—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Mental Health ↔ relates to ↔ Land Use Planning

12 Wikipedia bridge articles confirmed in both vertical ledgers. 251 deterministic cross-vertical edges. 6,698 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
251 Cross Edges
6,698 External Sources
274 Wikipedia Articles
12 🌲 Evergreen
188 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Mental Health
× Land Use Planning
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
251
External Sources Harvested
6,698
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (12)
IdahoBoise State UniversityTreasure ValleyVertical integrationPrivate equityBoise, IdahoBoise metropolitan areaNampa, IdahoAda County, IdahoCanyon County, IdahoMeridian, IdahoCaldwell, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitancapitaleastadacanyonwesterntreasurevalleymakingmeridiannampaapproximatelysuppliestechnologyamongbusinessmember
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:02:53 UTC
Content Hash
b09721c2828e8ee9
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in mental_health (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (21): "approximately", "associated", "boise", "capital", "distinct", "east", "geographic", "idaho", "incorporates", "isolated", "methods", "national", "official", "population", "rest", "restricted", "separate", "supplies", "technology", "uses".... | EXACT TITLE in mental_health: "Idaho". | EXACT TITLE in land_use_planning: "Idaho".
approximatelyassociatedboisecapitaldistincteastgeographicidahoincorporatesisolatedmethodsnationalofficialpopulationrestrestrictedseparatesuppliestechnologyuseswestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in mental_health (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (20): "among", "arts", "boise", "business", "division", "education", "graduate", "health", "idaho", "independent", "master", "member", "program", "programs", "public", "reported", "research", "school", "universities", "university". | EXACT TITLE in mental_health: "Boise State University". | EXACT TITLE in land_use_planning: "Boise State University".
amongartsboisebusinessdivisioneducationgraduatehealthidahoindependentmastermemberprogramprogramspublicreportedresearchschooluniversitiesuniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in mental_health (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (10): "association", "boise", "idaho", "local", "metropolitan", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in mental_health: "Treasure Valley". | EXACT TITLE in land_use_planning: "Treasure Valley".
associationboiseidaholocalmetropolitanresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Vertical integration
Q1571520 QID OVERLAP 0.800
QID OVERLAP: Q1571520 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (23): "become", "consolidation", "corporation", "different", "directly", "integrated", "integration", "making", "management", "market", "member", "need", "needed", "owned", "ownership", "position", "produce", "produces", "rather", "related"....
becomeconsolidationcorporationdifferentdirectlyintegratedintegrationmakingmanagementmarketmemberneedneededownedownershippositionproduceproducesratherrelatedsatisfysuppliesvertical
ather than buying it from suppliers). Vertical integration can be desirable because it secures supplies needed by the firm to produce its product and the market needed to sell the product, but it can become undesirable when a firm's actions become anti-competitive and impede free competition in an open marketplace. Vertical integration is one method of avoiding the hold-up problem.
Vertical expansion Vertical integration is often closely associated with vertical expansion which, in economics, is the growth of a business enterprise through the acquisition of companies that produce the intermediate goods needed by the business or help market and distribute its product. A firm may desire such expansion to secure the supplies needed by the firm to produce its product and the market needed to sell the product. Such expansion can become undesirable from a system-wide perspective when it becomes anti-competitive and impede free competition in an open marketplace. The result is a more efficient business with lower costs and more profits. On the undesirable side, when vertical expansion leads toward monopolistic control of a product or service then regulative action may be required to rectify anti-competitive behavior. Related to vertical expansion is lateral expansion, which is the growth of a business enterprise through the acquisition of similar firms, in the hope of achieving economies of scale. Vertical expansion is also known as a vertical acquisition. Vertical expansion or acquisitions can also be used to increase sales and to gain market power. The acquisition of DirecTV by News Corporation is an example of forwarding vertical expansion or acquisition. DirecTV is a satellite TV company through which News Corporation can distribute more of its media content: news, movies, and television shows. The acquisition of NBC by Comcast is an example of backward vertical integration. For example, in the United States, protecting the public from communications monopolies that can be built in this way is one of the missions of the Federal Communications Commission. Scholars' findings suggest that a reduction in inefficiencies caused by the market vertical value chains, including downstream prices or double mark-up, can be negated with vertical integration. Application in more complex environments can help firms overcome market failures (markets with high transaction costs or assets specificities). Scholars also identified potential risks and boundaries which may occur under vertical integration. This includes the potential competitor, the enhancements to horizontal collusion, and development of barriers to entry. However, it is still debated over if vertical integration expected efficiencies can lead to competitive harm to the market.
There are many problems and benefits that vertical integration brings to an economic system. Problems that can stem from vertical integration can include large capital investments needed to set up and buy factories and maintain efficient profits. Rapid technology development can increase integration difficulties and further increase costs. The requirement of different business skills venturing into new portions of the supply chain can be challenging for the firm. Another problem that may stem from vertical integration is the collapse of goals among the various firms in a supply chain. With each firm operating under different systems, integration may cause initial problems in management and production. Vertical integration also proves to be dangerous when monopolistic problems arise in a capitalistic economy. When this happens, competition is removed and a corporation has the power to control all firms in its supply chain. Large companies are more likely than smaller companies to employ vertical integration, as they have more resources to manage each stage of production (e.g. major expansion and funding). Vertical integration allows control of production from beginning to end. Vertical integration requires a company to focus not only on its core business, but also on several difficult areas such as sourcing materials and manufacturing partners, distribution, and finally selling the product. One benefit is that the implementation of vertical integration can yield increased profit margins or eliminate the leverage that other firms or buyers may have over the firm. It allows improved coordination between production and distribution firms and decreases the cost of exchange of goods between firms within a supply chain. Operational routines also become more consistent and certain as the management of these firms gradually merge. Vertically integrated firms rarely need to worry about the sufficiency in their supply of materials because they generally control the facilities that provide them. A vertically integrated company also creates high barriers of entry into their respective economy, eliminating most potential competition. Implementing vertical integration can be beneficial in that it reduces the distance that separates the suppliers and customers from the resources or information, which can then boost profits and efficiency. There are internal and external society-wide gains and losses stemming from vertical integration, which vary according to the state of technology in the industries involved, roughly corresponding to the stages of the industry lifecycle. Static technology represents the simplest case, where the gains and losses have been studied extensively.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (23): "business", "capital", "category", "changes", "control", "development", "expansion", "financing", "firms", "general", "investment", "management", "operational", "otherwise", "ownership", "private", "provide", "public", "rather", "role"....
businesscapitalcategorychangescontroldevelopmentexpansionfinancingfirmsgeneralinvestmentmanagementoperationalotherwiseownershipprivateprovidepublicratherrolespecializedspecificstrategy
l restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
An Investment manager (the private equity investor) raises money from institutional investors (e.g., hedge funds, pension funds, university endowments, and ultra-high-net-worth individuals) to pursue a particular investment strategy. The fund's raised proceeds are placed into an investment fund, of which the investment manager acts as a general partner (GP) and the institutional investors act as limited partners (LPs). The investment manager then purchases equity ownership stakes in companies by using a combination of equity and debt financing, with the goal of generating returns on the equity invested, including any subsequent equity investments into the target companies, over a target horizon based on the particular investment fund and strategy (typically 4–7 years). From a financial modeling perspective, the primary levers available to private equity investors to drive returns are: Revenue growth Margin expansion (typically an EBITDA margin) Free cash flow generation / debt paydown Valuation multiple expansion (typically an Enterprise Value / EBITDA multiple) Value creation strategies can vary widely by private equity fund. For example, some investors may target increasing sales in new or existing markets (driving revenue growth), and others may look to reduce costs through headcount reduction (expanding margins). Many strategies incorporate some amount of corporate governance restructuring, for example, setting up a board of directors or updating the target's managerial reporting structure. The use of debt financing in acquiring companies increases an investment's return on equity by reducing the amount of initial equity required to purchase the target. Moreover, the interest payments are tax-deductible, so the debt financing reduces corporate taxes and thus increases total after-tax cash flows generated by the business. Following a series of high-profile bankruptcies, aggressive leverage usage by private equity funds has declined in recent decades. In 2005, approximately 70% of the average private equity acquisition represented debt, but it was closer to 50% in 2020. Firms that assume large operational risks (e.g., "turnarounds") will usually apply far lower leverage levels to acquired companies in order to provide management with more financial flexibility; firms taking fewer operational risks will often try to maximize available leverage and focus on investments that generate strong, stable cash flows needed to service the higher debt balances. Over time, "private equity" has come to refer to many different investment strategies, including leveraged buyout, distressed securities, venture capital, growth capital, and mezzanine capital.
Strategies The strategies private-equity firms may use are as follows, leveraged buyout being the most common. Leveraged buyout Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "counties", "east", "idaho", "major", "metropolitan", "population", "sectors", "technology", "treasure", "valley".
adaannualboisecapitalcountieseastidahomajormetropolitanpopulationsectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Boise metropolitan area
QID OVERLAP 0.740
QID OVERLAP: Q4938481 in mental_health (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (12): "ada", "boise", "canyon", "counties", "idaho", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley".
adaboisecanyoncountiesidahomeridianmetropolitannampapercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "western".
boisecanyonidahomeridianmetropolitannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "east", "idaho", "jurisdiction", "local", "metropolitan", "population", "private".
adaboisecapitaldistricteastidahojurisdictionlocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in mental_health (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "east", "idaho", "metropolitan", "population".
approximatelyboisecaldwellcanyoneastidahometropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
239 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP239 edges
🌿 BRANCH188 edges
0.500
additionamongapproximatelyboisedivisionestablishedgraduateidaholaterofficesoperatesprofessionalpublicresearchruralschoolsstatewidestudentsuniversity
SHARED TOKENS (19): "addition", "among", "approximately", "boise", "division", "established", "graduate", "idaho", "later", "offices", "operates", "professional", "public", "research", "rural", "schools", "statewide", "students", "university". | EXACT TITLE in land_use_planning: "University of Idaho".
0.500
behaviorchangedevelopeddevelopmentdifferentdirectfieldindividualinfluenceparticipationrelatedrelationshipsschoolsstudysupportsystemsystems
SHARED TOKENS (17): "behavior", "change", "developed", "development", "different", "direct", "field", "individual", "influence", "participation", "related", "relationships", "schools", "study", "support", "system", "systems". | EXACT TITLE in mental_health: "Family therapy".
0.500
alternativearticleauthorityboardbroadlycapacitycasescivilconditionsdefinitionsevidencehealthcareindividualinformationinstitutionalintendedlawlegalmakingnational
SHARED TOKENS (34): "alternative", "article", "authority", "board", "broadly", "capacity", "cases", "civil", "conditions", "definitions", "evidence", "healthcare", "individual", "information", "institutional", "intended", "law", "legal", "making", "national".... | EXACT TITLE in mental_health: "Informed consent".
0.500
agenciescommunitydevelopedeconomicestimatesevenformalgeographicgrowthinformationintensityland-usemetropolitanmodelmodelsneedorganizationsplanningpracticeproduce
SHARED TOKENS (30): "agencies", "community", "developed", "economic", "estimates", "even", "formal", "geographic", "growth", "information", "intensity", "land-use", "metropolitan", "model", "models", "need", "organizations", "planning", "practice", "produce".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
academicanalysisapplicationsbroaderbusinesscoordinatesdatadefinitiongeographicgeographyindexinformationinstitutionalinsuranceintegratedknowledgemanagementmethodsmultipleorganizations
SHARED TOKENS (31): "academic", "analysis", "applications", "broader", "business", "coordinates", "data", "definition", "geographic", "geography", "index", "information", "institutional", "insurance", "integrated", "knowledge", "management", "methods", "multiple", "organizations".... | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
affectsamongbehaviorbroadercommunitycompetencecreatedefinesdetermineshealthindividualmerelyprofessionalratherrelationshipsresiliencerolework
SHARED TOKENS (18): "affects", "among", "behavior", "broader", "community", "competence", "create", "defines", "determines", "health", "individual", "merely", "professional", "rather", "relationships", "resilience", "role", "work". | EXACT TITLE in mental_health: "Mental health".
0.500
Grief ↗ Q1026040 EXACT TITLE
associatedbecomebeyondcasesconnectiondemonstrateevenhealthindividualmeasuremodelmodelsparticularpersonphysicalrelatedresearchresilienceresponsereveal
SHARED TOKENS (22): "associated", "become", "beyond", "cases", "connection", "demonstrate", "even", "health", "individual", "measure", "model", "models", "particular", "person", "physical", "related", "research", "resilience", "response", "reveal".... | EXACT TITLE in mental_health: "Grief".
0.500
affectsagencyamongapprovedbecomecommunityconcernsconditionscreateddatadegreefieldgeneralgovernmentgrouphealthlegalmakingmemberplacement
SHARED TOKENS (32): "affects", "agency", "among", "approved", "become", "community", "concerns", "conditions", "created", "data", "degree", "field", "general", "government", "group", "health", "legal", "making", "member", "placement".... | EXACT TITLE in mental_health: "Foster care".
0.500
Groundwater ↗ Q161598 EXACT TITLE
becomecapacitycentralchangedischargefieldinfluencemajormovementmultiplemunicipaloperatingpercentpipelinespresentproblemsprovidepublicstudysupplies
SHARED TOKENS (26): "become", "capacity", "central", "change", "discharge", "field", "influence", "major", "movement", "multiple", "municipal", "operating", "percent", "pipelines", "present", "problems", "provide", "public", "study", "supplies".... | EXACT TITLE in land_use_planning: "Groundwater".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdeterminedevelopeddevelopmentdifferentgovernmentgrowthland-uselocalparticularpermissionplacesplanningpolicyregulatoryresidentialrulesshapesingle
SHARED TOKENS (23): "allowing", "building", "determine", "developed", "development", "different", "government", "growth", "land-use", "local", "particular", "permission", "places", "planning", "policy", "regulatory", "residential", "rules", "shape", "single".... | EXACT TITLE in mental_health: "Zoning". | EXACT TITLE in land_use_planning: "Zoning".
0.500
approvedauthoritybecomecompetencecontroldirecteducationevidenceexperienceformalgeneralhealthhealthcareinvestmentleavemethodsobjectivesoccupationalperformanceplanning
SHARED TOKENS (36): "approved", "authority", "become", "competence", "control", "direct", "education", "evidence", "experience", "formal", "general", "health", "healthcare", "investment", "leave", "methods", "objectives", "occupational", "performance", "planning".... | EXACT TITLE in mental_health: "Clinical supervision".
0.500
aloneamongassociatedassociationconditionconflictdevelopeddocumentedeffectiveeventevidenceexperiencepersonphysicalpresentratesrelatedreportedresponserest
SHARED TOKENS (23): "alone", "among", "associated", "association", "condition", "conflict", "developed", "documented", "effective", "event", "evidence", "experience", "person", "physical", "present", "rates", "related", "reported", "response", "rest".... | EXACT TITLE in mental_health: "Post-traumatic stress disorder".
0.500
Psychosis ↗ Q170082 EXACT TITLE
administeredcentralconditiondependdescriptiondistinguishhealthimproveparticularpersonproblemsratherrealrelatedrequiresrolesupportsystemtreatmentunderlying
SHARED TOKENS (20): "administered", "central", "condition", "depend", "description", "distinguish", "health", "improve", "particular", "person", "problems", "rather", "real", "related", "requires", "role", "support", "system", "treatment", "underlying". | EXACT TITLE in mental_health: "Psychosis".
0.500
degreedirecteducationexperiencegraduateindividualjurisdictionjurisdictionsknowledgelicenseparticularphysicalpracticeschoolspecifictraining
SHARED TOKENS (16): "degree", "direct", "education", "experience", "graduate", "individual", "jurisdiction", "jurisdictions", "knowledge", "license", "particular", "physical", "practice", "school", "specific", "training". | EXACT TITLE in mental_health: "Residency (medicine)".
0.500
agencybecomebureaudeliverydepartmentdevelopmentestablishedfundinggovernmentlawmanagementoperationproduceprogramprovisionsresourcethroughoutwestern
SHARED TOKENS (18): "agency", "become", "bureau", "delivery", "department", "development", "established", "funding", "government", "law", "management", "operation", "produce", "program", "provisions", "resource", "throughout", "western". | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
0.500
addressbroadercoveringdevelopmenteconomicgrowthindividualinfrastructureland-usemanagementnationalnetworkparticularplacementplanningregionalrelatedrequiresspecificsupport
SHARED TOKENS (23): "address", "broader", "covering", "development", "economic", "growth", "individual", "infrastructure", "land-use", "management", "national", "network", "particular", "placement", "planning", "regional", "related", "requires", "specific", "support".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
accessagencieschangecommunityconditionscontemporarycreateddescribedevelopmentdifferentdistincteconomicemergencyenforcementfacilitiesfirmsfrequentlygeneralhealthinfrastructure
SHARED TOKENS (35): "access", "agencies", "change", "community", "conditions", "contemporary", "created", "describe", "development", "different", "distinct", "economic", "emergency", "enforcement", "facilities", "firms", "frequently", "general", "health", "infrastructure".... | EXACT TITLE in mental_health: "Infrastructure". | EXACT TITLE in land_use_planning: "Infrastructure".
0.500
Dementia ↗ Q83030 EXACT TITLE
affectsapproximatelyassociatedbehaviorcaseschangechangesconditioncontroldeterminedevelopmentgeneralhistoryidentifyimproveindividualmajorpersonproblemsprocesses
SHARED TOKENS (27): "affects", "approximately", "associated", "behavior", "cases", "change", "changes", "condition", "control", "determine", "development", "general", "history", "identify", "improve", "individual", "major", "person", "problems", "processes".... | EXACT TITLE in mental_health: "Dementia".
0.500
accessamongcasescommunitiescommunitycontroldeliverydesigneddevelopeddevelopmentdifferenteducationevenfieldhealthhealthcareimplementationinfrastructureknowledgemajor
SHARED TOKENS (37): "access", "among", "cases", "communities", "community", "control", "delivery", "designed", "developed", "development", "different", "education", "even", "field", "health", "healthcare", "implementation", "infrastructure", "knowledge", "major".... | EXACT TITLE in mental_health: "Public health". | EXACT TITLE in land_use_planning: "Public health".
0.500
actionanalysisassociatedbuildingcentralchangescontroldesigndevelopmentdifferentfieldfunctionsgeographymaterialmeansmetropolitanmultipleneighborhoodownershipparticular
SHARED TOKENS (27): "action", "analysis", "associated", "building", "central", "changes", "control", "design", "development", "different", "field", "functions", "geography", "material", "means", "metropolitan", "multiple", "neighborhood", "ownership", "particular".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
accesscannotcommunitiescommunitycurrentdemanddevelopmenteducationeffectiveformalfunctionsgrowthhealthimproveinformationknowledgelocalmeansmemberpopulation
SHARED TOKENS (33): "access", "cannot", "communities", "community", "current", "demand", "development", "education", "effective", "formal", "functions", "growth", "health", "improve", "information", "knowledge", "local", "means", "member", "population".... | EXACT TITLE in mental_health: "Community health worker".
0.500
agenciesconditionsconstructioncontroldesignestategeneralinfrastructurejurisdictionslicenselicensedlicensesmanagementmasterplanningpractitionerprivateprocessesproduceprofessional
SHARED TOKENS (26): "agencies", "conditions", "construction", "control", "design", "estate", "general", "infrastructure", "jurisdictions", "license", "licensed", "licenses", "management", "master", "planning", "practitioner", "private", "processes", "produce", "professional".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
approximatelychangesconditiondefinitiondesignedemergencyexperiencegovernmenthomelessnesshousingidentifyinglegalpopulationsprivatepublicstatusworkyet
SHARED TOKENS (18): "approximately", "changes", "condition", "definition", "designed", "emergency", "experience", "government", "homelessness", "housing", "identifying", "legal", "populations", "private", "public", "status", "work", "yet". | EXACT TITLE in mental_health: "Homelessness". | EXACT TITLE in land_use_planning: "Homelessness".
0.500
alternativesapplicableassessmentassociationauthoritybehaviorcentralchangechangescommunitiescommunityconditionscostscreatingdefinitiondependdependsdesigndevelopmenteconomic
SHARED TOKENS (38): "alternatives", "applicable", "assessment", "association", "authority", "behavior", "central", "change", "changes", "communities", "community", "conditions", "costs", "creating", "definition", "depend", "depends", "design", "development", "economic".... | EXACT TITLE in mental_health: "Land-use planning". | EXACT TITLE in land_use_planning: "Land-use planning".
0.500
capacitycapitalconnectingconventionaldesigndesignedintegratenetworkpublicqualityrapidsinglesystemsystemstransportation
SHARED TOKENS (15): "capacity", "capital", "connecting", "conventional", "design", "designed", "integrate", "network", "public", "quality", "rapid", "single", "system", "systems", "transportation". | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.500
bachelorbehaviorcannotcommunitydegreedifferentextensivehealthimproveindividualinstitutionsjurisdictionlicensedlicensingmasterprivateproblemsprocessesprofessionalreceive
SHARED TOKENS (27): "bachelor", "behavior", "cannot", "community", "degree", "different", "extensive", "health", "improve", "individual", "institutions", "jurisdiction", "licensed", "licensing", "master", "private", "problems", "processes", "professional", "receive".... | EXACT TITLE in mental_health: "Psychologist".
0.500
agenciesassessmentdesigneddevelopmentdifferenteducationestablishingfuturegovernmentlocalnationaloperationalorganizationsotherwiseownerplanningpolicypreservationprivateprograms
SHARED TOKENS (26): "agencies", "assessment", "designed", "development", "different", "education", "establishing", "future", "government", "local", "national", "operational", "organizations", "otherwise", "owner", "planning", "policy", "preservation", "private", "programs".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
behaviorchangeconcernsconditionconditionsdesigneddifferentevaluatinggeneralhealthimproveindividualitselfjurisdictionlegallylicensedmethodspersonproblemsproduce
SHARED TOKENS (33): "behavior", "change", "concerns", "condition", "conditions", "designed", "different", "evaluating", "general", "health", "improve", "individual", "itself", "jurisdiction", "legally", "licensed", "methods", "person", "problems", "produce".... | EXACT TITLE in mental_health: "Psychotherapy".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessannualbecomecostscoverageeconomiceffectiveestablishedexistencefundinggeneralgovernmenthealthhealthcareincomeinsurancememberpersonpolicyprogram
SHARED TOKENS (32): "access", "annual", "become", "costs", "coverage", "economic", "effective", "established", "existence", "funding", "general", "government", "health", "healthcare", "income", "insurance", "member", "person", "policy", "program".... | EXACT TITLE in mental_health: "Medicaid".
0.500
Social work ↗ Q205398 EXACT TITLE
academicadditionadministrationadvocacyagenciesartsbecomechangecommunitiescommunityconcernsdevelopeddevelopmentdirectlyeducationgovernmentgrouphealthindividuallaw
SHARED TOKENS (35): "academic", "addition", "administration", "advocacy", "agencies", "arts", "become", "change", "communities", "community", "concerns", "developed", "development", "directly", "education", "government", "group", "health", "individual", "law".... | EXACT TITLE in mental_health: "Social work".
0.500
admissionamongapproximatelyassociatedassociationcasesconditionconditionsdemonstrateeffectiveestimatesevidenceexperiencefuturegeneralhistoryincreasesindividualmajormakes
SHARED TOKENS (39): "admission", "among", "approximately", "associated", "association", "cases", "condition", "conditions", "demonstrate", "effective", "estimates", "evidence", "experience", "future", "general", "history", "increases", "individual", "major", "makes".... | EXACT TITLE in mental_health: "Bipolar disorder".
0.500
academicagenciesbeyondcontinuingcurriculumdegreedelivereddevelopmentdifferentdivisioneconomiceducationformalfrequentlygeneralgovernmentinstitutionalintegratedintendedoperation
SHARED TOKENS (31): "academic", "agencies", "beyond", "continuing", "curriculum", "degree", "delivered", "development", "different", "division", "economic", "education", "formal", "frequently", "general", "government", "institutional", "integrated", "intended", "operation".... | EXACT TITLE in mental_health: "Continuing education".
0.500
administrationagencycapacitycivilcommitmentcommunitycompetencedetermineemergencyestablishedevaluationhealthindividualjurisdictionslegalmeanpersonpressureproceduresproceedings
SHARED TOKENS (26): "administration", "agency", "capacity", "civil", "commitment", "community", "competence", "determine", "emergency", "established", "evaluation", "health", "individual", "jurisdictions", "legal", "mean", "person", "pressure", "procedures", "proceedings".... | EXACT TITLE in mental_health: "Involuntary commitment".
0.500
Urban design ↗ Q63100 EXACT TITLE
additioncommunityconnectdependentdesigneconomiclocalpagephysicalplanningprocessesprojectpublicregionalrelatedspecificstreetsurrounding
SHARED TOKENS (18): "addition", "community", "connect", "dependent", "design", "economic", "local", "page", "physical", "planning", "processes", "project", "public", "regional", "related", "specific", "street", "surrounding". | EXACT TITLE in land_use_planning: "Urban design".
0.500
Disability ↗ Q12131 EXACT TITLE
accessacquiredagainstbarrierscategoriescommunityconditioncreateddefinesdescribedifferenteffectiveexperienceframeworkhistoryindividualintegrationlawlegalmakes
SHARED TOKENS (40): "access", "acquired", "against", "barriers", "categories", "community", "condition", "created", "defines", "describe", "different", "effective", "experience", "framework", "history", "individual", "integration", "law", "legal", "makes".... | EXACT TITLE in mental_health: "Disability".
0.500
administrationagenciesagencydepartmentdistrictfunctionsgovernmentimprovelocalofficeofficesoperatorsprogramsproviderspublicregionalrequirementsstatutorysystemstransportation
SHARED TOKENS (20): "administration", "agencies", "agency", "department", "district", "functions", "government", "improve", "local", "office", "offices", "operators", "programs", "providers", "public", "regional", "requirements", "statutory", "systems", "transportation". | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
administrationagenciesagencyapplicationcoordinatesdesigneddevelopeddevelopmentmetropolitannationalorgplanningplatformsprofessionalresearchreviewssupportsystemtransportationuniversity
SHARED TOKENS (21): "administration", "agencies", "agency", "application", "coordinates", "designed", "developed", "development", "metropolitan", "national", "org", "planning", "platforms", "professional", "research", "reviews", "support", "system", "transportation", "university".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
Probation ↗ Q13961 EXACT TITLE
alternativesbehaviorcommunityconditionscourtsjurisdictionjurisdictionslawleavemeansmovementpermitprogramremainrequiredrulestreatment
SHARED TOKENS (17): "alternatives", "behavior", "community", "conditions", "courts", "jurisdiction", "jurisdictions", "law", "leave", "means", "movement", "permit", "program", "remain", "required", "rules", "treatment". | EXACT TITLE in mental_health: "Probation".
0.500
Wetland ↗ Q170321 EXACT TITLE
additionamongassessmentbuildingchangecontroldifferentdistinctfunctionshealthidentifyinfrastructuremethodsprocessesprotectprovidepublicqualityservingspecific
SHARED TOKENS (22): "addition", "among", "assessment", "building", "change", "control", "different", "distinct", "functions", "health", "identify", "infrastructure", "methods", "processes", "protect", "provide", "public", "quality", "serving", "specific".... | EXACT TITLE in land_use_planning: "Wetland".
0.500
agenciesassociatecertificationcertifiedcodescommunitycompletedifferentexperiencefrequentlyhealthindependentlylicenselicensedlicenseslicensinglicensuremasternationalorganizations
SHARED TOKENS (34): "agencies", "associate", "certification", "certified", "codes", "community", "complete", "different", "experience", "frequently", "health", "independently", "license", "licensed", "licenses", "licensing", "licensure", "master", "national", "organizations".... | EXACT TITLE in mental_health: "Licensed professional counselor".
0.500
applicationsassociatedbeyondconnectionsdatadescriptionsdevelopmentgraphknowledgemodelnetworksrelationshipsrepresentrepresentationresearchsearchsystemsunderlyinguses
SHARED TOKENS (19): "applications", "associated", "beyond", "connections", "data", "descriptions", "development", "graph", "knowledge", "model", "networks", "relationships", "represent", "representation", "research", "search", "systems", "underlying", "uses". | EXACT TITLE in mental_health: "Knowledge graph". | EXACT TITLE in land_use_planning: "Knowledge graph".
0.500
agenciesagencyassessmentbroaderdepartmentimproveinvestmentlocalprivateprogramsprojectprotectqualityresourcesruralsupported
SHARED TOKENS (16): "agencies", "agency", "assessment", "broader", "department", "improve", "investment", "local", "private", "programs", "project", "protect", "quality", "resources", "rural", "supported". | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
agencybuildingcommercialconnectionsconstructiondegreedesigndevelopmentfunctionsinstitutionalintegratedmultipleneighborhoodplanningpolicyprivateresidentialsinglesitestrategy
SHARED TOKENS (23): "agency", "building", "commercial", "connections", "construction", "degree", "design", "development", "functions", "institutional", "integrated", "multiple", "neighborhood", "planning", "policy", "private", "residential", "single", "site", "strategy".... | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilconstructiondefinitiondevelopmentestablishgovernmenthistorylawlegalmappingownershipplanningpositionsprofessionalrecordedrequiredresearchstructural
SHARED TOKENS (22): "analysis", "boundaries", "civil", "construction", "definition", "development", "establish", "government", "history", "law", "legal", "mapping", "ownership", "planning", "positions", "professional", "recorded", "required", "research", "structural".... | EXACT TITLE in land_use_planning: "Surveying".
0.500
adaadditionboisecentercommercialcommissiondepartmentfieldfunctionsgeneralidahonationaloperatespermissionreceiverequiringrightssupporttimesuses
SHARED TOKENS (21): "ada", "addition", "boise", "center", "commercial", "commission", "department", "field", "functions", "general", "idaho", "national", "operates", "permission", "receive", "requiring", "rights", "support", "times", "uses".... | EXACT TITLE in land_use_planning: "Boise Airport".
0.500
administrationanalysisbroaderbusinesscapitalcategorycivilcodescommunitiescommunitycreatingdesigndevelopmentdifferenteconomicfieldgeographygrowthhealthimplementation
SHARED TOKENS (48): "administration", "analysis", "broader", "business", "capital", "category", "civil", "codes", "communities", "community", "creating", "design", "development", "different", "economic", "field", "geography", "growth", "health", "implementation".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationapplicationsconditionsdatadefineseducationevenfacilitiesfundinggaphealthhealthcareimproveinformationintegrationmanagementmeansphysical
SHARED TOKENS (31): "access", "administration", "application", "applications", "conditions", "data", "defines", "education", "even", "facilities", "funding", "gap", "health", "healthcare", "improve", "information", "integration", "management", "means", "physical".... | EXACT TITLE in mental_health: "Telehealth".
0.500
actionagenciesagencyauthoritycouncilcourtscreateddefinitiondesignedestablishedevaluategovernmentjanuarylawmodelednationalpersonpolicypreparequality
SHARED TOKENS (24): "action", "agencies", "agency", "authority", "council", "courts", "created", "definition", "designed", "established", "evaluate", "government", "january", "law", "modeled", "national", "person", "policy", "prepare", "quality".... | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
0.500
addressaddressingadministeredagencychangescontrolcoordinationdirectlyfundinggoverninglawmajorownedphysicalprovisionsqualityresourcetreatment
SHARED TOKENS (18): "address", "addressing", "administered", "agency", "changes", "control", "coordination", "directly", "funding", "governing", "law", "major", "owned", "physical", "provisions", "quality", "resource", "treatment". | EXACT TITLE in land_use_planning: "Clean Water Act".
0.500
approvedauthoritybuildingcodecodescomplianceconstructioncontrolcouncildepartmentsdesigndistrictestategeneralhealthinsuranceintendedjurisdictionlawlocal
SHARED TOKENS (39): "approved", "authority", "building", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "district", "estate", "general", "health", "insurance", "intended", "jurisdiction", "law", "local".... | EXACT TITLE in land_use_planning: "Building code".
0.500
administeredadministrationagainstagencyalternativeclaimscommunitiescommunityconstructioncontrolcostscreatedcreatingdebtdesigneddevelopmenteffectiveemergencyenforcementgovernment
SHARED TOKENS (33): "administered", "administration", "against", "agency", "alternative", "claims", "communities", "community", "construction", "control", "costs", "created", "creating", "debt", "designed", "development", "effective", "emergency", "enforcement", "government".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
additionassociateddemandeconomicemergencyformalgovernmenthomelessnesshousingincomeincreasesindexlocalmarketsnationalownershiprentalresponse
SHARED TOKENS (18): "addition", "associated", "demand", "economic", "emergency", "formal", "government", "homelessness", "housing", "income", "increases", "index", "local", "markets", "national", "ownership", "rental", "response". | EXACT TITLE in land_use_planning: "Affordable housing".
0.500
Plat ↗ Q831939 EXACT TITLE
becomeboardcommissiondepartmentdescriptionsgeneralgoverningindividualinformationlegallegallylocalmapofficeplanningpublicratherreviewshowzoning
SHARED TOKENS (20): "become", "board", "commission", "department", "descriptions", "general", "governing", "individual", "information", "legal", "legally", "local", "map", "office", "planning", "public", "rather", "review", "show", "zoning". | EXACT TITLE in mental_health: "Plat". | EXACT TITLE in land_use_planning: "Plat".
0.500
accessagenciesbarriersboardcentercertificationcommunitiescommunityconsumercoveragefacilitiesfederallygovernancegoverninghealthinsurancelocalmunicipalorganizationspopulations
SHARED TOKENS (33): "access", "agencies", "barriers", "board", "center", "certification", "communities", "community", "consumer", "coverage", "facilities", "federally", "governance", "governing", "health", "insurance", "local", "municipal", "organizations", "populations".... | EXACT TITLE in mental_health: "Federally Qualified Health Center".
0.500
Irrigation ↗ Q11453 EXACT TITLE
additionapplicationcentralchangesconditionsconsolidationcontroldevelopeddirectlydischargefieldgrowthmanagementmethodsnetworkoccursoperationoutsidepracticepressure
SHARED TOKENS (32): "addition", "application", "central", "changes", "conditions", "consolidation", "control", "developed", "directly", "discharge", "field", "growth", "management", "methods", "network", "occurs", "operation", "outside", "practice", "pressure".... | EXACT TITLE in land_use_planning: "Irrigation".
0.500
dischargeeffectivefacilitiesgrouphealthindividualoperatesparticipationprogramprogramsresidentialstructurestructuredsupportthroughouttreatmentwork
SHARED TOKENS (17): "discharge", "effective", "facilities", "group", "health", "individual", "operates", "participation", "program", "programs", "residential", "structure", "structured", "support", "throughout", "treatment", "work". | EXACT TITLE in mental_health: "Intensive outpatient program".
0.500
accessbeyondchangechangescommunitiescommunitycreatingcurrentdelivereddesigneddirectgeneralhealthindividualinstitutemeansmethodsnationalproblemsprogram
SHARED TOKENS (31): "access", "beyond", "change", "changes", "communities", "community", "creating", "current", "delivered", "designed", "direct", "general", "health", "individual", "institute", "means", "methods", "national", "problems", "program".... | EXACT TITLE in mental_health: "Suicide prevention".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisboundariesbuildingcodesconditionsconstructioncontractorcountiescreatingdependentdesigndevelopmentfacilitiesinfrastructurelegallicensedlinesmajorparkingplan
SHARED TOKENS (31): "analysis", "boundaries", "building", "codes", "conditions", "construction", "contractor", "counties", "creating", "dependent", "design", "development", "facilities", "infrastructure", "legal", "licensed", "lines", "major", "parking", "plan".... | EXACT TITLE in land_use_planning: "Site plan".
0.500
assessmentassociationboardbroaderdefinesgrouphealthcareindividualknowledgemethodsnationalpracticeproblemstreatmentworkworkers
SHARED TOKENS (16): "assessment", "association", "board", "broader", "defines", "group", "healthcare", "individual", "knowledge", "methods", "national", "practice", "problems", "treatment", "work", "workers". | EXACT TITLE in mental_health: "Clinical social work".
0.500
agenciescivilconstructiondepartmentsdesigndistinguishfirmsgovernmentinfrastructuremunicipalnationalphysicalpipelinesprivateprofessionalpublicstructuralsystems
SHARED TOKENS (18): "agencies", "civil", "construction", "departments", "design", "distinguish", "firms", "government", "infrastructure", "municipal", "national", "physical", "pipelines", "private", "professional", "public", "structural", "systems". | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
acquiredaffectingbecomecasescategoryconditionconditionsdefinesdependdifferentfunctionshealthmajorrepresentunderlying
SHARED TOKENS (15): "acquired", "affecting", "become", "cases", "category", "condition", "conditions", "defines", "depend", "different", "functions", "health", "major", "represent", "underlying". | EXACT TITLE in mental_health: "Neurocognitive disorder".
0.500
Delirium ↗ Q160796 EXACT TITLE
affectingaffectsamongcaseschangesconditionconditionsdirectestablishingevenevidenceexperiencehealthidentifyinginsideintensitymultipleoccursoutsideperson
SHARED TOKENS (32): "affecting", "affects", "among", "cases", "changes", "condition", "conditions", "direct", "establishing", "even", "evidence", "experience", "health", "identifying", "inside", "intensity", "multiple", "occurs", "outside", "person".... | EXACT TITLE in mental_health: "Delirium".
0.500
academicadaboardboisecanyoncommunitycountiesdevelopmenteducationidahonampapopulationprogramspublicreportedresidentsservedsouthernsouthweststudent
SHARED TOKENS (27): "academic", "ada", "board", "boise", "canyon", "community", "counties", "development", "education", "idaho", "nampa", "population", "programs", "public", "reported", "residents", "served", "southern", "southwest", "student".... | EXACT TITLE in land_use_planning: "College of Western Idaho".
0.500
Light rail ↗ Q1268865 EXACT TITLE
broadercapacityconditionsdefinitionsdifferentindividualmultiplenetworksoperatesoperatingrapidsystemsystemstechnologyuses
SHARED TOKENS (15): "broader", "capacity", "conditions", "definitions", "different", "individual", "multiple", "networks", "operates", "operating", "rapid", "system", "systems", "technology", "uses". | EXACT TITLE in land_use_planning: "Light rail".
0.500
amongassociatedexperiencehealthhealthcareplanplanningpopulationpreparationproblemsprovidereportedresponserisksystemstreatment
SHARED TOKENS (16): "among", "associated", "experience", "health", "healthcare", "plan", "planning", "population", "preparation", "problems", "provide", "reported", "response", "risk", "systems", "treatment". | EXACT TITLE in mental_health: "Suicidal ideation".
0.500
associatedauthoritycodesconsequencescourtsenforcementgoverninggovernmentindependentlyinstitutionslawlegalorganizationspersonpublicrecordrulessystemthroughouttimes
SHARED TOKENS (20): "associated", "authority", "codes", "consequences", "courts", "enforcement", "governing", "government", "independently", "institutions", "law", "legal", "organizations", "person", "public", "record", "rules", "system", "throughout", "times". | EXACT TITLE in mental_health: "Law enforcement".
0.500
affectsamonganalysisapproximatelyassociatedcasesdevelopedeffectiveestimatesexperiencegrouphealthmethodsneededpercentpersonphysicalratesreceivereduced
SHARED TOKENS (25): "affects", "among", "analysis", "approximately", "associated", "cases", "developed", "effective", "estimates", "experience", "group", "health", "methods", "needed", "percent", "person", "physical", "rates", "receive", "reduced".... | EXACT TITLE in mental_health: "Eating disorder".
0.500
communitycompatibilitycontinuitycurrentdeterminesdevelopmentdocumentestablishinggeneralgrowthhousingindividualmasterneighborhoodplanplanningpolicyprovidepublicrecreation
SHARED TOKENS (24): "community", "compatibility", "continuity", "current", "determines", "development", "document", "establishing", "general", "growth", "housing", "individual", "master", "neighborhood", "plan", "planning", "policy", "provide", "public", "recreation".... | EXACT TITLE in land_use_planning: "Comprehensive planning".
0.500
agenciesalternativesassessmentbusinessesdesignevaluationfacilitiesfuturegovernmentincorporatesinfluencelinesmovemovementplanningprepareprivatepublicsystemtransportation
SHARED TOKENS (20): "agencies", "alternatives", "assessment", "businesses", "design", "evaluation", "facilities", "future", "government", "incorporates", "influence", "lines", "move", "movement", "planning", "prepare", "private", "public", "system", "transportation". | EXACT TITLE in land_use_planning: "Transportation planning".
0.480
Cartography ↗ Q42515 EXACT TITLE
boundariesdesigngeographicinformationmakingmapmediamodeledobjectivesphysicalpracticerepresentstudysystems
SHARED TOKENS (14): "boundaries", "design", "geographic", "information", "making", "map", "media", "modeled", "objectives", "physical", "practice", "represent", "study", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.480
annualapprovalcommissioncontextdefinitionsdevelopmentevenmeanspresentproducerequiresrequiringrestrictedzoning
SHARED TOKENS (14): "annual", "approval", "commission", "context", "definitions", "development", "even", "means", "present", "produce", "requires", "requiring", "restricted", "zoning". | EXACT TITLE in land_use_planning: "Agricultural land".
0.460
communitycoordinationcourtsfirmsgeneralhealthlawlegalmanagementspecificsystemtopicstreatment
SHARED TOKENS (13): "community", "coordination", "courts", "firms", "general", "health", "law", "legal", "management", "specific", "system", "topics", "treatment". | EXACT TITLE in mental_health: "Case management".
0.460
againstbehaviorconditionscontrolhealthindividualinfluenceintegrationmajormeansmechanismprotectrepresentation
SHARED TOKENS (13): "against", "behavior", "conditions", "control", "health", "individual", "influence", "integration", "major", "means", "mechanism", "protect", "representation". | EXACT TITLE in mental_health: "Dissociative disorder".
0.460
conditioncontinuingcoordinatesgeneralhealthhealthcarephysicalpractitionerprincipalprofessionalprofessionalsreceivesystem
SHARED TOKENS (13): "condition", "continuing", "coordinates", "general", "health", "healthcare", "physical", "practitioner", "principal", "professional", "professionals", "receive", "system". | EXACT TITLE in mental_health: "Primary care".
0.440
accessbecomecertifiedcommunityformalhealthinsuranceoperatingprivateprogramstatustreats
SHARED TOKENS (12): "access", "become", "certified", "community", "formal", "health", "insurance", "operating", "private", "program", "status", "treats". | EXACT TITLE in mental_health: "Certified Community Behavioral Health Clinic".
0.440
boisebrandconsumercreateddatademandidahomajormarketownedservedtechnology
SHARED TOKENS (12): "boise", "brand", "consumer", "created", "data", "demand", "idaho", "major", "market", "owned", "served", "technology". | EXACT TITLE in land_use_planning: "Micron Technology".
0.440
Canal ↗ Q12284 EXACT TITLE
buildingcasescontrolcreatecurrentdescribemanagementneededpressurerequiringresourcesvalley
SHARED TOKENS (12): "building", "cases", "control", "create", "current", "describe", "management", "needed", "pressure", "requiring", "resources", "valley". | EXACT TITLE in land_use_planning: "Canal".
0.440
academiccertifiededucationlicensedneededpositionsprofessionalprogramprovideschoolstudentssupport
SHARED TOKENS (12): "academic", "certified", "education", "licensed", "needed", "positions", "professional", "program", "provide", "school", "students", "support". | EXACT TITLE in mental_health: "School counselor".
0.420
Stormwater ↗ Q1421263 EXACT TITLE
additionbecomecreatedemanddevelopeddirectlymajorpopulationrelatedresourcetreatment
SHARED TOKENS (11): "addition", "become", "create", "demand", "developed", "directly", "major", "population", "related", "resource", "treatment". | EXACT TITLE in land_use_planning: "Stormwater".
0.420
addressingbusinessescommunitiesconstructioneconomicgovernmentgrowthhousinginfrastructureprivatepublic
SHARED TOKENS (11): "addressing", "businesses", "communities", "construction", "economic", "government", "growth", "housing", "infrastructure", "private", "public". | EXACT TITLE in land_use_planning: "Urban renewal".
0.420
Parole ↗ Q5357120 EXACT TITLE
associatedcomplianceconditionsjurisdictionsoriginaloutsideratherreleaseservedservingsystem
SHARED TOKENS (11): "associated", "compliance", "conditions", "jurisdictions", "original", "outside", "rather", "release", "served", "serving", "system". | EXACT TITLE in mental_health: "Parole".
0.420
analysiscurrentdatadesigndifferentformalgeographicplacementresearchrestrictedstudy
SHARED TOKENS (11): "analysis", "current", "data", "design", "different", "formal", "geographic", "placement", "research", "restricted", "study". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.420
Easement ↗ Q448405 EXACT TITLE
accessamongitselfjurisdictionslawownedpersonpublicrealrightsstated
SHARED TOKENS (11): "access", "among", "itself", "jurisdictions", "law", "owned", "person", "public", "real", "rights", "stated". | EXACT TITLE in land_use_planning: "Easement".
0.420
actionbehaviorchangesevaluationfieldfunctionsparticularsitesspecificstudysystem
SHARED TOKENS (11): "action", "behavior", "changes", "evaluation", "field", "functions", "particular", "sites", "specific", "study", "system". | EXACT TITLE in mental_health: "Psychopharmacology".
0.420
Annexation ↗ EXACT TITLE
acquisitioncontrolcurrentdescribesdescribingdistinctlawlegalmeansphysicaltitle
SHARED TOKENS (11): "acquisition", "control", "current", "describes", "describing", "distinct", "law", "legal", "means", "physical", "title". | EXACT TITLE in land_use_planning: "Annexation".
0.420
annualapproximatelybureaubusinessbusinessesdocumentedemploymentoccupationalofficeofficesregional
SHARED TOKENS (11): "annual", "approximately", "bureau", "business", "businesses", "documented", "employment", "occupational", "office", "offices", "regional". | EXACT TITLE in mental_health: "Occupational Employment and Wage Statistics".
0.400
accessbecomecenterdepartmentdepartmentsemergencymeanspresentprovidetreatment
SHARED TOKENS (10): "access", "become", "center", "department", "departments", "emergency", "means", "present", "provide", "treatment". | EXACT TITLE in mental_health: "Emergency department".
0.400
amongidahomeridianpercentprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (10): "among", "idaho", "meridian", "percent", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in mental_health: "Idaho State University".
0.400
Aquifer ↗ Q208791 EXACT TITLE
beyondlayermajormaterialmaterialspresentpressurerelatedstudyunderlying
SHARED TOKENS (10): "beyond", "layer", "major", "material", "materials", "present", "pressure", "related", "study", "underlying". | EXACT TITLE in land_use_planning: "Aquifer".
0.380
agencydepartmentfundingfutureidahoinfrastructureplanningprogramstransportation
SHARED TOKENS (9): "agency", "department", "funding", "future", "idaho", "infrastructure", "planning", "programs", "transportation". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.380
assessmentdetermineevaluatemanagementoccupationalphysicalstatustrainingworkers
SHARED TOKENS (9): "assessment", "determine", "evaluate", "management", "occupational", "physical", "status", "training", "workers". | EXACT TITLE in mental_health: "Psychiatrist".
0.380
agenciescoordinatescouncildevelopmentdivisionofficeofficespolicyquality
SHARED TOKENS (9): "agencies", "coordinates", "council", "development", "division", "office", "offices", "policy", "quality". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.380
commercialcommunitiesdevelopmenthousingindependentlyotherwiseownedsinglesmaller
SHARED TOKENS (9): "commercial", "communities", "development", "housing", "independently", "otherwise", "owned", "single", "smaller". | EXACT TITLE in land_use_planning: "Subdivision (land)".
0.380
boardcaldwellfundingidahooperatesoperatingprogramprogramsthroughout
SHARED TOKENS (9): "board", "caldwell", "funding", "idaho", "operates", "operating", "program", "programs", "throughout". | EXACT TITLE in mental_health: "Idaho Youth Ranch".
0.360
adaboisecanyoncountiesidahometropolitantreasurevalley
SHARED TOKENS (8): "ada", "boise", "canyon", "counties", "idaho", "metropolitan", "treasure", "valley". | EXACT TITLE in land_use_planning: "Southwestern Idaho".
0.360
Floodplain ↗ Q193110 EXACT TITLE
controldevelopeddischargeexperiencefrequentlyheavilyriskvalley
SHARED TOKENS (8): "control", "developed", "discharge", "experience", "frequently", "heavily", "risk", "valley". | EXACT TITLE in land_use_planning: "Floodplain".
0.360
behaviordirectoryhealthinsurancemediaprofessionalreportedworkers
SHARED TOKENS (8): "behavior", "directory", "health", "insurance", "media", "professional", "reported", "workers". | EXACT TITLE in mental_health: "Psychology Today".
0.360
boardbuildingcodedevelopmentmunicipalrulesstandardszoning
SHARED TOKENS (8): "board", "building", "code", "development", "municipal", "rules", "standards", "zoning". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.340
Criminal justice ↗ EXACT TITLE
agenciescourtsdeliverygovernmentinstitutionssupportsystem
SHARED TOKENS (7): "agencies", "courts", "delivery", "government", "institutions", "support", "system". | EXACT TITLE in mental_health: "Criminal justice".
0.340
authoritycourtsgovernmentjudicialjurisdictionsreviewstatute
SHARED TOKENS (7): "authority", "courts", "government", "judicial", "jurisdictions", "review", "statute". | EXACT TITLE in land_use_planning: "Judicial review".
0.340
amongconditionshealthinstitutionsmajorspecializedtreatment
SHARED TOKENS (7): "among", "conditions", "health", "institutions", "major", "specialized", "treatment". | EXACT TITLE in mental_health: "Psychiatric hospital".
0.320
Wastewater ↗ Q336191 EXACT TITLE
applicationscommercialcommunitydefinitionmunicipalprocesses
SHARED TOKENS (6): "applications", "commercial", "community", "definition", "municipal", "processes". | EXACT TITLE in land_use_planning: "Wastewater".
0.320
applicablelawprivateprovideregulatoryrights
SHARED TOKENS (6): "applicable", "law", "private", "provide", "regulatory", "rights". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.320
conflictdifferentlawlegalphysicalsystems
SHARED TOKENS (6): "conflict", "different", "law", "legal", "physical", "systems". | EXACT TITLE in land_use_planning: "Water right".
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycompletecostsdescribedevelopmentemploymentgovernmentgrowthhealthhousingneighborhoodplanningpublicregionalresourcesschoolstransportation
SHARED TOKENS (17): "community", "complete", "costs", "describe", "development", "employment", "government", "growth", "health", "housing", "neighborhood", "planning", "public", "regional", "resources", "schools", "transportation".
0.300
agencieshealthhealthcareorganizationspopulations
SHARED TOKENS (5): "agencies", "health", "healthcare", "organizations", "populations". | EXACT TITLE in mental_health: "Magellan Health".
0.300
buildingcommunitydevelopmentdirectevaluationfieldhealthidentifiedimproveinformationmanagementperformancepersonnelplanningpolicyprofessionalsprovideprovidersrecordsreport
SHARED TOKENS (30): "building", "community", "development", "direct", "evaluation", "field", "health", "identified", "improve", "information", "management", "performance", "personnel", "planning", "policy", "professionals", "provide", "providers", "records", "report"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectsassociatedbehaviorcaseschangescommunityconditioncontextdifferentfunctionshealthindividualmajormakingmethodsoccursparticularprofessionalprofessionalsprograms
SHARED TOKENS (25): "affects", "associated", "behavior", "cases", "changes", "community", "condition", "context", "different", "functions", "health", "individual", "major", "making", "methods", "occurs", "particular", "professional", "professionals", "programs"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociateassociatedbecomebuildingcommercialconsequencescostsdevelopmentexpansiongeographicgrowthhousinginfrastructuremeasureplanningpopulationprivaterapidrates
SHARED TOKENS (26): "agency", "associate", "associated", "become", "building", "commercial", "consequences", "costs", "development", "expansion", "geographic", "growth", "housing", "infrastructure", "measure", "planning", "population", "private", "rapid", "rates"....
0.300
commitmentcommunitycomplianceconsumerdevelopeddevelopmenteffectivegeneralgovernmenthealthhousinglegallocalmovementorganizationsprivateprofessionalsrightsspecializedspecific
SHARED TOKENS (24): "commitment", "community", "compliance", "consumer", "developed", "development", "effective", "general", "government", "health", "housing", "legal", "local", "movement", "organizations", "private", "professionals", "rights", "specialized", "specific"....
0.300
Street network ↗ Q358078 KW CROSS HIGH
analysisbecomeconnectedcreatingedgeslinesmovementnationalnetworknetworksnodesrepresentstreetsystemtransportation
SHARED TOKENS (15): "analysis", "become", "connected", "creating", "edges", "lines", "movement", "national", "network", "networks", "nodes", "represent", "street", "system", "transportation".
0.300
academicanalysisassessmentbehaviorcodescombinescommunitycreatecreatingdifferentfieldhealthlegalprofessionalsschoolstudentstudentssupportwork
SHARED TOKENS (19): "academic", "analysis", "assessment", "behavior", "codes", "combines", "community", "create", "creating", "different", "field", "health", "legal", "professionals", "school", "student", "students", "support", "work".
0.300
associatedcaseschangeconditionscontextdistincteffectiveeventhealthindividualmajormanagementmultipleoccursperformanceprofessionalqualityrelatedresponserisk
SHARED TOKENS (23): "associated", "cases", "change", "conditions", "context", "distinct", "effective", "event", "health", "individual", "major", "management", "multiple", "occurs", "performance", "professional", "quality", "related", "response", "risk"....
0.300
certifiedemergencyhealthindependentlylicensedlimitsphysicalpracticepractitionerpractitionersproblemsprovidereducedrequiringrestrictedtreatment
SHARED TOKENS (16): "certified", "emergency", "health", "independently", "licensed", "limits", "physical", "practice", "practitioner", "practitioners", "problems", "provide", "reduced", "requiring", "restricted", "treatment".
0.300
accessassociatedcategoriescommunitiescommunityconditionconditionsdefinesdefinitiondifferentdirecteffectiveemergencyexperiencegrowthhealthinfrastructuremanagementorganizationsplanning
SHARED TOKENS (26): "access", "associated", "categories", "communities", "community", "condition", "conditions", "defines", "definition", "different", "direct", "effective", "emergency", "experience", "growth", "health", "infrastructure", "management", "organizations", "planning"....
0.300
Mobile Crisis ↗ Q6886838 KW CROSS HIGH
agenciesagencyassessmentcommunityemergencyhealthindividualjurisdictionslegallocalotherwisepersonstatussupporttreatment
SHARED TOKENS (15): "agencies", "agency", "assessment", "community", "emergency", "health", "individual", "jurisdictions", "legal", "local", "otherwise", "person", "status", "support", "treatment".
0.300
associationconditioncurrentdifferentgrouphealthhistoryindividualjanuaryoccursphysicalproblemsprofessionalprofessionalsprogramsreportedriskstatussupporttreating
SHARED TOKENS (21): "association", "condition", "current", "different", "group", "health", "history", "individual", "january", "occurs", "physical", "problems", "professional", "professionals", "programs", "reported", "risk", "status", "support", "treating"....
0.300
alonebroadlycategoryconditiondependentgrouphomelessnessitselfmakingpersonproblemsratesrestrictedsinglesurrounding
SHARED TOKENS (15): "alone", "broadly", "category", "condition", "dependent", "group", "homelessness", "itself", "making", "person", "problems", "rates", "restricted", "single", "surrounding".
0.300
administeredagenciesauthoritycodedependdesigneddevelopmentdifferenteconomicgrowthimplementlawmeansnationalneededpreservationprotectprovisionsrequiresrules
SHARED TOKENS (22): "administered", "agencies", "authority", "code", "depend", "designed", "development", "different", "economic", "growth", "implement", "law", "means", "national", "needed", "preservation", "protect", "provisions", "requires", "rules"....
0.300
consequencescreatingeducationexpandingframeworkhealthinformationintegratedlawmodelneedorganizationspracticepresentprocessingratherrelationshipssafetysinglestated
SHARED TOKENS (21): "consequences", "creating", "education", "expanding", "framework", "health", "information", "integrated", "law", "model", "need", "organizations", "practice", "present", "processing", "rather", "relationships", "safety", "single", "stated"....
0.300
accessadditionagenciesarticlebeyondcommunitycoordinationcreatecreatingdefinesdelivereddesigneddevelopmenteconomiceducationeffectiveevenfuturegovernmenthealth
SHARED TOKENS (46): "access", "addition", "agencies", "article", "beyond", "community", "coordination", "create", "creating", "defines", "delivered", "designed", "development", "economic", "education", "effective", "even", "future", "government", "health"....
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmentemploymentexpansionfinancinggovernmentjurisdictionslawlocalnationalneededpermissionpermitpermits
SHARED TOKENS (25): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "employment", "expansion", "financing", "government", "jurisdictions", "law", "local", "national", "needed", "permission", "permit", "permits"....
0.300
accessapplicablebroaderdatadesigneddevelopmentestablishgeneralgovernmentinformationinstitutionslegalmakingmeanspolicypracticeprivateprovisionspublicresponse
SHARED TOKENS (24): "access", "applicable", "broader", "data", "designed", "development", "establish", "general", "government", "information", "institutions", "legal", "making", "means", "policy", "practice", "private", "provisions", "public", "response"....
0.300
buildingbusinesscentercentraldesigneddevelopmentgrowthintegratednetworkplanningprivatepublicresidentialservingsmaller
SHARED TOKENS (15): "building", "business", "center", "central", "designed", "development", "growth", "integrated", "network", "planning", "private", "public", "residential", "serving", "smaller".
0.300
conditionconsolidatedcostsdefinesdepartmentdepartmentsdirectlydischargeemergencygovernmenthealthlawlegalpaymentprogramprovideprovisionsrequiredrequiresstatus
SHARED TOKENS (23): "condition", "consolidated", "costs", "defines", "department", "departments", "directly", "discharge", "emergency", "government", "health", "law", "legal", "payment", "program", "provide", "provisions", "required", "requires", "status"....
0.300
administrationagencieschangescivilcontrolcoordinatecourtscreateddivisioneconomiceducationenforcementgoverninggovernmentinfluenceitselfjudiciallawlegalmodel
SHARED TOKENS (26): "administration", "agencies", "changes", "civil", "control", "coordinate", "courts", "created", "division", "economic", "education", "enforcement", "governing", "government", "influence", "itself", "judicial", "law", "legal", "model"....
0.300
businessescaseschangecoverageentitygovernsgrouphealthhealthcareinformationinsurancelawmaintainednationalprovidersprovisionsrequiresstandardstitletransfer
SHARED TOKENS (21): "businesses", "cases", "change", "coverage", "entity", "governs", "group", "health", "healthcare", "information", "insurance", "law", "maintained", "national", "providers", "provisions", "requires", "standards", "title", "transfer"....
0.300
additionagainstapproximatelyassociatedcannotcommercialcostscoveragecoveringdescribedifferentexpansiongovernmenthealthinsurancemajoroverviewpopulationprivateprogram
SHARED TOKENS (33): "addition", "against", "approximately", "associated", "cannot", "commercial", "costs", "coverage", "covering", "describe", "different", "expansion", "government", "health", "insurance", "major", "overview", "population", "private", "program"....
0.300
administrationdepartmentdescribedescribeseducationemergencyenforcementgoverninghealthcarejurisdictionlawlicenselicensinglimitsnationalpracticepractitionerpractitionersprofessionalrequirements
SHARED TOKENS (23): "administration", "department", "describe", "describes", "education", "emergency", "enforcement", "governing", "healthcare", "jurisdiction", "law", "license", "licensing", "limits", "national", "practice", "practitioner", "practitioners", "professional", "requirements"....
0.300
accessassociatedchangesconcernsconditionseffectiveemergencyhealthimplementationimprovemakingproblemsrepresentresearchrisktechnologytreating
SHARED TOKENS (17): "access", "associated", "changes", "concerns", "conditions", "effective", "emergency", "health", "implementation", "improve", "making", "problems", "represent", "research", "risk", "technology", "treating".
0.300
affectedaloneassociatedcasescontemporarydescribegeneralimproveindividualneedpresentprocessesqualityrecognizeresponsestructuretreatmentyet
SHARED TOKENS (18): "affected", "alone", "associated", "cases", "contemporary", "describe", "general", "improve", "individual", "need", "present", "processes", "quality", "recognize", "response", "structure", "treatment", "yet".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycasescreateddifferentestategovernmentlegallineslocalmeanminimumoriginalotherwiseownerownershipphysicalprivaterealrestrictedrights
SHARED TOKENS (23): "authority", "cases", "created", "different", "estate", "government", "legal", "lines", "local", "mean", "minimum", "original", "otherwise", "owner", "ownership", "physical", "private", "real", "restricted", "rights"....
0.300
agencycivilformalgovernmentlaw
SHARED TOKENS (5): "agency", "civil", "formal", "government", "law". | EXACT TITLE in land_use_planning: "Hearing (law)".
0.300
behaviorfoundingidentifyingmodeltreatment
SHARED TOKENS (5): "behavior", "founding", "identifying", "model", "treatment". | EXACT TITLE in mental_health: "Relapse prevention".
0.300
agencyassociationauthorityboardcompetencedocumentationgovernmentgraduatehealthjurisdictionslegallylicenselicensesoccupationalpermitspersonpracticeprofessionalreceiverequired
SHARED TOKENS (23): "agency", "association", "authority", "board", "competence", "documentation", "government", "graduate", "health", "jurisdictions", "legally", "license", "licenses", "occupational", "permits", "person", "practice", "professional", "receive", "required"....
0.300
absorbaccessadministrationagencyassociationcapacitychangescontroldepartmentdesignedfebruaryfoundinggovernmenthealthimproveinformationinstituteinstitutionalmaintainedmajor
SHARED TOKENS (33): "absorb", "access", "administration", "agency", "association", "capacity", "changes", "control", "department", "designed", "february", "founding", "government", "health", "improve", "information", "institute", "institutional", "maintained", "major"....
0.300
Schizophrenia ↗ Q41112 KW CROSS HIGH
affectedbehaviorcaseseffectiveexperienceformalgeneralhealthhistoryhomelessnessimproveneedpersonphysicalpopulationpresentproblemsreportedreportsrespond
SHARED TOKENS (23): "affected", "behavior", "cases", "effective", "experience", "formal", "general", "health", "history", "homelessness", "improve", "need", "person", "physical", "population", "present", "problems", "reported", "reports", "respond"....
0.300
agencydepartmenthealthidahopublic
SHARED TOKENS (5): "agency", "department", "health", "idaho", "public". | EXACT TITLE in mental_health: "Idaho Department of Health and Welfare".
0.300
authoritybehaviorcapacitycasesdeterminesenforcementgeneralgovernmenthealthindividualjurisdictionlawlegalmeansmethodsneedphysicalpublicrelatedrights
SHARED TOKENS (23): "authority", "behavior", "capacity", "cases", "determines", "enforcement", "general", "government", "health", "individual", "jurisdiction", "law", "legal", "means", "methods", "need", "physical", "public", "related", "rights"....
0.300
amongcasescodecommunitiescontrolcreatedevelopmentfeesfunctionshousingincomelocalmakesmodelmunicipalneedneighborhoodplanningpracticeproject
SHARED TOKENS (29): "among", "cases", "code", "communities", "control", "create", "development", "fees", "functions", "housing", "income", "local", "makes", "model", "municipal", "need", "neighborhood", "planning", "practice", "project"....
0.300
accessinformationlimitsplacesrules
SHARED TOKENS (5): "access", "information", "limits", "places", "rules". | EXACT TITLE in mental_health: "Confidentiality".
0.300
amongapproximatelyassociationboisebureaucanyoncapacitycentercountiescreatedcreatesdirectlyeastedgefebruaryidaholocalnampanationaloffice
SHARED TOKENS (27): "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "counties", "created", "creates", "directly", "east", "edge", "february", "idaho", "local", "nampa", "national", "office"....
0.300
Juvenile court ↗ Q468501 KW CROSS HIGH
authoritybehaviorcapacitychangescontextcourtscreatedatadevelopmentgeneralimplementationincreasesjurisdictionlegalmodelpracticeproceedingsprotectreportedresponse
SHARED TOKENS (26): "authority", "behavior", "capacity", "changes", "context", "courts", "create", "data", "development", "general", "implementation", "increases", "jurisdiction", "legal", "model", "practice", "proceedings", "protect", "reported", "response"....
0.300
Drainage ↗ Q7481320 EXACT TITLE
conditionsgrowthimproveneedsupplies
SHARED TOKENS (5): "conditions", "growth", "improve", "need", "supplies". | EXACT TITLE in land_use_planning: "Drainage".
0.300
agenciescategorycommunitydevelopededucationemploymentfieldhealthhousingindividualmodelofficeorganizationspersonnelpractitionerprivateproblemsprofessionalprofessionalsprograms
SHARED TOKENS (26): "agencies", "category", "community", "developed", "education", "employment", "field", "health", "housing", "individual", "model", "office", "organizations", "personnel", "practitioner", "private", "problems", "professional", "professionals", "programs"....
0.300
accessadditionadministrationaffectsagencybuildingbusinesscoordinatecreateddepartmentdevelopmentemergencyfundinggovernmenthousinginfrastructurelocalmajormanagementoccurs
SHARED TOKENS (30): "access", "addition", "administration", "affects", "agency", "building", "business", "coordinate", "created", "department", "development", "emergency", "funding", "government", "housing", "infrastructure", "local", "major", "management", "occurs"....
0.300
actionactualapprovalassessmentassociationconsequencescontextdefinesdevelopmentdocumentationevaluatingidentifyingjudicialmajormakingmanagementmoveparticipationplanpolicy
SHARED TOKENS (27): "action", "actual", "approval", "assessment", "association", "consequences", "context", "defines", "development", "documentation", "evaluating", "identifying", "judicial", "major", "making", "management", "move", "participation", "plan", "policy"....
0.300
acquisitionbusinesscapitalcentralcommissioncompetitiveconsolidatedconsolidationcontrolcorporatecreatedepartmentdirectentitygovernmentlawlegalmanagementmarketoccurs
SHARED TOKENS (31): "acquisition", "business", "capital", "central", "commission", "competitive", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "entity", "government", "law", "legal", "management", "market", "occurs"....
0.300
buildingcodescommercialdesigneddevelopeddevelopmentdistricthousingplanningpreservationrecreationresidentialrightssitestatedunituseszoning
SHARED TOKENS (18): "building", "codes", "commercial", "designed", "developed", "development", "district", "housing", "planning", "preservation", "recreation", "residential", "rights", "site", "stated", "unit", "uses", "zoning".
0.300
cannotdistincteffectiveevaluatefunctionsgeneralgroupidentifiedindividualoccupationalpersonphysicalpopulationprofessionalresponsespecifictreatment
SHARED TOKENS (17): "cannot", "distinct", "effective", "evaluate", "functions", "general", "group", "identified", "individual", "occupational", "person", "physical", "population", "professional", "response", "specific", "treatment".
0.300
agencyapprovedassessmentdepartmenteducationenforcementestablishingfederallygovernmentindependentinformationjanuarylegallocalnationalofficesoperationprogramspublicregional
SHARED TOKENS (22): "agency", "approved", "assessment", "department", "education", "enforcement", "establishing", "federally", "government", "independent", "information", "january", "legal", "local", "national", "offices", "operation", "programs", "public", "regional"....
0.300
additionarticledefinitioneducationexperiencehealthinfluenceknowledgemajormultipleparticipationperformancephysicalprocessesprofessionalprogramrecreationrelatedrelationshipsrisk
SHARED TOKENS (24): "addition", "article", "definition", "education", "experience", "health", "influence", "knowledge", "major", "multiple", "participation", "performance", "physical", "processes", "professional", "program", "recreation", "related", "relationships", "risk"....
0.300
authoritybuildingbusinesscapitalcommercialestatefunctionshousingincomeintendedinvestmentlocalmultipleofficeofficesrealrentalresidentialzoning
SHARED TOKENS (19): "authority", "building", "business", "capital", "commercial", "estate", "functions", "housing", "income", "intended", "investment", "local", "multiple", "office", "offices", "real", "rental", "residential", "zoning".
0.300
addressbehaviorcommunitiescommunityconcernscourtshealthintendedjudicialproblemsprogramspublicsafetyspecializedsystemtreatmentunderlying
SHARED TOKENS (17): "address", "behavior", "communities", "community", "concerns", "courts", "health", "intended", "judicial", "problems", "programs", "public", "safety", "specialized", "system", "treatment", "underlying".
0.300
assessmentassociatedbehaviorcasescategorychangesconcernsconditioncontextdeliverydevelopmentemergencyevidencefrequentlyhistoryindependentlyindividualoccursproceduresraises
SHARED TOKENS (30): "assessment", "associated", "behavior", "cases", "category", "changes", "concerns", "condition", "context", "delivery", "development", "emergency", "evidence", "frequently", "history", "independently", "individual", "occurs", "procedures", "raises"....
0.300
administeredboardcentercertificationcompletecontinuingcostsdegreedepartmenteducationformalfundinggovernmentgraduatehealthindependentlylicensurepracticeprogramprograms
SHARED TOKENS (24): "administered", "board", "center", "certification", "complete", "continuing", "costs", "degree", "department", "education", "formal", "funding", "government", "graduate", "health", "independently", "licensure", "practice", "program", "programs"....
0.300
actionchangecivilcommunitiesconnectconstructioncontrolevenhealthinfluenceland-uselimitslocalmanagementnationalotherwiseplanprocessesqualityregulation
SHARED TOKENS (24): "action", "change", "civil", "communities", "connect", "construction", "control", "even", "health", "influence", "land-use", "limits", "local", "management", "national", "otherwise", "plan", "processes", "quality", "regulation"....
0.300
addressassociatedassociationbehaviorcombinescommitmentconditionconditionsdesigneddevelopeddevelopmenteffectivehealthidentifiedimproveindividualmovementnationalproblemsprocessing
SHARED TOKENS (28): "address", "associated", "association", "behavior", "combines", "commitment", "condition", "conditions", "designed", "developed", "development", "effective", "health", "identified", "improve", "individual", "movement", "national", "problems", "processing"....
0.300
applicabledistrictpermituseszoning
SHARED TOKENS (5): "applicable", "district", "permit", "uses", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.300
advocacyaffectedcommunitycorporateeducationfundinggroupidentifiesindividuallocalnationalnonprofitprofessionalspublicpublishessupportsupported
SHARED TOKENS (17): "advocacy", "affected", "community", "corporate", "education", "funding", "group", "identifies", "individual", "local", "national", "nonprofit", "professionals", "public", "publishes", "support", "supported".
0.300
accessaddressamongapproximatelyassociationbusinessconstructioncostscoveragedelivereddevelopededucationestablishedexpansionfacilitiesfundingfuturegovernmenthealthhealthcare
SHARED TOKENS (37): "access", "address", "among", "approximately", "association", "business", "construction", "costs", "coverage", "delivered", "developed", "education", "established", "expansion", "facilities", "funding", "future", "government", "health", "healthcare"....
0.300
academicaddressagenciesemergencyevengovernmentorganizationsoutsideproblemsprogramprogramsresponserolesupportwork
SHARED TOKENS (15): "academic", "address", "agencies", "emergency", "even", "government", "organizations", "outside", "problems", "program", "programs", "response", "role", "support", "work".
0.300
againstamongauthoritycasesconcernsconstrainconstructiondistricteconomicestimatesexplicitlyhomelessnesshousingjurisdictionlimitslocalmajormetropolitanoperatingowned
SHARED TOKENS (30): "against", "among", "authority", "cases", "concerns", "constrain", "construction", "district", "economic", "estimates", "explicitly", "homelessness", "housing", "jurisdiction", "limits", "local", "major", "metropolitan", "operating", "owned"....
0.300
Alcoholism ↗ Q15326 KW CROSS HIGH
affectedaffectsamongassociatedconsequencescontextcostsdefinitionsdevelopmentdirectlyevidencegrouphealthincreasesindividualinformationparticipationpersonphysicalproblems
SHARED TOKENS (30): "affected", "affects", "among", "associated", "consequences", "context", "costs", "definitions", "development", "directly", "evidence", "group", "health", "increases", "individual", "information", "participation", "person", "physical", "problems"....
0.300
administrationassessmentcentraldevelopeddevelopmentdifferentfieldgrowthhealthheavilyidahointegrationknowledgemastermethodsmodelmodelsneedpracticepractitioners
SHARED TOKENS (29): "administration", "assessment", "central", "developed", "development", "different", "field", "growth", "health", "heavily", "idaho", "integration", "knowledge", "master", "methods", "model", "models", "need", "practice", "practitioners"....
0.300
communitydevelopmentdirectlydistricteconomicfinancingfutureincreasesinfrastructureinvestmentneedoriginalprivateprogramprojectpublicrelatedtoward
SHARED TOKENS (18): "community", "development", "directly", "district", "economic", "financing", "future", "increases", "infrastructure", "investment", "need", "original", "private", "program", "project", "public", "related", "toward".
0.300
administeredadministrationalternativeannualcostsdifferentgovernmentgrouphealthhealthcareinsurancelimitspercentplanprivateprogramprovidereceivereportreports
SHARED TOKENS (23): "administered", "administration", "alternative", "annual", "costs", "different", "government", "group", "health", "healthcare", "insurance", "limits", "percent", "plan", "private", "program", "provide", "receive", "report", "reports"....
0.300
amongbecomebusinesscodeshealthcareinformationlawlegalprofessionalsprotectprovidereceiverightssupporttreatment
SHARED TOKENS (15): "among", "become", "business", "codes", "healthcare", "information", "law", "legal", "professionals", "protect", "provide", "receive", "rights", "support", "treatment".
0.300
alternativeapplicationapproximatelybusinessesconnectedconstructioncostsdemanddesigndevelopeddifferentdischargeevenfieldincorporatesintendedmanagementmunicipalneednetwork
SHARED TOKENS (32): "alternative", "application", "approximately", "businesses", "connected", "construction", "costs", "demand", "design", "developed", "different", "discharge", "even", "field", "incorporates", "intended", "management", "municipal", "need", "network"....
0.300
accesscannotcommissioncontrolcostsdifferententityfrequentlygovernmentinfrastructurelineslocalmaintainsmarketmultipleoperatespipelinesproducepublicregulation
SHARED TOKENS (25): "access", "cannot", "commission", "control", "costs", "different", "entity", "frequently", "government", "infrastructure", "lines", "local", "maintains", "market", "multiple", "operates", "pipelines", "produce", "public", "regulation"....
0.300
additionadministersadministrationagencycertificationdepartmentfacilitiesfinancinggovhealthhealthcareinsuranceprogramprogramsqualityreportsstandardssystem
SHARED TOKENS (18): "addition", "administers", "administration", "agency", "certification", "department", "facilities", "financing", "gov", "health", "healthcare", "insurance", "program", "programs", "quality", "reports", "standards", "system".
0.300
academicaccessalternativecommunitycurriculumdesigneddifferenteducationgeneralimproveindividualintegrationmaterialsmethodsphysicalpracticeproceduresprovideresourceschool
SHARED TOKENS (27): "academic", "access", "alternative", "community", "curriculum", "designed", "different", "education", "general", "improve", "individual", "integration", "materials", "methods", "physical", "practice", "procedures", "provide", "resource", "school"....
0.300
analysisassessmentcapacitycostscurrentdatademandemploymentestimatesfutureinfrastructuremodelplanningpolicypopulationratesspecifictransportation
SHARED TOKENS (18): "analysis", "assessment", "capacity", "costs", "current", "data", "demand", "employment", "estimates", "future", "infrastructure", "model", "planning", "policy", "population", "rates", "specific", "transportation".
0.300
academicbecomecontinuingeducationfieldpracticepractitionerprofessionalrelatedrequirementsresearchschoolspecificteachingtraining
SHARED TOKENS (15): "academic", "become", "continuing", "education", "field", "practice", "practitioner", "professional", "related", "requirements", "research", "school", "specific", "teaching", "training".
0.300
administeredagenciesapproximatelyauthoritybuildingbusinesscapacitycivilconstructioncontroldepartmentdesigndirectdirectlyeastestablishfacilitiesgeneralgovernmentinfrastructure
SHARED TOKENS (42): "administered", "agencies", "approximately", "authority", "building", "business", "capacity", "civil", "construction", "control", "department", "design", "direct", "directly", "east", "establish", "facilities", "general", "government", "infrastructure"....
0.300
buildingdegreedesigndevelopeddevelopmententitygeneralgovernmentlimitsoperatorprivatepublicratherrelatedrestrictedruralsitesites
SHARED TOKENS (18): "building", "degree", "design", "developed", "development", "entity", "general", "government", "limits", "operator", "private", "public", "rather", "related", "restricted", "rural", "site", "sites".
0.300
approximatelyassociatedassociationbecomebehaviorcaseschangesconditionconditionseducationgeneralgrouphealthhistorymajorpersonphysicalproblemsreportreported
SHARED TOKENS (25): "approximately", "associated", "association", "become", "behavior", "cases", "changes", "condition", "conditions", "education", "general", "group", "health", "history", "major", "person", "physical", "problems", "report", "reported"....
0.300
administrationassociatebachelorbecomebuildingcommunitydegreedifferenthealthpositionprogramreceivespecifictrainingwork
SHARED TOKENS (15): "administration", "associate", "bachelor", "become", "building", "community", "degree", "different", "health", "position", "program", "receive", "specific", "training", "work".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionactionapplicationconnectdevelopmentevenfunctionsgovernmentjurisdictionslaterlegalnetworksownerownershippaymentprivatepublicspecifiedsurroundingtitle
SHARED TOKENS (22): "acquisition", "action", "application", "connect", "development", "even", "functions", "government", "jurisdictions", "later", "legal", "networks", "owner", "ownership", "payment", "private", "public", "specified", "surrounding", "title"....
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
allowingapplicationauthorityboundariesbuildingchangecommercialcommissioncommunitycontrolcouncilcourtscreatingcurrentdistrictgeneralgovernmentlayerlocalmakes
SHARED TOKENS (40): "allowing", "application", "authority", "boundaries", "building", "change", "commercial", "commission", "community", "control", "council", "courts", "creating", "current", "district", "general", "government", "layer", "local", "makes"....
0.300
agencybecomebehaviorcurrentdepartmentdiscoveryestablishedexperiencegovernmenthealthinstituteinstitutionslawnationalorganizationsresearchthroughouttreatment
SHARED TOKENS (18): "agency", "become", "behavior", "current", "department", "discovery", "established", "experience", "government", "health", "institute", "institutions", "law", "national", "organizations", "research", "throughout", "treatment".
0.300
approximatelyboardboisebureaucapacitycenterconstructiondesignidaholawmaterialsnationalprovideresourcewesternwork
SHARED TOKENS (16): "approximately", "board", "boise", "bureau", "capacity", "center", "construction", "design", "idaho", "law", "materials", "national", "provide", "resource", "western", "work".
0.300
applicablecomplianceconstraincreatesdevelopmentdocumententityestablishedestatefuturegovernmentgrowthimprovelegallocalmarketnonprofitobjectivesoccursotherwise
SHARED TOKENS (42): "applicable", "compliance", "constrain", "creates", "development", "document", "entity", "established", "estate", "future", "government", "growth", "improve", "legal", "local", "market", "nonprofit", "objectives", "occurs", "otherwise"....
0.300
alternativecannotcompletecreatedevelopeddifferentevenexperienceinfluenceitselfmethodsmovementoccursrestsmallertoward
SHARED TOKENS (16): "alternative", "cannot", "complete", "create", "developed", "different", "even", "experience", "influence", "itself", "methods", "movement", "occurs", "rest", "smaller", "toward".
0.300
academicawaybuildingcentercommunitygrouphealthindividualintendedlocalproblemsprogramprogramsschooltowardtreatmentwork
SHARED TOKENS (17): "academic", "away", "building", "center", "community", "group", "health", "individual", "intended", "local", "problems", "program", "programs", "school", "toward", "treatment", "work".
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
addressassociatedbuildingcommunitycontemporarycreatingdesigndevelopmentestatefacilitieshousinginfrastructureland-usemovementmunicipalneighborhoodplanningpopulationpreservationreal
SHARED TOKENS (22): "address", "associated", "building", "community", "contemporary", "creating", "design", "development", "estate", "facilities", "housing", "infrastructure", "land-use", "movement", "municipal", "neighborhood", "planning", "population", "preservation", "real"....
0.300
accesscommunitycompletedesigndesignedeconomichealthmaintainedpolicypractitionerspublicrelatedrequiressafetytransportation
SHARED TOKENS (15): "access", "community", "complete", "design", "designed", "economic", "health", "maintained", "policy", "practitioners", "public", "related", "requires", "safety", "transportation".
0.300
approvalapprovedbuildingcommercialconstructioncontextcontractorscostscreatesdesigndeterminedevelopmentdifferenteconomicestatefinancinggrowthhousingpermitsplanning
SHARED TOKENS (29): "approval", "approved", "building", "commercial", "construction", "context", "contractors", "costs", "creates", "design", "determine", "development", "different", "economic", "estate", "financing", "growth", "housing", "permits", "planning"....
🫐 BERRY51 edges
0.280
Parcel ↗ EXACT TITLE
deliverygeographyindividualtopics
SHARED TOKENS (4): "delivery", "geography", "individual", "topics". | EXACT TITLE in land_use_planning: "Parcel".
0.280
healthhealthcaremanagementreported
SHARED TOKENS (4): "health", "healthcare", "management", "reported". | EXACT TITLE in mental_health: "Universal Health Services".
0.280
actualcommunitycreatedevelopmentgrowthmanagementoccursownedplanningpreservationprivateresourcesruralzoning
SHARED TOKENS (14): "actual", "community", "create", "development", "growth", "management", "occurs", "owned", "planning", "preservation", "private", "resources", "rural", "zoning".
0.280
adaboisebureauconstructioncontroldirectlyeastidahomultipleoperatingoperationalprivatesouthernwestern
SHARED TOKENS (14): "ada", "boise", "bureau", "construction", "control", "directly", "east", "idaho", "multiple", "operating", "operational", "private", "southern", "western".
0.280
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidahowestern
SHARED TOKENS (4): "approximately", "boise", "idaho", "western". | EXACT TITLE in land_use_planning: "Boise River".
0.260
broaderchangecontextdeliveredexplicitlygroupmanagementmechanismrelationshipsspecializedsupporttrainingtreatment
SHARED TOKENS (13): "broader", "change", "context", "delivered", "explicitly", "group", "management", "mechanism", "relationships", "specialized", "support", "training", "treatment".
0.260
approximatelyboisedatadistrictevengovernmentidaholegislaturelimitspopulationresidentssinglesubsequent
SHARED TOKENS (13): "approximately", "boise", "data", "district", "even", "government", "idaho", "legislature", "limits", "population", "residents", "single", "subsequent".
0.260
actionamongboundariescontroldistinctexpandinggovernmentjurisdictionlawlocalmunicipalresponsework
SHARED TOKENS (13): "action", "among", "boundaries", "control", "distinct", "expanding", "government", "jurisdiction", "law", "local", "municipal", "response", "work".
0.260
accesscentercentralcommunitygeneralgrouphealthhealthcarelocalnetworkplanningpracticepractitioners
SHARED TOKENS (13): "access", "center", "central", "community", "general", "group", "health", "healthcare", "local", "network", "planning", "practice", "practitioners".
0.260
categoriescategoryconsequencesdirectdirectlyhealthindividualoperatingpercentphysicalproblemsrelatedsubstantial
SHARED TOKENS (13): "categories", "category", "consequences", "direct", "directly", "health", "individual", "operating", "percent", "physical", "problems", "related", "substantial".
0.260
businessdefinesdepartmenthealthindividualinsurancelicensedpersonprofessionalprovideprovidersreceivetreatment
SHARED TOKENS (13): "business", "defines", "department", "health", "individual", "insurance", "licensed", "person", "professional", "provide", "providers", "receive", "treatment".
0.240
communitydepartmentsdevelopeddifferentfundinghealthhomelessnesshousingintendedprofessionalsupportedwork
SHARED TOKENS (12): "community", "departments", "developed", "different", "funding", "health", "homelessness", "housing", "intended", "professional", "supported", "work".
0.240
advocacyassociationcontinuingeducationgeneralinformationinsurancenationalprofessionalresearchresourcesworkers
SHARED TOKENS (12): "advocacy", "association", "continuing", "education", "general", "information", "insurance", "national", "professional", "research", "resources", "workers".
0.240
authorityboundariescorporationcreateddistrictentitygeographicgovernmentlegislaturelocalpublicstatute
SHARED TOKENS (12): "authority", "boundaries", "corporation", "created", "district", "entity", "geographic", "government", "legislature", "local", "public", "statute".
0.240
actionconditionsdocumentationeducationhealthimproveindividualmanagementmultipleplanrecordreview
SHARED TOKENS (12): "action", "conditions", "documentation", "education", "health", "improve", "individual", "management", "multiple", "plan", "record", "review".
0.240
Right to property ↗ KW CROSS HIGH
articlecivileconomicgeneralindividuallegalownershippaymentpersonprivaterightsspecified
SHARED TOKENS (12): "article", "civil", "economic", "general", "individual", "legal", "ownership", "payment", "person", "private", "rights", "specified".
0.240
administersagencydepartmentdepartmentsdevelopmentdirectlyfinancinggovernmenthousingmemberprogramreports
SHARED TOKENS (12): "administers", "agency", "department", "departments", "development", "directly", "financing", "government", "housing", "member", "program", "reports".
0.220
conditionsconsequencesdeliveredgenerallegalparticipationpresentprocessesprofessionalsstreettreatment
SHARED TOKENS (11): "conditions", "consequences", "delivered", "general", "legal", "participation", "present", "processes", "professionals", "street", "treatment".
0.220
informationmapping
SHARED TOKENS (2): "information", "mapping". | EXACT TITLE in land_use_planning: "Soil survey".
0.220
againstamongbehaviorcontrolcontrollingcurrentdefineseconomichealthphysicalreport
SHARED TOKENS (11): "against", "among", "behavior", "control", "controlling", "current", "defines", "economic", "health", "physical", "report".
0.220
agenciescommunitiescreatingfunctionsmanagementplanningprogramsqualityresourcesrightsstudy
SHARED TOKENS (11): "agencies", "communities", "creating", "functions", "management", "planning", "programs", "quality", "resources", "rights", "study".
0.220
boisecoveringcreatedfacilitiesidahomultiplenationalpercentpopulationsrecreationresources
SHARED TOKENS (11): "boise", "covering", "created", "facilities", "idaho", "multiple", "national", "percent", "populations", "recreation", "resources".
0.220
additioncentercodeemergencyhealthlocalnationalnetworkoperationprovidesupports
SHARED TOKENS (11): "addition", "center", "code", "emergency", "health", "local", "national", "network", "operation", "provide", "supports".
0.220
affectedchangesconditiondevelopmenteconomiceveneventexperiencehealthhistoryplaces
SHARED TOKENS (11): "affected", "changes", "condition", "development", "economic", "even", "event", "experience", "health", "history", "places".
0.210
major
SHARED TOKENS (1): "major". | EXACT TITLE in land_use_planning: "Sekisui House".
0.200
casesincomememberprincipalprovidereceiveresidentialseparatesupportunit
SHARED TOKENS (10): "cases", "income", "member", "principal", "provide", "receive", "residential", "separate", "support", "unit".
0.200
adaboisebureaucanyoncountiesfillsidahotreasurevalleywestern
SHARED TOKENS (10): "ada", "boise", "bureau", "canyon", "counties", "fills", "idaho", "treasure", "valley", "western".
0.200
broadlyfacilitieshealthhealthcareinstitutionsnetworkpublicresourcesservedsystem
SHARED TOKENS (10): "broadly", "facilities", "health", "healthcare", "institutions", "network", "public", "resources", "served", "system".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastidahometropolitanpopulationschoolschools
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "east", "idaho", "metropolitan", "population", "school", "schools".
0.200
applicationsbehaviorcivilconstructionknowledgematerialsproblemsrelatedstudyuses
SHARED TOKENS (10): "applications", "behavior", "civil", "construction", "knowledge", "materials", "problems", "related", "study", "uses".
0.200
administrationbuildingdepartmentdirectlyhealthintegratedoutsidequalityreportstreatment
SHARED TOKENS (10): "administration", "building", "department", "directly", "health", "integrated", "outside", "quality", "reports", "treatment".
0.200
associationdevelopmentlicensedmemberpracticeprofessionalprofessionalsqualitystatedstudents
SHARED TOKENS (10): "association", "development", "licensed", "member", "practice", "professional", "professionals", "quality", "stated", "students".
0.200
continuingfacilitieshealthhealthcareidahonetworkoperatesoperatingsupportsystem
SHARED TOKENS (10): "continuing", "facilities", "health", "healthcare", "idaho", "network", "operates", "operating", "support", "system".
0.180
adaboisegovernmentidahometropolitanmunicipalpopulationseparatestreet
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate", "street".
0.180
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
boisebureaucivilcountieseastidahonationalprovidewestern
SHARED TOKENS (9): "boise", "bureau", "civil", "counties", "east", "idaho", "national", "provide", "western".
0.180
awaydeliveryfragmentedhealthhealthcareintegratedmodelresponsesystems
SHARED TOKENS (9): "away", "delivery", "fragmented", "health", "healthcare", "integrated", "model", "response", "systems".
0.160
concernsevidencehealthphysicalproblemsresourcesreviewtreatment
SHARED TOKENS (8): "concerns", "evidence", "health", "physical", "problems", "resources", "review", "treatment".
0.160
actionchangeeffectivemakingratherrelationshipssystemsystems
SHARED TOKENS (8): "action", "change", "effective", "making", "rather", "relationships", "system", "systems".
0.160
Septic tank ↗ Q386300 KW CROSS HIGH
connectedfieldprocessesruralsystemsystemsthereforetreatment
SHARED TOKENS (8): "connected", "field", "processes", "rural", "system", "systems", "therefore", "treatment".
0.140
associationconditionspopulationpracticeprofessionalpublishesresearch
SHARED TOKENS (7): "association", "conditions", "population", "practice", "professional", "publishes", "research".
0.140
legalmerelyownershippersonrightssubsequentsystem
SHARED TOKENS (7): "legal", "merely", "ownership", "person", "rights", "subsequent", "system".
0.120
actualcurrentestatemarketproducereal
SHARED TOKENS (6): "actual", "current", "estate", "market", "produce", "real".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahometropolitanpercentpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "metropolitan", "percent", "population".
0.120
evaluationexperienceprofessionalreviewreviewssites
SHARED TOKENS (6): "evaluation", "experience", "professional", "review", "reviews", "sites".
0.120
constructionimproveitselfmaterialsrealtitle
SHARED TOKENS (6): "construction", "improve", "itself", "materials", "real", "title".
0.120
businessdevelopmentestateofficeofficesrather
SHARED TOKENS (6): "business", "development", "estate", "office", "offices", "rather".
0.120
awayboiseidahomajormetropolitanserves
SHARED TOKENS (6): "away", "boise", "idaho", "major", "metropolitan", "serves".
0.100
annualassociationdifferentprofessionalstudents
SHARED TOKENS (5): "annual", "association", "different", "professional", "students".
0.100
associatebuildingcourtsidahopresent
SHARED TOKENS (5): "associate", "building", "courts", "idaho", "present".
0.100
agencycertificationpersonprofessionalpublic
SHARED TOKENS (5): "agency", "certification", "person", "professional", "public".
0.100
councileducationprogramsrelateduniversities
SHARED TOKENS (5): "council", "education", "programs", "related", "universities".
◈ Frequently Asked Questions
Mental Health × Land Use Planning — Treasure Valley
HAIKU · HIGH GATE
How does Ada County's land use planning affect access to mental health services in Boise?
Ada County zoning decisions determine where mental health clinics, counseling centers, and crisis facilities can operate within Boise's city limits and surrounding areas. When Ada County restricts mixed-use development or concentrates services in downtown Boise, residents in outlying neighborhoods face longer travel times to reach mental health providers, directly impacting treatment engagement rates across the metropolitan area.
Why does Canyon County's approach to residential zoning influence mental health outcomes in Nampa and Caldwell?
Canyon County's land use policies control housing density and affordability in Nampa and Caldwell, which directly correlates with stress levels, social isolation, and access to mental health resources among residents. Sprawling low-density zoning increases transportation barriers to mental health services, while concentrated housing near employment hubs in Meridian and western Boise reduces commute stress and improves service proximity.
What role does Treasure Valley population growth play in coordinating mental health infrastructure with land use planning?
The Treasure Valley's population expansion requires Ada County and Canyon County to align mental health facility placement with new residential zones, commercial corridors, and transit corridors in Boise, Meridian, Nampa, and Caldwell. Without proactive coordination between land use planners and mental health administrators, rapid metropolitan growth outpaces service capacity and increases psychological distress from community instability.
How can Boise State University research inform mental health considerations in Treasure Valley land use decisions?
Boise State University researchers study how urban design, neighborhood walkability, and access to green space in Ada County and Canyon County affect depression, anxiety, and community belonging among residents. These findings can guide Boise, Meridian, Nampa, and Caldwell planners to incorporate mental health-supportive features—such as proximity to parks and pedestrian infrastructure—into zoning codes and comprehensive plans.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Mental Health × Land Use Planning 12 QID bridges 251 edges 6,698 ext links 2026-07-17 22:02:53 UTC b0c5b076d7fba4b7
Mental Health corridor ↗ Land Use Planning corridor ↗ Land Use Planning × Mental Health ↗ boisestandard.org/standard ↗
Parent Corridors
Mental Health × All Other Verticals