348 KW CROSS HIGH
centercreateframeworkoutdoorrecreationresourcesresponsetravel
SHARED TOKENS (8): "center", "create", "framework", "outdoor", "recreation", "resources", "response", "travel".
0.160
Fly fishing ↗ Q898886 KW CROSS HIGH
differenthabitatnaturalopensmallspecializedvarywater
SHARED TOKENS (8): "different", "habitat", "natural", "open", "small", "specialized", "vary", "water".
0.160
Green belt ↗ KW CROSS HIGH
developmentgreenbeltlandparkplanningsmallspaceurban
SHARED TOKENS (8): "development", "greenbelt", "land", "park", "planning", "small", "space", "urban".
0.160
designfacilitiesmanagementpeopleplanningprovidesafetransportation
SHARED TOKENS (8): "design", "facilities", "management", "people", "planning", "provide", "safe", "transportation".
0.140
commerciallicenselicensinglocalmanagementrecreationalwestern
SHARED TOKENS (7): "commercial", "license", "licensing", "local", "management", "recreational", "western".
0.140
Oversize load ↗ Q680421 KW CROSS HIGH
constructionequipmentinfrastructureroadstandardtransportationwater
SHARED TOKENS (7): "construction", "equipment", "infrastructure", "road", "standard", "transportation", "water".
0.120
commercialenvironmentlandmilitaryphysicalproducts
SHARED TOKENS (6): "commercial", "environment", "land", "military", "physical", "products".
0.120
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahonampawestern
SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "nampa", "western".
0.120
communitydifferenteducationformopenprograms
SHARED TOKENS (6): "community", "different", "education", "form", "open", "programs".
0.100
Streamflow ↗ Q29425295 KW CROSS HIGH
capacitycomeslandmajorwater
SHARED TOKENS (5): "capacity", "comes", "land", "major", "water".
0.100
gardenidahoroutetreasurevalley
SHARED TOKENS (5): "garden", "idaho", "route", "treasure", "valley".
0.100
adaconnectingidahoroutestar
SHARED TOKENS (5): "ada", "connecting", "idaho", "route", "star".
0.100
activityformoutdooruserswater
SHARED TOKENS (5): "activity", "form", "outdoor", "users", "water".
0.100
Wild camping ↗ Q2755308 KW CROSS HIGH
formmeansopensitestrail
SHARED TOKENS (5): "form", "means", "open", "sites", "trail".
◈ Frequently Asked Questions
Outdoor Recreation × Transportation Infrastructure — Treasure Valley
HAIKU · HIGH GATE
How do shared-use paths in Ada County connect outdoor recreation areas to residential neighborhoods?
Shared-use paths throughout Ada County provide direct pedestrian and bicycle access from Boise, Garden City, and Meridian to the Boise River and regional parks. The United States Army Corps of Engineers manages portions of the Boise River corridor, which shared-use paths utilize to link recreation opportunities with local transportation networks.
What role do transportation corridors play in accessing outdoor recreation across Canyon County municipalities?
Transportation corridors connecting Eagle, Meridian, and Kuna in Canyon County and Ada County enable residents to reach river recreation and public lands. Department of transportation planning in these municipalities coordinates road maintenance and pathway development to ensure reliable access to outdoor recreation opportunities.
How does Boise's transportation infrastructure support access to Treasure Valley outdoor recreation?
Boise's primary transportation routes connect the capital to recreation areas managed by the United States Army Corps of Engineers along the Boise River. Local departments in Boise coordinate with Ada County agencies to maintain shared-use paths and roads that provide outdoor recreation opportunities to residents across the Treasure Valley.
Why do shared-use paths in Meridian and Garden City matter for Treasure Valley recreation access?
Shared-use paths in Meridian and Garden City create transportation links to the Boise River and adjacent public lands, extending outdoor recreation opportunities beyond Ada County into the broader Treasure Valley. These paths enable local residents to access regional recreation without relying solely on automobile transportation.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Outdoor Recreation × Transportation Infrastructure 10 QID bridges 191 edges 5,309 ext links 2026-07-17 22:36:22 UTC b84db07cc6ba31a9
Outdoor Recreation corridor ↗ Transportation Infrastructure corridor ↗ Transportation Infrastructure × Outdoor Recreation ↗ boisestandard.org/standard ↗
Parent Corridors
Outdoor Recreation × All Other Verticals