—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Outdoor Recreation ↔ relates to ↔ Mining Gems

10 Wikipedia bridge articles confirmed in both vertical ledgers. 222 deterministic cross-vertical edges. 6,121 external source links harvested. Every edge provenance-stamped. Every claim auditable.

10 QID Bridge Articles
222 Cross Edges
6,121 External Sources
253 Wikipedia Articles
12 🌲 Evergreen
137 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Outdoor Recreation
× Mining Gems
QID Bridge Articles
10
confirmed Wikipedia overlap
Total Cross Edges
222
External Sources Harvested
6,121
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Bureau of Land Management
score: 1.0000  ·  type: exact_title_cross  ·  32 shared tokens
QID Bridge Titles (10)
Bureau of Land ManagementBoise National ForestTreasure ValleyBoise RiverUnited States Forest ServiceUnited States Army Corps of EngineersBoise, IdahoAda County, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboiselandnationalriveracresapproximatelydepartmentfederallandsmanagementofficeoregonprivatewesternforesthomeadacapitalagencies
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:35:43 UTC
Content Hash
9d0e6e9344621cd5
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
10 BRIDGES
Bureau of Land Management
Q1010556 EXACT TITLE 1.000
QID OVERLAP: Q1010556 in outdoor_recreation (tier:evergreen) and mining_gems (tier:evergreen). | SHARED TOKENS (32): "acres", "agencies", "agency", "among", "approximately", "blm", "bureau", "conservation", "department", "described", "estate", "federal", "government", "groups", "idaho", "land", "lands", "management", "manages", "million".... | EXACT TITLE in outdoor_recreation: "Bureau of Land Management". | EXACT TITLE in mining_gems: "Bureau of Land Management".
acresagenciesagencyamongapproximatelyblmbureauconservationdepartmentdescribedestatefederalgovernmentgroupsidaholandlandsmanagementmanagesmillionmissionnationalnevadaofficeoregonpermitsprivatepublicscenicsystem+2
t (BLM) is an agency within the United States Department of the Interior responsible for administering U.S. federal lands. Headquartered in Washington, D.C., the BLM oversees more than 247.3 million acres (1,001,000 km2) of land, or one-eighth of the United States's total landmass. The Bureau was created by Congress during the presidency of Harry S Truman in 1946 by combining two existing agencies: the United States General Land Office and the Grazing Service. The agency manages the federal government's nearly 700 million acres (2,800,000 km2) of subsurface mineral estate located beneath federal, state and private lands severed from their surface rights by the Homestead Act of 1862. Most BLM public lands are located in these 12 western states: Alaska, Arizona, California, Colorado, Idaho, Montana, Nevada, New Mexico, Oregon, Utah, Washington and Wyoming. The mission of the BLM is "to sustain the health, diversity, and productivity of the public lands for the use and enjoyment of present and future generations." Originally BLM holdings were described as "land nobody wanted" because homesteaders had passed them by. All the same, ranchers hold nearly 18,000 permits and leases for livestock grazing on 155 million acres (630,000 km2) of BLM public lands. The agency manages 263 wilderness areas, 31 national monuments and some 710 other protected areas as part of the National Conservation Lands (formerly known as the National Landscape Conservation System), totaling about 39.5 million acres (160,000 km2). In addition the National Conservation Lands include nearly 2,700 miles of Wild and Scenic Rivers, and nearly 6,000 miles of National Scenic and Historic Trails. There are more than 63,000 oil and gas wells on BLM public lands.
presidency of Harry S Truman in 1946 by combining two existing agencies: the United States General Land Office and the Grazing Service. The agency manages the federal government's nearly 700 million acres (2,800,000 km2) of subsurface mineral estate located beneath federal, state and private lands severed from their surface rights by the Homestead Act of 1862. Most BLM public lands are located in these 12 western states: Alaska, Arizona, California, Colorado, Idaho, Montana, Nevada, New Mexico, Oregon, Utah, Washington and Wyoming. The mission of the BLM is "to sustain the health, diversity, and productivity of the public lands for the use and enjoyment of present and future generations." Originally BLM holdings were described as "land nobody wanted" because homesteaders had passed them by. All the same, ranchers hold nearly 18,000 permits and leases for livestock grazing on 155 million acres (630,000 km2) of BLM public lands. The agency manages 263 wilderness areas, 31 national monuments and some 710 other protected areas as part of the National Conservation Lands (formerly known as the National Landscape Conservation System), totaling about 39.5 million acres (160,000 km2). In addition the National Conservation Lands include nearly 2,700 miles of Wild and Scenic Rivers, and nearly 6,000 miles of National Scenic and Historic Trails. There are more than 63,000 oil and gas wells on BLM public lands.
iginally BLM holdings were described as "land nobody wanted" because homesteaders had passed them by. All the same, ranchers hold nearly 18,000 permits and leases for livestock grazing on 155 million acres (630,000 km2) of BLM public lands. The agency manages 263 wilderness areas, 31 national monuments and some 710 other protected areas as part of the National Conservation Lands (formerly known as the National Landscape Conservation System), totaling about 39.5 million acres (160,000 km2). In addition the National Conservation Lands include nearly 2,700 miles of Wild and Scenic Rivers, and nearly 6,000 miles of National Scenic and Historic Trails. There are more than 63,000 oil and gas wells on BLM public lands.
Boise National Forest
Q891075 EXACT TITLE 1.000
QID OVERLAP: Q891075 in outdoor_recreation (tier:evergreen) and mining_gems (tier:evergreen). | SHARED TOKENS (25): "acres", "basin", "boise", "cascade", "districts", "early", "emmett", "facilities", "forest", "home", "idaho", "land", "managed", "motorized", "mountain", "multiple", "national", "people", "plant", "recreation".... | EXACT TITLE in outdoor_recreation: "Boise National Forest". | EXACT TITLE in mining_gems: "Boise National Forest".
acresbasinboisecascadedistrictsearlyemmettfacilitiesforesthomeidaholandmanagedmotorizedmountainmultiplenationalpeopleplantrecreationresourcesriverwaterwestwildlife
Boise National Forest is a National Forest covering 2,203,703 acres (8,918.07 km2) of the U.S. state of Idaho. Created on July 1, 1908, from part of Sawtooth National Forest, it is managed by the U.S. Forest Service as five units: the Cascade, Emmett, Idaho City, Lowman, and Mountain Home ranger districts. The Idaho Batholith underlies most of Boise National Forest, forming the forest's Boise, Salmon River, and West mountain ranges; the forest reaches a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
s a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
Archaeological evidence indicates that human habitation in Idaho began towards the end of the last ice age: bone fragments about 10,000 years old have been found in Wilson Butte Cave, an inflationary cave on the Snake River Plain believed to have been occupied by indigenous people until as recently as the 17th century. A change of climate around 7000 years ago dried up much of the Great Basin, forcing the Shoshone people northward into the mountainous areas of central Idaho. Most of what is now Boise National Forest was sparsely inhabited by Native Americans, and several archaeological sites, including campsites, rock shelters, burial grounds, and pictographs have been found along rivers in the area. Trappers and fur traders of European descent first arrived in the area in the early 1800s, starting with John Jacob Astor's Pacific Fur Company in October 1811. Donald Mackenzie and Francois Payette trapped in the area of Boise National Forest in 1819. By 1840, the fur trade was coming to an end, but the westward migration on the Oregon Trail, which passed south of the forest, was beginning. The first settlers moved into the mountains in the 1860s after gold was discovered in Idaho, which forced many of the Shoshone out and led to conflicts throughout the state, including the Bannock War in southern Idaho. Prospectors George Grimes and Moses Splawn were the first to discover gold in the forest at the eponymous Grimes Creek on August 2, 1862. Subsequent gold discoveries at Rocky Bar in 1863 and Atlanta in 1864 increased the rush of people to Idaho, and in 1863 Idaho City, with a population of 6,267, surpassed Portland, Oregon as the largest city in the Pacific Northwest. The Idaho gold rush was largely over by 1870, and the population of the Boise Basin fell from 16,000 to 3,500. In 1898 the forest's first gold dredge was built in Placerville and followed by several others. By 1951, when the last dredges shut down, at least 2.3 million ounces (65.2 million grams) of gold had been produced from the Boise Basin area. Silver was mined along the Crooked River from 1882 until 1921, but a silver mine at Silver Mountain proved unsuccessful. Following a shortage of mercury during World War II, mines in the Stibnite area became the country's largest producer of tungsten and second largest source of mercury. The most important known placer deposit of niobium and tantalum in the United States is located in Bear Valley. From 1953 until 1959, dredges there produced $12.5 million ($138 million today) in niobium, tantalum, and uranium. Other minerals mined in the forest include antimony and molybdenum. U.S. Forest Service Boise National Forest was created on July 1, 1908, from part of Sawtooth National Forest, and originally covered 1,147,360 acres (4,643.2 km2). By the Forest Reserve Act of 1891, the U.S. Congress granted the U.S. President the authority to establish forest reserves out of Public Domain Lands that were subject to disposal (homesteads, sales, etc.) administered by the United States General Land Office, which had been placed under the authority of the U.S. Department of the Interior in 1849. With the passage of the Transfer Act of 1905, forest reserves were transferred to the U.S. Department of Agriculture in the newly created U.S. Forest Service. Present-day Boise National Forest was first protected as part of two forest reserves by proclamations issued by President Theodore Roosevelt: Sawtooth Forest Reserve (created on May 29, 1905, and expanded on November 6, 1906) and Payette Forest Reserve (created on June 3, 1905). After forest reserves were renamed national forests in 1908, Boise National Forest was split from Sawtooth National Forest into an independent national forest. Emile Grandjean was the forest's first supervisor, serving from 1908 to 1922. On April 1, 1944, the entirety of what was then Payette National Forest was transferred to Boise National Forest, and simultaneously Weiser and Idaho national forests were combined to reestablish the present-day Payette National Forest, which is to the north of Boise National Forest. In 1933 the Boise Basin Experimental Forest was created on 8,740 acres (35.4 km2) of the forest near Idaho City to study the management of ponderosa pine. The Lucky Peak Nursery was established in 1959 to produce trees for planting on burned or logged lands on the national forests of the Intermountain region. After the creation of the Civilian Conservation Corps (CCC) in 1933, nine camps and eight subcamps were set up in Boise National Forest, but the number of camps was reduced from 1934 until the program was closed in 1942.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in outdoor_recreation (tier:evergreen) and mining_gems (tier:evergreen). | SHARED TOKENS (12): "boise", "idaho", "land", "local", "oregon", "region", "resources", "river", "snake", "treasure", "valley", "western". | EXACT TITLE in outdoor_recreation: "Treasure Valley". | EXACT TITLE in mining_gems: "Treasure Valley".
boiseidaholandlocaloregonregionresourcesriversnaketreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise River
Q891080 EXACT TITLE 0.920
QID OVERLAP: Q891080 in outdoor_recreation (tier:evergreen) and mining_gems (tier:evergreen). | SHARED TOKENS (11): "approximately", "boise", "forest", "idaho", "lands", "northeast", "river", "snake", "urban", "watershed", "western". | EXACT TITLE in outdoor_recreation: "Boise River". | EXACT TITLE in mining_gems: "Boise River".
approximatelyboiseforestidaholandsnortheastriversnakeurbanwatershedwestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
United States Forest Service
Q1891156 QID OVERLAP 0.800
QID OVERLAP: Q1891156 in outdoor_recreation (tier:branch) and mining_gems (tier:evergreen). | SHARED TOKENS (21): "acres", "agency", "bureau", "business", "department", "development", "federal", "forest", "land", "lands", "major", "management", "manages", "million", "national", "office", "operations", "park", "private", "system"....
acresagencybureaubusinessdepartmentdevelopmentfederalforestlandlandsmajormanagementmanagesmillionnationalofficeoperationsparkprivatesystemwildlife
e United States Forest Service (USFS) is an agency within the United States Department of Agriculture. It administers the nation's 154 national forests and 20 national grasslands covering 193 million acres (780,000 km2) of land. The major divisions of the agency are the Chief's Office, National Forest System, State and Private Forestry, Business Operations, as well as Research and Development. The agency manages about 25% of federal lands and is the sole major national land management agency not part of the U.S. Department of the Interior (which manages the National Park Service, the U.S.
In 1876, Congress formed the office of Special Agent in the Department of Agriculture to assess the quality and conditions of forests in the United States. Franklin B. Hough was appointed the head of the office. In 1881, the office was expanded into the newly formed Division of Forestry. The Forest Reserve Act of 1891 authorized withdrawing land from the public domain as forest reserves managed by the Department of the Interior. In 1901, the Division of Forestry was renamed the Bureau of Forestry. The Transfer Act of 1905 transferred the management of forest reserves from the United States General Land Office of the Interior Department to the Bureau of Forestry, henceforth known as the United States Forest Service. Gifford Pinchot was the first United States chief forester in the presidency of Theodore Roosevelt. A historical note to include is that the National Park Service was created in 1916 to manage Yellowstone and several other parks; in 1956, the Fish and Wildlife Service became the manager of lands reserved for wildlife. The Grazing Service and the United States General Land Office were combined to create the Bureau of Land Management in 1946. Also of note was that it was not until 1976 that the Federal Land Policy and Management Act became the national policy for retaining public land for federal ownership. Significant federal legislation affecting the Forest Service includes the Weeks Act of 1911, the Taylor Grazing Act of 1934, P.L. 73-482; the Multiple Use – Sustained Yield Act of 1960, P.L. 86-517; the Wilderness Act, P.L. 88-577; the National Forest Management Act, P.L. 94-588; the National Environmental Policy Act, P.L. 91–190; the Cooperative Forestry Assistance Act, P.L. 95-313; and the Forest and Rangelands Renewable Resources Planning Act, P.L. 95-307. From the early 1900s to the present, there has been a fierce rivalry over control of forests between the Department of Agriculture and the Department of the Interior. Their roles overlap but numerous proposals to combine the two have failed. In 2009, the Government Accountability Office (GAO) evaluated whether the Forest Service should be moved from the Department of Agriculture to the Department of the Interior, which already manages some 438 million acres (1,770,000 km2) of public land through the National Park Service, the Fish and Wildlife Service, and the Bureau of Land Management. GAO ultimately did not offer a recommendation upon the conclusion of its performance audit. The Forest Service remains a part of the USDA. In March 2026, President Donald Trump announced his plans to move the Forest Service's headquarters from Washington D.C.
As of 2019, FY 2020 Forest Service total budget authority is $5.14 billion, a decrease of $815 million from 2019. The budget includes $2.4 billion for Wildland Fire Management, a decrease of $530 million from the 2019 Annualized Continuing Resolution because the "fire fix" cap adjustment becomes available in FY 2020, while the FY 2019 Annualized Continuing Resolution includes $500 million above the base as bridge to the first year of the fire fix. The Forest Service, headquartered in Washington, D.C., has 27,062 permanent, full-time employees as of Sept. 20, 2018, including 541 in the headquarters office and 26,521 in regional and field office. In March 2026, the Forest Service announced the move of its main office to Salt Lake City, Utah, as part of a restructuring plan so their leaders can be closer to the forests and the people they serve in the West. The Chief of the Forest Service is a career federal employee who oversees the agency. The Chief reports to the Under Secretary for Natural Resources and Environment in the U.S. Department of Agriculture, an appointee of the President confirmed by the Senate. The Chief's staff provides broad policy and direction for the agency, works with the Administration to develop a budget to submit to Congress, provides information to Congress on accomplishments, and monitors activities of the agency. There are five deputy chiefs for the following areas: National Forest System, State and Private Forestry, Research and Development, Business Operations, and Finance. The USDA Forest Service's mission is to sustain the health, diversity, and productivity of the Nation's forests and grasslands to meet the needs of present and future generations. Its motto is "Caring for the land and serving people." As the lead federal agency in natural resource conservation, the Forest Service provides leadership in the protection, management, and use of the nation's forest, rangeland, and aquatic ecosystems. The agency's ecosystem approach to management integrates ecological, economic, and social factors to maintain and enhance the quality of the environment to meet current and future needs. Through implementation of land and resource management plans, the agency ensures sustainable ecosystems by restoring and maintaining species diversity and ecological productivity that helps provide recreation, water, timber, minerals, fish, wildlife, wilderness, and aesthetic values for current and future generations of people. The everyday work of the Forest Service balances resource extraction, resource protection, and providing recreation. The work includes managing 193 million acres (780,000 km2) of national forest and grasslands, including 59 million acres (240,000 km2) of roadless areas; 14,077 recreation sites; 143,346 miles (230,693 km) of trails; 374,883 miles (603,316 km) of roads; and the harvesting of 1.5 billion trees per year. Further, the Forest Service fought fires on 2.996 million acres (12,120 km2) of land in 2007. The Forest Service organization includes ranger districts, national forests, regions, research stations and research work units and the Northeastern Area Office for State and Private Forestry.
United States Army Corps of Engineers
Q1049334 QID OVERLAP 0.800
QID OVERLAP: Q1049334 in outdoor_recreation (tier:branch) and mining_gems (tier:evergreen). | SHARED TOKENS (52): "activities", "agencies", "approximately", "army", "authority", "business", "capacity", "clean", "construction", "control", "corps", "department", "design", "direct", "directly", "economy", "ecosystem", "engineers", "environment", "environmental"....
activitiesagenciesapproximatelyarmyauthoritybusinesscapacitycleanconstructioncontrolcorpsdepartmentdesigndirectdirectlyeconomyecosystemengineersenvironmentenvironmentalfacilitiesfederalformgovernmentinfrastructurejunemaintenancemanagedmanagementmarch+22
ilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
The National Defense Act of 1916 authorized a reserve corps in the Army, and the Engineer Officers' Reserve Corps and the Engineer Enlisted Reserve Corps became one of the branches. Some of these personnel were called into active service for World War I. An example of this was the 510th and 511th Engineer Service Battalions. These two military units were organized at Camp Lee, Va, and consisted of black soldiers (draftees), white officers, and non-commissioned officers. From the beginning, many politicians wanted the Corps of Engineers to contribute to both military construction and civil works. Assigned the military construction mission on 1 December 1941, after the Quartermaster Department struggled with the expanding mission, the Corps built facilities at home and abroad to support the U.S. Army and Air Force. During World War II the USACE program expanded to more than 27,000 military and industrial projects in a $15.3 billion mobilization effort. Included were aircraft, tank assembly, and ammunition plants; camps for 5.3 million soldiers; depots, ports, and hospitals; and the rapid construction of such landmark projects such as the Manhattan Project at Los Alamos, Hanford and Oak Ridge among other places, and the Pentagon, the Department of Defense headquarters across the Potomac from Washington, DC. In civilian projects, the Corps of Engineers became the lead federal navigation and flood control agency. Congress significantly expanded its civil works activities, becoming a major provider of hydroelectric energy and the country's leading provider of recreation. Its role in responding to natural disasters also grew dramatically, especially following the devastating Mississippi Flood of 1927. In the late 1960s, the agency became a leading environmental preservation and restoration agency. In 1944, specially trained army combat engineers were assigned to blow up underwater obstacles and clear defended ports during the invasion of Normandy. During World War II, the Army Corps of Engineers in the European Theater of Operations was responsible for building numerous bridges, including the first and longest floating tactical bridge across the Rhine at Remagen, and building or maintaining roads vital to the Allied advance across Europe into the heart of Germany. In the Pacific theater, the "Pioneer troops" were formed, a hand-selected unit of volunteer Army combat engineers trained in jungle warfare, knife fighting, and unarmed jujitsu (hand-to-hand combat) techniques. Working in camouflage, the Pioneers cleared jungle, prepared routes of advance and established bridgeheads for the infantry, as well as demolishing enemy installations. Five commanding generals (chiefs of staff after the 1903 reorganization) of the United States Army held engineer commissions early in their careers. All transferred to other branches before being promoted to the top position. They were Alexander Macomb, George B. McClellan, Henry W. Halleck, Douglas MacArthur, and Maxwell D.
The General Survey Act of 1824 authorized use of army engineers to survey roads and canals. The next month, an act to improve navigation on the Ohio and Mississippi rivers initiated the Corps of Engineers' permanent civil works construction mission. Although the 1824 act to improve the Mississippi and Ohio rivers is often called the first rivers and harbors legislation, the act passed in 1826 was the first to combine authorizations for both surveys and projects, thereby establishing a pattern that continues to the present day. Survey and construction of the National Road until Federal funds were withdrawn (1838) The 555 ft 5+1⁄8 in (169.29 m) tall Washington Monument, completed under the direction and command of Lieutenant Colonel Thomas Lincoln Casey, 1884 Construction of Fort Baldwin as part of the Harbor Defenses of Portland during the Endicott Period (1905-1912) Panama Canal, completed under supervision of Army Engineer officers, 1914 Flood Control Act of 1936 made flood control a federal policy and officially recognized the Corps of Engineers as the major federal flood control agency Bonneville Dam, completed in 1937 Flood Control Act of 1941, which channelized the Los Angeles River and parts of the Santa Ana River USACE took over all real estate acquisition, construction, and maintenance for army facilities, 1941 There was no road between Costa Rica and Panama until the Corps began one in 1941–1943. The concern was access to the Panama Canal during wartime. The Manhattan Project (1942–1946) Planning and construction of the Pentagon, completed in 1943 just 16 months after groundbreaking Comprehensive Everglades Restoration Plan, first authorized by congress in 1948 USACE began construction support for NASA leading to major activities at the Manned Spacecraft Center and Kennedy Space Center, 1961 King Khalid Military City 1973–1987 The Water Resources Development Act of 1986 (WRDA 86) brought major change in financing by requiring non-federal contributions toward most federal water resource projects Cross Florida Barge Canal Tennessee-Tombigbee Waterway Occasional civil disasters, including the Great Mississippi Flood of 1927, resulted in greater responsibilities for the Corps of Engineers.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in outdoor_recreation (tier:branch) and mining_gems (tier:branch). | SHARED TOKENS (13): "ada", "boise", "capital", "home", "idaho", "locally", "major", "nevada", "north", "oregon", "river", "treasure", "valley".
adaboisecapitalhomeidaholocallymajornevadanorthoregonrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in outdoor_recreation (tier:evergreen) and mining_gems (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "cascade", "district", "home", "idaho", "local", "private", "roads", "second".
adaboisecapitalcascadedistricthomeidaholocalprivateroadssecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in outdoor_recreation (tier:branch) and mining_gems (tier:branch). | SHARED TOKENS (6): "ada", "among", "boise", "capital", "idaho", "second".
adaamongboisecapitalidahosecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in outdoor_recreation (tier:branch) and mining_gems (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "nampa".
boisecaldwellcanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
212 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP212 edges
🌲 EVERGREEN2 edges
0.650
basinbogusboiseconditionsforestidaholandmountainnationaloperatedprivaterecreationroadrunswestern
SHARED TOKENS (15): "basin", "bogus", "boise", "conditions", "forest", "idaho", "land", "mountain", "national", "operated", "private", "recreation", "road", "runs", "western". | URL->A (1): http://www.bogusbasin.org/. | EXACT TITLE in outdoor_recreation: "Bogus Basin". | EXACT TITLE in mining_gems: "Bogus Basin".
0.650
acresadaadditionalamericablmboisebureaucanyonconservationcreatingdamdeepdifferentecosystemgoldenhistoricalhomeidahoimportantland
SHARED TOKENS (41): "acres", "ada", "additional", "america", "blm", "boise", "bureau", "canyon", "conservation", "creating", "dam", "deep", "different", "ecosystem", "golden", "historical", "home", "idaho", "important", "land".... | URL->A (1): https://www.blm.gov/programs/national-conservation-lands/idaho/morley-nelson-snake-river-birds-of-prey. | EXACT TITLE in outdoor_recreation: "Morley Nelson Snake River Birds of Prey National Conservation Area".
🌿 BRANCH137 edges
0.590
causeentityenvironmentenvironmentalgovernmenthazardsmaintenanceoperationalpublicrestorationsafetysite
SHARED TOKENS (12): "cause", "entity", "environment", "environmental", "government", "hazards", "maintenance", "operational", "public", "restoration", "safety", "site". | URL->B (1): https://www.msha.gov/. | EXACT TITLE in mining_gems: "Abandoned mine".
0.590
administrationagencyconditionsdepartmentdifferentdistrictsfederalhazardsmeansofficeoperationssafety
SHARED TOKENS (12): "administration", "agency", "conditions", "department", "different", "districts", "federal", "hazards", "means", "office", "operations", "safety". | URL->B (1): http://www.msha.gov/. | EXACT TITLE in mining_gems: "Mine Safety and Health Administration".
0.570
agencyboisedepartmentenvironmentalfederalgovernmentidahomainofficesqualityregional
SHARED TOKENS (11): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "main", "offices", "quality", "regional". | URL->B (1): https://www.deq.idaho.gov/. | EXACT TITLE in mining_gems: "Idaho Department of Environmental Quality".
0.510
agencydepartmentgovernmentidahomanagesprogramsrecreationthroughout
SHARED TOKENS (8): "agency", "department", "government", "idaho", "manages", "programs", "recreation", "throughout". | URL->A (1): https://parksandrecreation.idaho.gov/. | EXACT TITLE in outdoor_recreation: "Idaho Department of Parks and Recreation".
0.500
Uranium ↗ Q1098 EXACT TITLE
anotherchainconcentrationdifferentdiscoveryenvironmentalevenfacilitiesformsheatledmillionnaturalprimaryprogramsrelatedrocktablethemwater
SHARED TOKENS (20): "another", "chain", "concentration", "different", "discovery", "environmental", "even", "facilities", "forms", "heat", "led", "million", "natural", "primary", "programs", "related", "rock", "table", "them", "water". | EXACT TITLE in mining_gems: "Uranium".
0.500
activityanotherconnectedconservationdesigndesigneddevelopeddistributionlocalmainplacesqualitysystemsystemstermsthoughwater
SHARED TOKENS (17): "activity", "another", "connected", "conservation", "design", "designed", "developed", "distribution", "local", "main", "places", "quality", "system", "systems", "terms", "though", "water". | EXACT TITLE in mining_gems: "Hydrogeology".
0.500
Mining ↗ Q44497 EXACT TITLE
activitiesbusinesscommunitiescommunityenvironmentalespeciallyevenhabitatlandlocalmeansnaturaloperationsreclamationresourcerestorationrockrolesafetythem
SHARED TOKENS (24): "activities", "business", "communities", "community", "environmental", "especially", "even", "habitat", "land", "local", "means", "natural", "operations", "reclamation", "resource", "restoration", "rock", "role", "safety", "them".... | EXACT TITLE in mining_gems: "Mining".
0.500
Wildfire ↗ Q169950 EXACT TITLE
canadacausecreatecreatesdirecteconomicequipmentespeciallyeventfireforestgrowthheatinterfaceslandmanagementnaturalopenoregonphysical
SHARED TOKENS (26): "canada", "cause", "create", "creates", "direct", "economic", "equipment", "especially", "event", "fire", "forest", "growth", "heat", "interfaces", "land", "management", "natural", "open", "oregon", "physical".... | EXACT TITLE in outdoor_recreation: "Wildfire". | EXACT TITLE in mining_gems: "Wildfire".
0.500
Sand ↗ Q34679 EXACT TITLE
conditionsconstructionecosystemformformslifelocalmassmillionnationalparkplacesprimaryresourcerocksecondsourceswildlife
SHARED TOKENS (18): "conditions", "construction", "ecosystem", "form", "forms", "life", "local", "mass", "million", "national", "park", "places", "primary", "resource", "rock", "second", "sources", "wildlife". | EXACT TITLE in outdoor_recreation: "Sand". | EXACT TITLE in mining_gems: "Sand".
0.500
activitiesbegancompletecreatesenvironmentalhistorylandmunicipalphysicalplanningreclamationresourcesrestorationsitesthroughout
SHARED TOKENS (15): "activities", "began", "complete", "creates", "environmental", "history", "land", "municipal", "physical", "planning", "reclamation", "resources", "restoration", "sites", "throughout". | EXACT TITLE in mining_gems: "Mine reclamation".
0.500
activitiesagencyalcoholbureaudepartmentenforcementfederalfirelawlicensinglocaloperatesproductsprojecttransportation
SHARED TOKENS (15): "activities", "agency", "alcohol", "bureau", "department", "enforcement", "federal", "fire", "law", "licensing", "local", "operates", "products", "project", "transportation". | EXACT TITLE in mining_gems: "Bureau of Alcohol, Tobacco, Firearms and Explosives".
0.500
acresagencybecomebuiltbureaudepartmentdevelopmentfederalgovernmentjunelandslawmanagementmillionpeoplereclamationresourcerevenuesecondsource
SHARED TOKENS (24): "acres", "agency", "become", "built", "bureau", "department", "development", "federal", "government", "june", "lands", "law", "management", "million", "people", "reclamation", "resource", "revenue", "second", "source".... | EXACT TITLE in outdoor_recreation: "Bureau of Reclamation".
0.500
Zinc ↗ Q758 EXACT TITLE
alcoholamongbackcausecenterclassescommunitiesconcentrationdevelopmentearlyformgrowthimportantmajorpeopleprimaryregionscalesecondstructures
SHARED TOKENS (24): "alcohol", "among", "back", "cause", "center", "classes", "communities", "concentration", "development", "early", "form", "growth", "important", "major", "people", "primary", "region", "scale", "second", "structures".... | EXACT TITLE in mining_gems: "Zinc".
0.500
acresagencyconservationdepartmentfiregovernmentidaholandlandsmanagesmillionofficesoperatesprogramsprotectionpublicschools
SHARED TOKENS (17): "acres", "agency", "conservation", "department", "fire", "government", "idaho", "land", "lands", "manages", "million", "offices", "operates", "programs", "protection", "public", "schools". | EXACT TITLE in mining_gems: "Idaho Department of Lands".
0.500
State park ↗ Q1761072 EXACT TITLE
administrationcanadaconservationdesignededucationalexperiencefederalgovernmenthistoryimportantlocalmanagednationalnaturalparkpreserveprogramsratherrecreationalregional
SHARED TOKENS (24): "administration", "canada", "conservation", "designed", "educational", "experience", "federal", "government", "history", "important", "local", "managed", "national", "natural", "park", "preserve", "programs", "rather", "recreational", "regional".... | EXACT TITLE in outdoor_recreation: "State park".
0.500
basinidaholargermajormountainsnationalnearnorthrecreationriversnakesouthvalleywatershedwest
SHARED TOKENS (15): "basin", "idaho", "larger", "major", "mountains", "national", "near", "north", "recreation", "river", "snake", "south", "valley", "watershed", "west". | EXACT TITLE in mining_gems: "Payette River".
0.500
becomechainconflictcreatecriticaldepartmenteconomicespeciallyexpansiongovernmentimportantmakesmanagementmanagesmilitaryneedproductsratherregionrequire
SHARED TOKENS (26): "become", "chain", "conflict", "create", "critical", "department", "economic", "especially", "expansion", "government", "important", "makes", "management", "manages", "military", "need", "products", "rather", "region", "require".... | EXACT TITLE in mining_gems: "Strategic material".
0.500
acresadaarmyboisecorpsdamdiscoveryengineershomeidaholuckynearparkpublicrecreationriver
SHARED TOKENS (16): "acres", "ada", "army", "boise", "corps", "dam", "discovery", "engineers", "home", "idaho", "lucky", "near", "park", "public", "recreation", "river". | EXACT TITLE in outdoor_recreation: "Lucky Peak State Park".
0.500
Silicon ↗ Q670 EXACT TITLE
amongcommunicationsconstructiondescribeddigitalearlyeconomyfamilyformformsinformationmarketmassnaturalphysicalplantroadssecondstructurestable
SHARED TOKENS (22): "among", "communications", "construction", "described", "digital", "early", "economy", "family", "form", "forms", "information", "market", "mass", "natural", "physical", "plant", "roads", "second", "structures", "table".... | EXACT TITLE in mining_gems: "Silicon".
0.500
Concrete ↗ Q22657 EXACT TITLE
allowsalreadyanotherconstructionearlyformformsitselfmassmeansphysicalproviderepairroadroleshapestructuralwaterworld
SHARED TOKENS (19): "allows", "already", "another", "construction", "early", "form", "forms", "itself", "mass", "means", "physical", "provide", "repair", "road", "role", "shape", "structural", "water", "world". | EXACT TITLE in mining_gems: "Concrete".
0.500
beyondboiseconnectsdameagleidaholuckymotorizedrecreationalriverroadroutessystemtrailtransportationurbanwest
SHARED TOKENS (17): "beyond", "boise", "connects", "dam", "eagle", "idaho", "lucky", "motorized", "recreational", "river", "road", "routes", "system", "trail", "transportation", "urban", "west". | EXACT TITLE in outdoor_recreation: "Boise River Greenbelt".
0.500
chainchannelsconsumerscreatingdirectdirectlydistributionfacilitiesgoodsmanagementnetworkproductsstructuresupplierssystemsystemsthemvalue
SHARED TOKENS (18): "chain", "channels", "consumers", "creating", "direct", "directly", "distribution", "facilities", "goods", "management", "network", "products", "structure", "suppliers", "system", "systems", "them", "value". | EXACT TITLE in mining_gems: "Supply chain".
0.500
Dredging ↗ Q852170 EXACT TITLE
activitiesbuiltcommercialcreatecreatingeconomicenvironmentenvironmentalfeatureslandlifelong-termmainplantsourcessystemsvaluablevaluewaterwildlife
SHARED TOKENS (20): "activities", "built", "commercial", "create", "creating", "economic", "environment", "environmental", "features", "land", "life", "long-term", "main", "plant", "sources", "systems", "valuable", "value", "water", "wildlife". | EXACT TITLE in mining_gems: "Dredging".
0.500
accessadministrationagencyassetauthoritiesbusinessdepartmentdevelopmentemergencyfederalgovernmentinfrastructurelocalmajormanagementprimaryprovideresourcesresponsespecialized
SHARED TOKENS (23): "access", "administration", "agency", "asset", "authorities", "business", "department", "development", "emergency", "federal", "government", "infrastructure", "local", "major", "management", "primary", "provide", "resources", "response", "specialized".... | EXACT TITLE in mining_gems: "Federal Emergency Management Agency".
0.500
Fishing ↗ Q14373 EXACT TITLE
activitiesactivityadditionalcommercialdirectemploymentenvironmentfoodimportantlong-termmillionnaturalparkpeopleproviderecreationaltermswaterwildlife
SHARED TOKENS (19): "activities", "activity", "additional", "commercial", "direct", "employment", "environment", "food", "important", "long-term", "million", "natural", "park", "people", "provide", "recreational", "terms", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Fishing".
0.500
Geophysics ↗ Q46255 EXACT TITLE
backbroaderconnectsdatadeepdevelopmentearlyenvironmentenvironmentalexplorationextendingformationframeworkhazardsmonitoringnaturalphysicalresourcesrockshape
SHARED TOKENS (23): "back", "broader", "connects", "data", "deep", "development", "early", "environment", "environmental", "exploration", "extending", "formation", "framework", "hazards", "monitoring", "natural", "physical", "resources", "rock", "shape".... | EXACT TITLE in mining_gems: "Geophysics".
0.500
Hunting ↗ EXACT TITLE
activitiesagainstbecomecapacityconservationcontrolecologicalenvironmentespeciallyevenfoodformimportantlawmaintenancemanagementmeansnaturalprimaryproducts
SHARED TOKENS (29): "activities", "against", "become", "capacity", "conservation", "control", "ecological", "environment", "especially", "even", "food", "form", "important", "law", "maintenance", "management", "means", "natural", "primary", "products".... | EXACT TITLE in outdoor_recreation: "Hunting".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciesbasinborderscanyoncentralcommercialconflictconstructioncontroldamdevelopeddownstreamfeatureshabitathistoryidahoimportantmajormilitary
SHARED TOKENS (43): "activities", "agencies", "basin", "borders", "canyon", "central", "commercial", "conflict", "construction", "control", "dam", "developed", "downstream", "features", "habitat", "history", "idaho", "important", "major", "military".... | EXACT TITLE in outdoor_recreation: "Snake River". | EXACT TITLE in mining_gems: "Snake River".
0.500
addingcapacityconcentrationconditionscontrolcreatingcriticalcurrentdevelopmentdifferentearlyformheatlednearphysicalsinglestructuretablethroughout
SHARED TOKENS (20): "adding", "capacity", "concentration", "conditions", "control", "creating", "critical", "current", "development", "different", "early", "form", "heat", "led", "near", "physical", "single", "structure", "table", "throughout". | EXACT TITLE in mining_gems: "Semiconductor".
0.500
Phosphate ↗ Q46220103 EXACT TITLE
amongcauseeconomicenvironmentespeciallyformgroupsgrowthimportantmajormeansnamesplantrolesourceworld
SHARED TOKENS (16): "among", "cause", "economic", "environment", "especially", "form", "groups", "growth", "important", "major", "means", "names", "plant", "role", "source", "world". | EXACT TITLE in mining_gems: "Phosphate".
0.500
activitiesadditionalagenciesallowsdatadevelopedfacilitiesfederalgovgovernmentinformationlistingsmanagedpermitsplanningplatformrecreationsitesitessystem
SHARED TOKENS (21): "activities", "additional", "agencies", "allows", "data", "developed", "facilities", "federal", "gov", "government", "information", "listings", "managed", "permits", "planning", "platform", "recreation", "site", "sites", "system".... | EXACT TITLE in outdoor_recreation: "Recreation.gov".
0.500
agenciesagencyapplyauthoritydefinitiondesignedenvironmentenvironmentalfederalgovernmentlawnationalpreservequalityreportsrequirementsrequiresworld
SHARED TOKENS (18): "agencies", "agency", "apply", "authority", "definition", "designed", "environment", "environmental", "federal", "government", "law", "national", "preserve", "quality", "reports", "requirements", "requires", "world". | EXACT TITLE in mining_gems: "National Environmental Policy Act".
0.500
agencyarmycleanconservationcontrolcoordinationcorpsdirectlyengineersenvironmentalfederalformlawmaintainingmajorphysicalprimaryprotectionqualityresource
SHARED TOKENS (22): "agency", "army", "clean", "conservation", "control", "coordination", "corps", "directly", "engineers", "environmental", "federal", "form", "law", "maintaining", "major", "physical", "primary", "protection", "quality", "resource".... | EXACT TITLE in mining_gems: "Clean Water Act".
0.500
acresagencydepartmentdistrictecologicalemploysfederalheadquartershistoricalmainmanagementmanagesmillionnationalnaturalparkpeopleplacespublicrecreational
SHARED TOKENS (21): "acres", "agency", "department", "district", "ecological", "employs", "federal", "headquarters", "historical", "main", "management", "manages", "million", "national", "natural", "park", "people", "places", "public", "recreational".... | EXACT TITLE in mining_gems: "National Park Service".
0.500
Lead ↗ Q708 EXACT TITLE
causeconstructiondevelopmentexposureformitselfmajormillionnearpeopleratherrolestructuressystemsystems
SHARED TOKENS (15): "cause", "construction", "development", "exposure", "form", "itself", "major", "million", "near", "people", "rather", "role", "structures", "system", "systems". | EXACT TITLE in mining_gems: "Lead".
0.500
adabasinbogusboisecentercentralconnectedgardenidahoitselfmountainnationalnearbyrecreationroadsstarvalleywestern
SHARED TOKENS (18): "ada", "basin", "bogus", "boise", "center", "central", "connected", "garden", "idaho", "itself", "mountain", "national", "nearby", "recreation", "roads", "star", "valley", "western". | EXACT TITLE in mining_gems: "Boise County, Idaho".
0.500
Optical fiber ↗ Q162 EXACT TITLE
anothercontactcoredatadesigndesignedimportantlinksmeanssinglespacesspecializedsupporttemporarythem
SHARED TOKENS (15): "another", "contact", "core", "data", "design", "designed", "important", "links", "means", "single", "spaces", "specialized", "support", "temporary", "them". | EXACT TITLE in mining_gems: "Optical fiber".
0.500
Recycling ↗ Q132580 EXACT TITLE
anothercenterconservationcontroldependsdifferenteconomicenvironmentalfoodformgardenmanagementnatureofficeproductsrelatedresourcesourcessustainabilitysystem
SHARED TOKENS (22): "another", "center", "conservation", "control", "depends", "different", "economic", "environmental", "food", "form", "garden", "management", "nature", "office", "products", "related", "resource", "sources", "sustainability", "system".... | EXACT TITLE in mining_gems: "Recycling".
0.500
Open space ↗ Q1451377 EXACT TITLE
businesschaincommunityconservationdesigndevelopmentespeciallygenericlandmakesopenparkpeopleplanningpublicrecreationalreservereservesrockspaces
SHARED TOKENS (22): "business", "chain", "community", "conservation", "design", "development", "especially", "generic", "land", "makes", "open", "park", "people", "planning", "public", "recreational", "reserve", "reserves", "rock", "spaces".... | EXACT TITLE in outdoor_recreation: "Open space".
0.500
additionalagencyauthoritybusinessdepartmentenforcementfederalfiregovernmentlawmissionmonitoringofficeprotectionresponseterms
SHARED TOKENS (16): "additional", "agency", "authority", "business", "department", "enforcement", "federal", "fire", "government", "law", "mission", "monitoring", "office", "protection", "response", "terms". | EXACT TITLE in mining_gems: "Federal Trade Commission".
0.500
Data center ↗ Q671224 EXACT TITLE
agencyamericabackcentercleanconditionscontroldatadefinesdifferentdigitalearlyedgeenvironmentalequipmentfacilitiesfacilitygrowthinformationinfrastructure
SHARED TOKENS (44): "agency", "america", "back", "center", "clean", "conditions", "control", "data", "defines", "different", "digital", "early", "edge", "environmental", "equipment", "facilities", "facility", "growth", "information", "infrastructure".... | EXACT TITLE in mining_gems: "Data center".
0.500
Tailings ↗ Q1784525 EXACT TITLE
contentdevelopeddifferenteconomicenvironmentalespeciallyformmajormanagementrequiresrocksourcesvaluablevaluewater
SHARED TOKENS (15): "content", "developed", "different", "economic", "environmental", "especially", "form", "major", "management", "requires", "rock", "sources", "valuable", "value", "water". | EXACT TITLE in mining_gems: "Tailings".
0.500
Nickel ↗ Q744 EXACT TITLE
backcanadaconditionsespeciallyevenformsgoldenimportantlargerlayermajornaturalproductsregionsitesitesthoughwesternworld
SHARED TOKENS (19): "back", "canada", "conditions", "especially", "even", "forms", "golden", "important", "larger", "layer", "major", "natural", "products", "region", "site", "sites", "though", "western", "world". | EXACT TITLE in mining_gems: "Nickel".
0.500
americabusinesscompletecompletedconnectedcurrentespeciallyformidaholedmountainsnearnorthoregonriverroadsrouteroutestraffictrail
SHARED TOKENS (23): "america", "business", "complete", "completed", "connected", "current", "especially", "form", "idaho", "led", "mountains", "near", "north", "oregon", "river", "roads", "route", "routes", "traffic", "trail".... | EXACT TITLE in outdoor_recreation: "Oregon Trail".
0.480
basinbureaucanadadefinitionlandsmajormountainsnevadanorthriversouthsouthwestwestwestern
SHARED TOKENS (14): "basin", "bureau", "canada", "definition", "lands", "major", "mountains", "nevada", "north", "river", "south", "southwest", "west", "western". | EXACT TITLE in mining_gems: "Western United States".
0.480
Picnic ↗ Q506294 EXACT TITLE
differentearlyespeciallyeventfoodformformshomeinformalparkpublicrequiresscenicwater
SHARED TOKENS (14): "different", "early", "especially", "event", "food", "form", "forms", "home", "informal", "park", "public", "requires", "scenic", "water". | EXACT TITLE in outdoor_recreation: "Picnic".
0.460
Explosive ↗ Q12870 EXACT TITLE
becomeclearconditionsdispersedevenformsheatmerelyprimaryratherrequiresimplyspans
SHARED TOKENS (13): "become", "clear", "conditions", "dispersed", "even", "forms", "heat", "merely", "primary", "rather", "require", "simply", "spans". | EXACT TITLE in mining_gems: "Explosive".
0.460
acresboisecanyondamdepartmentfloodplainsidahomanagementnearriversnakewaterwildlife
SHARED TOKENS (13): "acres", "boise", "canyon", "dam", "department", "floodplains", "idaho", "management", "near", "river", "snake", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Fort Boise Wildlife Management Area".
0.460
agenciesagencydepartmentequipmentfederalmilitarynaturalprogramsrepairsupportsupportsthroughoutworld
SHARED TOKENS (13): "agencies", "agency", "department", "equipment", "federal", "military", "natural", "programs", "repair", "support", "supports", "throughout", "world". | EXACT TITLE in mining_gems: "Defense Logistics Agency".
0.460
Substation ↗ Q174814 EXACT TITLE
approximatelycentralcommercialconnectedcontroldifferentdistributionimportantinfrastructurelargeroperatedplantsystem
SHARED TOKENS (13): "approximately", "central", "commercial", "connected", "control", "different", "distribution", "important", "infrastructure", "larger", "operated", "plant", "system". | EXACT TITLE in mining_gems: "Substation".
0.440
amongapproximatelyboiseidahomainofficesoperatesparkpublicrepresentedschoolsstatewide
SHARED TOKENS (12): "among", "approximately", "boise", "idaho", "main", "offices", "operates", "park", "public", "represented", "schools", "statewide". | EXACT TITLE in mining_gems: "University of Idaho".
0.440
Lithium ↗ Q568 EXACT TITLE
amongconditionsevenimportantmainnaturerelatedsourcesystemsystemsthoughwater
SHARED TOKENS (12): "among", "conditions", "even", "important", "main", "nature", "related", "source", "system", "systems", "though", "water". | EXACT TITLE in mining_gems: "Lithium".
0.440
begancreekdevelopmentidahomountainmountainsopenoregonreservoirriversouthwest
SHARED TOKENS (12): "began", "creek", "development", "idaho", "mountain", "mountains", "open", "oregon", "reservoir", "river", "south", "west". | EXACT TITLE in mining_gems: "Owyhee Mountains".
0.440
centralconstructiondesignmarketplantsecondsinglesitesourcesourcesspecificallywater
SHARED TOKENS (12): "central", "construction", "design", "market", "plant", "second", "single", "site", "source", "sources", "specifically", "water". | EXACT TITLE in mining_gems: "Ready-mix concrete".
0.440
Trail ↗ Q628179 EXACT TITLE
americacommunitieslanemotorizednaturalnorthoregonplacesroadroutethoughtrail
SHARED TOKENS (12): "america", "communities", "lane", "motorized", "natural", "north", "oregon", "places", "road", "route", "though", "trail". | EXACT TITLE in outdoor_recreation: "Trail". | EXACT TITLE in mining_gems: "Trail".
0.440
Gold ↗ Q897 EXACT TITLE
conditionsformhistoryledrestorationsecondshapesimplysystemthoughthroughoutworld
SHARED TOKENS (12): "conditions", "form", "history", "led", "restoration", "second", "shape", "simply", "system", "though", "throughout", "world". | EXACT TITLE in outdoor_recreation: "Gold". | EXACT TITLE in mining_gems: "Gold".
0.440
activityamongboisebusinesseducationidahoinstitutionmillionmountainprogramspublicwest
SHARED TOKENS (12): "activity", "among", "boise", "business", "education", "idaho", "institution", "million", "mountain", "programs", "public", "west". | EXACT TITLE in mining_gems: "Boise State University".
0.440
Trout ↗ Q2258881 EXACT TITLE
familyfoodgenericimportantlargerlifenamesnorthproviderelatedsourceupstream
SHARED TOKENS (12): "family", "food", "generic", "important", "larger", "life", "names", "north", "provide", "related", "source", "upstream". | EXACT TITLE in outdoor_recreation: "Trout".
0.420
boisedepartmenteventsfacilitiesidahomanagedparkpeoplerecreationriverurban
SHARED TOKENS (11): "boise", "department", "events", "facilities", "idaho", "managed", "park", "people", "recreation", "river", "urban". | EXACT TITLE in outdoor_recreation: "Ann Morrison Park".
0.420
Vanadium ↗ Q722 EXACT TITLE
againstcentercontentdirectlyformationformsimportantlayerlifenaturethough
SHARED TOKENS (11): "against", "center", "content", "directly", "formation", "forms", "important", "layer", "life", "nature", "though". | EXACT TITLE in mining_gems: "Vanadium".
0.420
Germanium ↗ Q867 EXACT TITLE
concentrationcountrydiscoveryformsmajornatureprimarysystemstablethoughwater
SHARED TOKENS (11): "concentration", "country", "discovery", "forms", "major", "nature", "primary", "systems", "table", "though", "water". | EXACT TITLE in mining_gems: "Germanium".
0.420
categoryconstructionedgeformfoundationnaturalroadroadsrocksimplyworld
SHARED TOKENS (11): "category", "construction", "edge", "form", "foundation", "natural", "road", "roads", "rock", "simply", "world". | EXACT TITLE in mining_gems: "Construction aggregate".
0.420
Splash pad ↗ Q7578390 EXACT TITLE
featuresfireneedparkpublicqualityrecreationrisktreateduserswater
SHARED TOKENS (11): "features", "fire", "need", "park", "public", "quality", "recreation", "risk", "treated", "users", "water". | EXACT TITLE in outdoor_recreation: "Splash pad".
0.420
blmbureauconservationlandlandsmanagedmanagementmotorizednationalnaturerestrictions
SHARED TOKENS (11): "blm", "bureau", "conservation", "land", "lands", "managed", "management", "motorized", "national", "nature", "restrictions". | EXACT TITLE in outdoor_recreation: "National Conservation Area".
0.420
activitybecomeconditionsdevelopedequipmentfeaturesparticipationrecreationalsinglespecializedworld
SHARED TOKENS (11): "activity", "become", "conditions", "developed", "equipment", "features", "participation", "recreational", "single", "specialized", "world". | EXACT TITLE in outdoor_recreation: "Snowboarding".
0.420
Rafting ↗ Q207238 EXACT TITLE
activitiesactivitybecomedifferenteventexperiencerecreationalriskriverwaterworld
SHARED TOKENS (11): "activities", "activity", "become", "different", "event", "experience", "recreational", "risk", "river", "water", "world". | EXACT TITLE in outdoor_recreation: "Rafting".
0.400
Campsite ↗ Q832778 EXACT TITLE
facilitiesfamilymeansmilitaryparkpeoplerelatedroadsimplyterms
SHARED TOKENS (10): "facilities", "family", "means", "military", "park", "people", "related", "road", "simply", "terms". | EXACT TITLE in outdoor_recreation: "Campsite".
0.400
economiceconomyengineersenvironmentenvironmentalknowledgeresourcessourcesstructuralvalue
SHARED TOKENS (10): "economic", "economy", "engineers", "environment", "environmental", "knowledge", "resources", "sources", "structural", "value". | EXACT TITLE in mining_gems: "Economic geology".
0.400
Gallium ↗ Q861 EXACT TITLE
becomesnaturalnaturenearprimaryratherrolestructuresystemswater
SHARED TOKENS (10): "becomes", "natural", "nature", "near", "primary", "rather", "role", "structure", "systems", "water". | EXACT TITLE in mining_gems: "Gallium".
0.400
Tin ↗ Q1096 EXACT TITLE
anotherearlyfoodmainmakesscaleshowsstructuretablewater
SHARED TOKENS (10): "another", "early", "food", "main", "makes", "scale", "shows", "structure", "table", "water". | EXACT TITLE in outdoor_recreation: "Tin". | EXACT TITLE in mining_gems: "Tin".
0.400
countryenvironmentgovernedmountainnatureprimaryroadrunningtrailworld
SHARED TOKENS (10): "country", "environment", "governed", "mountain", "nature", "primary", "road", "running", "trail", "world". | EXACT TITLE in outdoor_recreation: "Trail running".
0.400
Refining ↗ Q682483 EXACT TITLE
controldependsdevelopeddifferentfoodformnaturalresourcestructuretable
SHARED TOKENS (10): "control", "depends", "developed", "different", "food", "form", "natural", "resource", "structure", "table". | EXACT TITLE in mining_gems: "Refining".
0.380
Graphite ↗ Q5309 EXACT TITLE
amongconditionsconvertscriticalformheatmillionnaturalscale
SHARED TOKENS (9): "among", "conditions", "converts", "critical", "form", "heat", "million", "natural", "scale". | EXACT TITLE in mining_gems: "Graphite".
0.380
Smelting ↗ Q2748405 EXACT TITLE
businessdifferentdirectlydrivingformheatleavingownershipsource
SHARED TOKENS (9): "business", "different", "directly", "driving", "form", "heat", "leaving", "ownership", "source". | EXACT TITLE in mining_gems: "Smelting".
0.380
accessidaholuckynearoperatedoperationalprimaryvalleywestern
SHARED TOKENS (9): "access", "idaho", "lucky", "near", "operated", "operational", "primary", "valley", "western". | EXACT TITLE in mining_gems: "Lucky Friday mine".
0.380
Titanium ↗ Q716 EXACT TITLE
amongconditionenginesformsgoodsmilitarynaturestrongwater
SHARED TOKENS (9): "among", "condition", "engines", "forms", "goods", "military", "nature", "strong", "water". | EXACT TITLE in mining_gems: "Titanium".
0.380
Transformer ↗ Q11658 EXACT TITLE
anotherbecomecorecurrentdescribesdistributionlawmultipleprovide
SHARED TOKENS (9): "another", "become", "core", "current", "describes", "distribution", "law", "multiple", "provide". | EXACT TITLE in mining_gems: "Transformer".
0.380
constructioncontroldevelopmenthabitatimportantlandriverwaterwildlife
SHARED TOKENS (9): "construction", "control", "development", "habitat", "important", "land", "river", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Erosion control".
0.380
approximatelycentraleventidaholargermillionnorthriversouth
SHARED TOKENS (9): "approximately", "central", "event", "idaho", "larger", "million", "north", "river", "south". | EXACT TITLE in mining_gems: "Idaho Batholith".
0.360
Rhenium ↗ Q737 EXACT TITLE
concentrationconstructionenginesimportantratherriversingletable
SHARED TOKENS (8): "concentration", "construction", "engines", "important", "rather", "river", "single", "table". | EXACT TITLE in mining_gems: "Rhenium".
0.360
Hiking ↗ Q12014035 EXACT TITLE
activitycanadadescribesdevelopedformsorganizationsparkurban
SHARED TOKENS (8): "activity", "canada", "describes", "developed", "forms", "organizations", "park", "urban". | EXACT TITLE in outdoor_recreation: "Hiking".
0.360
Tungsten ↗ Q743 EXACT TITLE
conditionsconstructionespeciallyformsimportantlifemajormilitary
SHARED TOKENS (8): "conditions", "construction", "especially", "forms", "important", "life", "major", "military". | EXACT TITLE in mining_gems: "Tungsten".
0.360
Manganese ↗ Q731 EXACT TITLE
criticaldeepformformationimportantsitessystemswater
SHARED TOKENS (8): "critical", "deep", "form", "formation", "important", "sites", "systems", "water". | EXACT TITLE in mining_gems: "Manganese".
0.360
Tellurium ↗ Q1100 EXACT TITLE
exposureformformationitselfnaturalprimaryrelatedsource
SHARED TOKENS (8): "exposure", "form", "formation", "itself", "natural", "primary", "related", "source". | EXACT TITLE in mining_gems: "Tellurium".
0.360
especiallyformformationgrowthmainmassopenrock
SHARED TOKENS (8): "especially", "form", "formation", "growth", "main", "mass", "open", "rock". | EXACT TITLE in mining_gems: "Vein (geology)".
0.360
Copper ↗ Q753 EXACT TITLE
anothercreatedirectlyearlyformheatledshape
SHARED TOKENS (8): "another", "create", "directly", "early", "form", "heat", "led", "shape". | EXACT TITLE in mining_gems: "Copper".
0.360
Gravel ↗ Q133833 EXACT TITLE
classescommercialconstructionimportantroadrockscalethem
SHARED TOKENS (8): "classes", "commercial", "construction", "important", "road", "rock", "scale", "them". | EXACT TITLE in mining_gems: "Gravel".
0.360
Cobalt ↗ Q740 EXACT TITLE
canadacenterdeepformimportantnaturalresourcesworld
SHARED TOKENS (8): "canada", "center", "deep", "form", "important", "natural", "resources", "world". | EXACT TITLE in mining_gems: "Cobalt".
0.340
Silver ↗ Q1090 EXACT TITLE
beyonddescribeddigitalformimportantrolesystems
SHARED TOKENS (7): "beyond", "described", "digital", "form", "important", "role", "systems". | EXACT TITLE in mining_gems: "Silver".
0.340
boisedataidahomajormarketproductssouth
SHARED TOKENS (7): "boise", "data", "idaho", "major", "market", "products", "south". | EXACT TITLE in mining_gems: "Micron Technology".
0.340
centralgovernmentlandlocalnationalpublicsystem
SHARED TOKENS (7): "central", "government", "land", "local", "national", "public", "system". | EXACT TITLE in outdoor_recreation: "Public land". | EXACT TITLE in mining_gems: "Public land".
0.340
Ore ↗ Q102798 EXACT TITLE
againstconcentrationnaturalrocktreatedvaluablevalue
SHARED TOKENS (7): "against", "concentration", "natural", "rock", "treated", "valuable", "value". | EXACT TITLE in outdoor_recreation: "Ore". | EXACT TITLE in mining_gems: "Ore".
0.340
Potash ↗ Q10564271 EXACT TITLE
canadaformmeansmillionplantprimarywater
SHARED TOKENS (7): "canada", "form", "means", "million", "plant", "primary", "water". | EXACT TITLE in mining_gems: "Potash".
0.340
concentrationdifferenteconomicmassplantvaluablevalue
SHARED TOKENS (7): "concentration", "different", "economic", "mass", "plant", "valuable", "value". | EXACT TITLE in mining_gems: "Mineral processing".
0.340
categoriescountrydesignedfeatureslargermountaintrail
SHARED TOKENS (7): "categories", "country", "designed", "features", "larger", "mountain", "trail". | EXACT TITLE in outdoor_recreation: "Mountain biking".
0.320
butteidaholandmajorriversnake
SHARED TOKENS (6): "butte", "idaho", "land", "major", "river", "snake". | EXACT TITLE in mining_gems: "Snake River Plain".
0.320
agencydepartmentdevelopmenteconomicidahomanaged
SHARED TOKENS (6): "agency", "department", "development", "economic", "idaho", "managed". | EXACT TITLE in mining_gems: "Idaho Department of Labor".
0.320
beyondformationimportantmajorsystemsystems
SHARED TOKENS (6): "beyond", "formation", "important", "major", "system", "systems". | EXACT TITLE in mining_gems: "Geochemistry".
0.320
Disc golf ↗ Q876737 EXACT TITLE
accessiblecompletedifferentroughlyrulestoward
SHARED TOKENS (6): "accessible", "complete", "different", "roughly", "rules", "toward". | EXACT TITLE in outdoor_recreation: "Disc golf".
0.320
Ski resort ↗ Q130003 EXACT TITLE
activityamericadevelopedmainnorthsystem
SHARED TOKENS (6): "activity", "america", "developed", "main", "north", "system". | EXACT TITLE in outdoor_recreation: "Ski resort".
0.320
consumerscontentinstitutionlawofficeoffices
SHARED TOKENS (6): "consumers", "content", "institution", "law", "office", "offices". | EXACT TITLE in mining_gems: "Assay office".
0.300
basinbeganboisecapitaldevelopmentdiscoverydistrictevenfirehomeidaholistedmainmountainnationalnearbynortheastplacesriversouth
SHARED TOKENS (20): "basin", "began", "boise", "capital", "development", "discovery", "district", "even", "fire", "home", "idaho", "listed", "main", "mountain", "national", "nearby", "northeast", "places", "river", "south".
0.300
canadaequipmentsourcethoughwater
SHARED TOKENS (5): "canada", "equipment", "source", "though", "water". | EXACT TITLE in mining_gems: "Placer mining".
0.300
activitiesagencyamongbeyondcommunityconservationcontrolgovernmentlicenselicensingmanagementnaturalrecreationalregulatoryrequireresourcerevenuespecifically
SHARED TOKENS (18): "activities", "agency", "among", "beyond", "community", "conservation", "control", "government", "license", "licensing", "management", "natural", "recreational", "regulatory", "require", "resource", "revenue", "specifically".
0.300
agenciesauthoritiesauthorityconservationdescribeddesigneddevelopmentdifferenteconomicfederalgrowthlawlistedmeansnationalpreservationprimaryrequiresruleswildlife
SHARED TOKENS (20): "agencies", "authorities", "authority", "conservation", "described", "designed", "development", "different", "economic", "federal", "growth", "law", "listed", "means", "national", "preservation", "primary", "requires", "rules", "wildlife".
0.300
Sagebrush steppe ↗ KW CROSS HIGH
basinbecomecommunityecosystemfireformhabitatimportantlandlocalopenplantqualityrecreationrisksourcewaterwestwildlife
SHARED TOKENS (19): "basin", "become", "community", "ecosystem", "fire", "form", "habitat", "important", "land", "local", "open", "plant", "quality", "recreation", "risk", "source", "water", "west", "wildlife".
0.300
constructionformnaturalrockshape
SHARED TOKENS (5): "construction", "form", "natural", "rock", "shape". | EXACT TITLE in mining_gems: "Crushed stone".
0.300
againstagencybasinbuiltcenterenvironmentalfacilityfederalgovernmenthabitatidaholandlistmajormillionnationalprioritiesprotectionresidentsrestoration
SHARED TOKENS (24): "against", "agency", "basin", "built", "center", "environmental", "facility", "federal", "government", "habitat", "idaho", "land", "list", "major", "million", "national", "priorities", "protection", "residents", "restoration"....
0.300
administrationagainstagenciesassetsauthoritybackbureaubusinessconsumersdataeconomicfederalfinancialgrowthimportantlawmajorprimaryprotectionregulatory
SHARED TOKENS (24): "administration", "against", "agencies", "assets", "authority", "back", "bureau", "business", "consumers", "data", "economic", "federal", "financial", "growth", "important", "law", "major", "primary", "protection", "regulatory"....
0.300
alreadybecomecauseconditionconditionsconservationcurrentecologicalecosystemfoodhabitathistoricalimportantlifelocalmaintainingnaturequalityratherrepair
SHARED TOKENS (23): "already", "become", "cause", "condition", "conditions", "conservation", "current", "ecological", "ecosystem", "food", "habitat", "historical", "important", "life", "local", "maintaining", "nature", "quality", "rather", "repair"....
0.300
categoriescontrolequipmentespeciallylicensinglocalmotorizedneedphysicalratherrequiresafetythemtreatedusers
SHARED TOKENS (15): "categories", "control", "equipment", "especially", "licensing", "local", "motorized", "need", "physical", "rather", "require", "safety", "them", "treated", "users".
0.300
activitiesconservationmanagementrecreationalwildlife
SHARED TOKENS (5): "activities", "conservation", "management", "recreational", "wildlife". | EXACT TITLE in outdoor_recreation: "Wildlife management area".
0.300
activitiesactivityapproximatelybackboisecommercialcommunitydamdirectlydiscoverydistrictforestidaholistedmonthsmountainmountainsnationalnearnearby
SHARED TOKENS (34): "activities", "activity", "approximately", "back", "boise", "commercial", "community", "dam", "directly", "discovery", "district", "forest", "idaho", "listed", "months", "mountain", "mountains", "national", "near", "nearby"....
0.300
additionalagencyconservationcurrentdepartmentdevelopmentdirectlyfederalgovernmentheadquartersmilitarynationalofficesphysicalprojectreportssystem
SHARED TOKENS (17): "additional", "agency", "conservation", "current", "department", "development", "directly", "federal", "government", "headquarters", "military", "national", "offices", "physical", "project", "reports", "system".
0.300
americacentralconcentrationconstructioncoreeconomicfireitselfmainmarketnearnorthopenroughlysourcesouthverticalwestern
SHARED TOKENS (18): "america", "central", "concentration", "construction", "core", "economic", "fire", "itself", "main", "market", "near", "north", "open", "roughly", "source", "south", "vertical", "western".
0.300
accessallowsbecomebuiltconnectedconnectingconsumerscurrentdistributionmarketsmillionneednetworkpeoplephaserisksourcessystemsthroughoutworld
SHARED TOKENS (20): "access", "allows", "become", "built", "connected", "connecting", "consumers", "current", "distribution", "markets", "million", "need", "network", "people", "phase", "risk", "sources", "systems", "throughout", "world".
0.300
activitiesconditionsdeepdesigneddifferentemergencyenterequipmentevenformformsimmediatelifemainprotectionproviderequiresafetyspecializedsupport
SHARED TOKENS (23): "activities", "conditions", "deep", "designed", "different", "emergency", "enter", "equipment", "even", "form", "forms", "immediate", "life", "main", "protection", "provide", "require", "safety", "specialized", "support"....
0.300
Gold rush ↗ Q273182 KW CROSS HIGH
activitiesbecomebeyondcanadadescribeddiscoveryearlyeconomicenvironmentalfacilitieshistoryimportantitselfledlocalmajormassnorthpeopleshows
SHARED TOKENS (24): "activities", "become", "beyond", "canada", "described", "discovery", "early", "economic", "environmental", "facilities", "history", "important", "itself", "led", "local", "major", "mass", "north", "people", "shows"....
0.300
approximatelycanadacascadecompletedformmountainnationalnearnevadaofficialoregonparkroughlyroutescenicsouthstatussystemtrailwestern
SHARED TOKENS (20): "approximately", "canada", "cascade", "completed", "form", "mountain", "national", "near", "nevada", "official", "oregon", "park", "roughly", "route", "scenic", "south", "status", "system", "trail", "western".
0.300
acresactivityapproximatelycriticaldifferentdistrictdistrictsexplorationforesthomeidahomountainsnationaloperatedplacesprivateregionsimplysitevalley
SHARED TOKENS (20): "acres", "activity", "approximately", "critical", "different", "district", "districts", "exploration", "forest", "home", "idaho", "mountains", "national", "operated", "places", "private", "region", "simply", "site", "valley".
0.300
acresactivityapproximatelyboisebureaucanyoncentraldistrictsforestidaholandlandslifemajormanagedmanagementmillionnationalnorthofficial
SHARED TOKENS (32): "acres", "activity", "approximately", "boise", "bureau", "canyon", "central", "districts", "forest", "idaho", "land", "lands", "life", "major", "managed", "management", "million", "national", "north", "official"....
0.300
activityapproximatelybecomedesigneddistributionenvironmentalexpansionmaintenanceoperatingoperationalphysicalprovidepublicregulatoryservingsystemsystemstraffictransportationurban
SHARED TOKENS (20): "activity", "approximately", "become", "designed", "distribution", "environmental", "expansion", "maintenance", "operating", "operational", "physical", "provide", "public", "regulatory", "serving", "system", "systems", "traffic", "transportation", "urban".
0.300
agencybeganconservationcountrydepartmenteducationenforcementengineersenvironmentalestablishingfederalfinancialgovernmentheadquartersinformationledlocalmaintainingmattersmonitoring
SHARED TOKENS (26): "agency", "began", "conservation", "country", "department", "education", "enforcement", "engineers", "environmental", "establishing", "federal", "financial", "government", "headquarters", "information", "led", "local", "maintaining", "matters", "monitoring"....
0.300
againstanchorcleanconstructioncontrolcreatecriticaldeepenvironmentequipmentevenfeaturesfoundationitselfmillionofficeplantrequiressinglesite
SHARED TOKENS (23): "against", "anchor", "clean", "construction", "control", "create", "critical", "deep", "environment", "equipment", "even", "features", "foundation", "itself", "million", "office", "plant", "requires", "single", "site"....
0.300
advancedbecomebegancompletecreatedeepenginesenvironmentgrowthhistoryknowledgelong-termmultiplenaturaloperationsplanningreasoningsafetysupportsystems
SHARED TOKENS (21): "advanced", "become", "began", "complete", "create", "deep", "engines", "environment", "growth", "history", "knowledge", "long-term", "multiple", "natural", "operations", "planning", "reasoning", "safety", "support", "systems"....
0.300
communitiesconnectconservationconstructioncontrolcriticalecosystememphasizesenvironmentalevenfoodhabitatimportantlandlocalmaintainingmanagementnationalnaturalplant
SHARED TOKENS (32): "communities", "connect", "conservation", "construction", "control", "critical", "ecosystem", "emphasizes", "environmental", "even", "food", "habitat", "important", "land", "local", "maintaining", "management", "national", "natural", "plant"....
0.300
Surface mining ↗ Q756944 KW CROSS HIGH
americabegancategorydifferentenvironmentenvironmentalequipmentfoodformshabitathazardsnorthrocksafetythroughoutwaterworld
SHARED TOKENS (17): "america", "began", "category", "different", "environment", "environmental", "equipment", "food", "forms", "habitat", "hazards", "north", "rock", "safety", "throughout", "water", "world".
0.300
agenciesagencyallowsamericabusinessbusinessescurrentfederalgoodsgovernmentlawmarketmillionofficeofficialoperatingprivateprovidepublicroad
SHARED TOKENS (22): "agencies", "agency", "allows", "america", "business", "businesses", "current", "federal", "goods", "government", "law", "market", "million", "office", "official", "operating", "private", "provide", "public", "road"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
activitiesactualadditionaladministrationagenciesagencyapproximatelyauthoritiesbusinesscleanconservationdepartmentdesignedearlyecosystemenvironmentenvironmentalexposurefederalgovernment
SHARED TOKENS (50): "activities", "actual", "additional", "administration", "agencies", "agency", "approximately", "authorities", "business", "clean", "conservation", "department", "designed", "early", "ecosystem", "environment", "environmental", "exposure", "federal", "government"....
0.300
advancedagenciesagencyarmydepartmentdepartmentsdevelopmentdirectlyfederalgovernmentmanagedmanagementmilitarymillionmissionnationalofficeofficialoperatesoperations
SHARED TOKENS (26): "advanced", "agencies", "agency", "army", "department", "departments", "development", "directly", "federal", "government", "managed", "management", "military", "million", "mission", "national", "office", "official", "operates", "operations"....
0.300
Outdoor gym ↗ Q692630 EXACT TITLE
builtconstructionequipmentparkpublic
SHARED TOKENS (5): "built", "construction", "equipment", "park", "public". | EXACT TITLE in outdoor_recreation: "Outdoor gym".
0.300
advancedcommercialcriticaldatadescribesdifferentdispersedeconomicenvironmentalexplorationgovernmentmajormillionnamesrequiresreservesrestrictionssecondsinglesystems
SHARED TOKENS (22): "advanced", "commercial", "critical", "data", "describes", "different", "dispersed", "economic", "environmental", "exploration", "government", "major", "million", "names", "requires", "reserves", "restrictions", "second", "single", "systems"....
0.300
chainconservationcreatesdevelopmententityestatefederalfinancialforestgovernmentgrowthhabitatlandlandslocalmanagedmarketownershipprivatepublic
SHARED TOKENS (33): "chain", "conservation", "creates", "development", "entity", "estate", "federal", "financial", "forest", "government", "growth", "habitat", "land", "lands", "local", "managed", "market", "ownership", "private", "public"....
0.300
agencycentercurrentdatadepartmentfederalgeographygovernmenthazardsmajormakesmapsmarchnaturalnearofficesparkpeoplepublicregulatory
SHARED TOKENS (23): "agency", "center", "current", "data", "department", "federal", "geography", "government", "hazards", "major", "makes", "maps", "march", "natural", "near", "offices", "park", "people", "public", "regulatory"....
0.300
activityrecreationrecreationalshapewater
SHARED TOKENS (5): "activity", "recreation", "recreational", "shape", "water". | EXACT TITLE in outdoor_recreation: "Tubing (recreation)".
0.300
causeclassificationconditionscontentdifferentespeciallyeventeventsformformshistoryinformallargermountainsnearpatternshapestatusstructures
SHARED TOKENS (19): "cause", "classification", "conditions", "content", "different", "especially", "event", "events", "form", "forms", "history", "informal", "larger", "mountains", "near", "pattern", "shape", "status", "structures".
0.300
adabeganboisecapitalcompletedconstructiondepartmentdesigndistrictfederalformationgovernmenthomeidaholistsmillionnationalnearbyparkplaces
SHARED TOKENS (24): "ada", "began", "boise", "capital", "completed", "construction", "department", "design", "district", "federal", "formation", "government", "home", "idaho", "lists", "million", "national", "nearby", "park", "places"....
🫐 BERRY73 edges
0.280
activityallowscausedatadistributionecosystemequipmenthabitatinformationprimaryrecreationreportingspecializedwildlife
SHARED TOKENS (14): "activity", "allows", "cause", "data", "distribution", "ecosystem", "equipment", "habitat", "information", "primary", "recreation", "reporting", "specialized", "wildlife".
0.280
Faceting ↗ Q3064125 EXACT TITLE
createscreatingedgeedges
SHARED TOKENS (4): "creates", "creating", "edge", "edges". | EXACT TITLE in mining_gems: "Faceting".
0.280
Boating ↗ Q2141830 EXACT TITLE
activitiesactivityitselfrecreational
SHARED TOKENS (4): "activities", "activity", "itself", "recreational". | EXACT TITLE in outdoor_recreation: "Boating".
0.280
activityformpublicrecreational
SHARED TOKENS (4): "activity", "form", "public", "recreational". | EXACT TITLE in outdoor_recreation: "Birdwatching".
0.280
Antimony ↗ EXACT TITLE
directformhistorynature
SHARED TOKENS (4): "direct", "form", "history", "nature". | EXACT TITLE in mining_gems: "Antimony".
0.280
bordersdifferentevenexplorationimportantlandmassmultipleopenroleroutesinglethemtransportation
SHARED TOKENS (14): "borders", "different", "even", "exploration", "important", "land", "mass", "multiple", "open", "role", "route", "single", "them", "transportation".
0.260
americadiscoveryeconomicfederalinformallandlandslawnevadaopenpublicrocksystem
SHARED TOKENS (13): "america", "discovery", "economic", "federal", "informal", "land", "lands", "law", "nevada", "open", "public", "rock", "system".
0.260
eagleidahopark
SHARED TOKENS (3): "eagle", "idaho", "park". | EXACT TITLE in outdoor_recreation: "Eagle Island State Park".
0.260
Garnet ↗ Q105368 EXACT TITLE
definingphysicalprimary
SHARED TOKENS (3): "defining", "physical", "primary". | EXACT TITLE in mining_gems: "Garnet".
0.260
controldatasystems
SHARED TOKENS (3): "control", "data", "systems". | EXACT TITLE in mining_gems: "Power electronics".
0.260
Quarry ↗ Q188040 EXACT TITLE
environmentalrocksafety
SHARED TOKENS (3): "environmental", "rock", "safety". | EXACT TITLE in mining_gems: "Quarry".
0.260
environmentalfoundationwater
SHARED TOKENS (3): "environmental", "foundation", "water". | EXACT TITLE in outdoor_recreation: "Boat ramp".
0.260
boiseemmettidaho
SHARED TOKENS (3): "boise", "emmett", "idaho". | EXACT TITLE in outdoor_recreation: "Emmett, Idaho".
0.260
Skiing ↗ Q130949 EXACT TITLE
activityeventsrecreational
SHARED TOKENS (3): "activity", "events", "recreational". | EXACT TITLE in outdoor_recreation: "Skiing".
0.260
administrationagencyconditionsdepartmenteducationemploymentfederallawmissionregulatorysafetytrainingworking
SHARED TOKENS (13): "administration", "agency", "conditions", "department", "education", "employment", "federal", "law", "mission", "regulatory", "safety", "training", "working".
0.260
Cycling ↗ Q53121 EXACT TITLE
activityrecreationworld
SHARED TOKENS (3): "activity", "recreation", "world". | EXACT TITLE in outdoor_recreation: "Cycling". | EXACT TITLE in mining_gems: "Cycling".
0.240
advancedbackcommunitydesigneddifferentequipmentexperiencenorthrequiresriverrunningwater
SHARED TOKENS (12): "advanced", "back", "community", "designed", "different", "equipment", "experience", "north", "requires", "river", "running", "water".
0.240
Urban mining ↗ Q2500233 KW CROSS HIGH
approximatelyequipmentgovernmentinformalinsidemainmanagementmarketnationalpeoplesitesurban
SHARED TOKENS (12): "approximately", "equipment", "government", "informal", "inside", "main", "management", "market", "national", "people", "sites", "urban".
0.240
conflictcreatingdepartmentdesigneddifferentevengroupsprimaryproviderouteurbanusers
SHARED TOKENS (12): "conflict", "creating", "department", "designed", "different", "even", "groups", "primary", "provide", "route", "urban", "users".
0.240
Trailhead ↗ Q7832815 KW CROSS HIGH
accessdefinesdistributionentityfeaturesmaintainingmajormapsmountainpathwaystraffictrail
SHARED TOKENS (12): "access", "defines", "distribution", "entity", "features", "maintaining", "major", "maps", "mountain", "pathways", "traffic", "trail".
0.240
agenciesamongfederallawlistnationalofficesplacespreservationpreserverequiressites
SHARED TOKENS (12): "agencies", "among", "federal", "law", "list", "national", "offices", "places", "preservation", "preserve", "requires", "sites".
0.240
communitiescountrydirectlyenvironmentenvironmentalhistoryimportantlistsmajorsafetyvalueworld
SHARED TOKENS (12): "communities", "country", "directly", "environment", "environmental", "history", "important", "lists", "major", "safety", "value", "world".
0.240
businesscausedatadesignedemergencyequipmentprotectionprovidesinglesourcesourcessystem
SHARED TOKENS (12): "business", "cause", "data", "designed", "emergency", "equipment", "protection", "provide", "single", "source", "sources", "system".
0.230
agencydepartmentidahowildlife
SHARED TOKENS (4): "agency", "department", "idaho", "wildlife". | URL->A (1): https://idfg.idaho.gov/.
0.220
Indium ↗ Q1094 EXACT TITLE
ledrole
SHARED TOKENS (2): "led", "role". | EXACT TITLE in mining_gems: "Indium".
0.220
causeconstructioncontroldesignedmanagementnearbyneedriversitetemporarywater
SHARED TOKENS (11): "cause", "construction", "control", "designed", "management", "nearby", "need", "river", "site", "temporary", "water".
0.220
accessagencyhistoricalidahomaintainsofficeofficialplacespreservationpublicsites
SHARED TOKENS (11): "access", "agency", "historical", "idaho", "maintains", "office", "official", "places", "preservation", "public", "sites".
0.220
approximatelycommunitiesdescribesdigitalenvironmentalequipmentgoodsinformalledmillionrisk
SHARED TOKENS (11): "approximately", "communities", "describes", "digital", "environmental", "equipment", "goods", "informal", "led", "million", "risk".
0.220
activitycanadacollectingcommercialenvironmentnaturalpeopleproviderecreationalrockvaluable
SHARED TOKENS (11): "activity", "canada", "collecting", "commercial", "environment", "natural", "people", "provide", "recreational", "rock", "valuable".
0.220
Native species ↗ Q169480 KW CROSS HIGH
ecologicaleconomicecosystemenvironmentalhistorylocalnaturalregionspecificallytermsthough
SHARED TOKENS (11): "ecological", "economic", "ecosystem", "environmental", "history", "local", "natural", "region", "specifically", "terms", "though".
0.220
Lapidary ↗ Q17319698 EXACT TITLE
requiresspecialized
SHARED TOKENS (2): "requires", "specialized". | EXACT TITLE in mining_gems: "Lapidary".
0.220
Cabochon ↗ Q615008 EXACT TITLE
developedform
SHARED TOKENS (2): "developed", "form". | EXACT TITLE in mining_gems: "Cabochon".
0.210
Blasting ↗ Q4925437 EXACT TITLE
rock
SHARED TOKENS (1): "rock". | EXACT TITLE in mining_gems: "Blasting".
0.210
Gemology ↗ Q243330 EXACT TITLE
natural
SHARED TOKENS (1): "natural". | EXACT TITLE in mining_gems: "Gemology".
0.210
Kayaking ↗ Q2094083 EXACT TITLE
water
SHARED TOKENS (1): "water". | EXACT TITLE in outdoor_recreation: "Kayaking".
0.200
activitiesbeyondconstructiondrivingeventsforestrecreationalroadsspecificallytransportation
SHARED TOKENS (10): "activities", "beyond", "construction", "driving", "events", "forest", "recreational", "roads", "specifically", "transportation".
0.200
Leave No Trace ↗ Q559348 KW CROSS HIGH
centerconservationcreateecologicaleducationalframeworkrecreationresourcesresponsewildlife
SHARED TOKENS (10): "center", "conservation", "create", "ecological", "educational", "framework", "recreation", "resources", "response", "wildlife".
0.200
agencydepartmentfederalidahoinfrastructuremaintenanceoperationsplanningprogramstransportation
SHARED TOKENS (10): "agency", "department", "federal", "idaho", "infrastructure", "maintenance", "operations", "planning", "programs", "transportation".
0.200
announcedcapacitydevelopeddirectlyearlynetworkplannedrequiresecondworld
SHARED TOKENS (10): "announced", "capacity", "developed", "directly", "early", "network", "planned", "require", "second", "world".
0.200
completecontextequipmentfeaturesmotorizedmountainriskrocksecondsingle
SHARED TOKENS (10): "complete", "context", "equipment", "features", "motorized", "mountain", "risk", "rock", "second", "single".
0.200
coordinationcriticalledmaintainingnatureoperationsprimaryrolesafetyworld
SHARED TOKENS (10): "coordination", "critical", "led", "maintaining", "nature", "operations", "primary", "role", "safety", "world".
0.200
activityamericacanadahistoryidahonearnevadaoregonwestwestern
SHARED TOKENS (10): "activity", "america", "canada", "history", "idaho", "near", "nevada", "oregon", "west", "western".
0.200
boisecascadedamhomeidahonorthreservoirriversouthvalley
SHARED TOKENS (10): "boise", "cascade", "dam", "home", "idaho", "north", "reservoir", "river", "south", "valley".
0.200
Swimming hole ↗ Q7658373 KW CROSS HIGH
activitybecomecreekdeepespeciallyhistorynaturalriverwaterworld
SHARED TOKENS (10): "activity", "become", "creek", "deep", "especially", "history", "natural", "river", "water", "world".
0.180
adaboisegardengovernmentidahomainmunicipalsecondstreet
SHARED TOKENS (9): "ada", "boise", "garden", "government", "idaho", "main", "municipal", "second", "street".
0.180
Snowshoe ↗ Q214724 KW CROSS HIGH
allowsdeepequipmentmotorizedratherrecreationrolespecializedthem
SHARED TOKENS (9): "allows", "deep", "equipment", "motorized", "rather", "recreation", "role", "specialized", "them".
0.180
Nordic skiing ↗ Q216613 KW CROSS HIGH
allowseventeventsrecreationalrequirementsrequiresrulestrainingworld
SHARED TOKENS (9): "allows", "event", "events", "recreational", "requirements", "requires", "rules", "training", "world".
0.180
Fly fishing ↗ Q898886 KW CROSS HIGH
differentformshabitatmassnaturalnorthopenspecializedwater
SHARED TOKENS (9): "different", "forms", "habitat", "mass", "natural", "north", "open", "specialized", "water".
0.180
Sunshine Mine ↗ Q7641530 KW CROSS HIGH
historicalidahomillionnaturereservesresourceresourcesvalleyworld
SHARED TOKENS (9): "historical", "idaho", "million", "nature", "reserves", "resource", "resources", "valley", "world".
0.160
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
boisecanyonhomeidahonampasecondwestwestern
SHARED TOKENS (8): "boise", "canyon", "home", "idaho", "nampa", "second", "west", "western".
0.160
closuredesigndevelopmentdiscoveryexplorationoperationsphaseresources
SHARED TOKENS (8): "closure", "design", "development", "discovery", "exploration", "operations", "phase", "resources".
0.160
Hecla Mining ↗ Q5696498 KW CROSS HIGH
agencyenvironmentalidaholandprotectionsitevalleywater
SHARED TOKENS (8): "agency", "environmental", "idaho", "land", "protection", "site", "valley", "water".
0.160
CRH plc ↗ Q1053299 KW CROSS HIGH
americaapproximatelyconstructioninfrastructurenorthoperatesprovidersuppliers
SHARED TOKENS (8): "america", "approximately", "construction", "infrastructure", "north", "operates", "provider", "suppliers".
0.160
Bicycle safety ↗ Q516366 KW CROSS HIGH
environmenteventinfrastructuremultipleriskroadsafetytraffic
SHARED TOKENS (8): "environment", "event", "infrastructure", "multiple", "risk", "road", "safety", "traffic".
0.160
approximatelyboisecaldwellcanyonidaholocallyoregonwest
SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "idaho", "locally", "oregon", "west".
0.160
activitiescommerciallicenselicensinglocalmanagementrecreationalwestern
SHARED TOKENS (8): "activities", "commercial", "license", "licensing", "local", "management", "recreational", "western".
0.140
Heap leaching ↗ Q2031399 KW CROSS HIGH
economicoperationsplacesprojectqualitysystemsthem
SHARED TOKENS (7): "economic", "operations", "places", "project", "quality", "systems", "them".
0.140
Ore genesis ↗ Q7100977 KW CROSS HIGH
concentrationcurrentformformsphysicalphysicallysource
SHARED TOKENS (7): "concentration", "current", "form", "forms", "physical", "physically", "source".
0.140
americaconstructioncontentcorenorthroadsterms
SHARED TOKENS (7): "america", "construction", "content", "core", "north", "roads", "terms".
0.140
MDU Resources ↗ Q6715200 KW CROSS HIGH
businessesconstructionnorthoperatesproductsrelatedresources
SHARED TOKENS (7): "businesses", "construction", "north", "operates", "products", "related", "resources".
0.120
Barrick Mining ↗ KW CROSS HIGH
canadamillionoperationsreservesresourcesworld
SHARED TOKENS (6): "canada", "million", "operations", "reserves", "resources", "world".
0.120
informationmountainnationalpeopleurbanwater
SHARED TOKENS (6): "information", "mountain", "national", "people", "urban", "water".
0.120
Green belt ↗ KW CROSS HIGH
developmentlandparkplanningurbanwildlife
SHARED TOKENS (6): "development", "land", "park", "planning", "urban", "wildlife".
0.120
Weiser, Idaho ↗ Q514160 KW CROSS HIGH
confluenceidahooregonriversnakesupports
SHARED TOKENS (6): "confluence", "idaho", "oregon", "river", "snake", "supports".
0.120
environmentformlargernearrocksafety
SHARED TOKENS (6): "environment", "form", "larger", "near", "rock", "safety".
0.120
approximatelybusinessesidaholistednationalplaces
SHARED TOKENS (6): "approximately", "businesses", "idaho", "listed", "national", "places".
0.120
Wild camping ↗ Q2755308 KW CROSS HIGH
dispersedformmeansopensitestrail
SHARED TOKENS (6): "dispersed", "form", "means", "open", "sites", "trail".
0.100
Streamflow ↗ Q29425295 KW CROSS HIGH
capacitychannelslandmajorwater
SHARED TOKENS (5): "capacity", "channels", "land", "major", "water".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahokuna
SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "kuna".
0.100
Platinum group ↗ Q223995 KW CROSS HIGH
groupsnearphysicalsystemstable
SHARED TOKENS (5): "groups", "near", "physical", "systems", "table".
0.100
Equestrianism ↗ KW CROSS HIGH
activitiesdrivingrecreationaltransportationworking
SHARED TOKENS (5): "activities", "driving", "recreational", "transportation", "working".
0.100
conservationfederallawprimaryresource
SHARED TOKENS (5): "conservation", "federal", "law", "primary", "resource".
0.100
boisecenteridahonevadavalley
SHARED TOKENS (5): "boise", "center", "idaho", "nevada", "valley".
◈ Frequently Asked Questions
Outdoor Recreation × Mining Gems — Treasure Valley
HAIKU · HIGH GATE
Where can I legally pan for gems in the Treasure Valley without conflicting with Bureau of Land Management restrictions?
The Boise National Forest and surrounding BLM-managed lands in Ada County, Idaho permit recreational gem panning in designated areas during specific seasons. The United States Forest Service maintains detailed maps showing which parcels allow this activity, while private lands in Meridian and Canyon County require owner permission before any gem recovery operations.
How do outdoor recreation activities around the Boise River relate to historical gem mining sites?
The Boise River flows through Ada County past terrain where early gem mining activity occurred, and the United States Army Corps of Engineers manages water levels that affect both recreational access and visibility of old mining claims. Hikers and rafters in Boise National Forest frequently traverse areas with documented gem deposits that remain accessible for hobbyist collection under current Federal land management policies.
What Federal permits govern gem mining versus general outdoor recreation in Boise, Idaho?
The Bureau of Land Management and United States Forest Service issue separate permits for commercial gem extraction versus recreational gem panning on the approximately 2.1 million acres they manage across the Treasure Valley. Outdoor recreationalists in Ada County and Canyon County should verify their activity classification with the local Federal office, as Boise, Idaho sits within jurisdictions where different rules apply to casual versus extractive uses of public lands.
Are there areas in the Treasure Valley where I can both hike and prospect for gems on the same day?
Boise National Forest and BLM lands surrounding Boise, Idaho offer multi-use trails where recreational hiking and gem prospecting coexist on designated Federal property in Ada County. The United States Forest Service permits this dual-use activity on specific parcels, though prospectors must comply with recreation area regulations that the Bureau of Land Management and Army Corps of Engineers enforce along the Boise River corridor.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Outdoor Recreation × Mining Gems 10 QID bridges 222 edges 6,121 ext links 2026-07-17 22:35:43 UTC 011c2c5ae4f8b152
Outdoor Recreation corridor ↗ Mining Gems corridor ↗ Mining Gems × Outdoor Recreation ↗ boisestandard.org/standard ↗
Parent Corridors
Outdoor Recreation × All Other Verticals