—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Interior Design Architecture ↔ relates to ↔ Biotech Life Sciences

18 Wikipedia bridge articles confirmed in both vertical ledgers. 273 deterministic cross-vertical edges. 7,200 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
273 Cross Edges
7,200 External Sources
299 Wikipedia Articles
17 🌲 Evergreen
213 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Interior Design Architecture
× Biotech Life Sciences
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
273
External Sources Harvested
7,200
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
University of Idaho
score: 1.0000  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (18)
University of IdahoIdahoBoise metropolitan areaBoise State UniversityCollege of Western IdahoTreasure ValleyIdaho State UniversityOnline marketplaceMergers and acquisitionsBoise, IdahoOccupational Safety and Health AdministrationPrivate equityNampa, IdahoBoise RiverAda County, IdahoCaldwell, IdahoMeridian, IdahoSnake River Plain
Shared Semantics (20 tokens)
idahoboisepopulationcapitalmetropolitanpublicnorthwestwesternadaamongapproximatelyuniversitycanyonhomemeridiantreasurevalleycollegecampusresearch
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:33:19 UTC
Content Hash
a628f7499288cf42
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (21): "among", "approximately", "boise", "campus", "division", "established", "graduate", "idaho", "later", "moscow", "operates", "production", "professional", "public", "represented", "research", "statewide", "students", "uidaho", "undergraduate".... | EXACT TITLE in interior_design_architecture: "University of Idaho". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
amongapproximatelyboisecampusdivisionestablishedgraduateidaholatermoscowoperatesproductionprofessionalpublicrepresentedresearchstatewidestudentsuidahoundergraduateuniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (32): "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "early", "economy", "geographic", "idaho", "instead", "land", "manufacturing", "methods", "million", "national", "northwest", "official", "people".... | EXACT TITLE in interior_design_architecture: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
agricultureapproximatelyassociatedboisecapitalcontainsdistinctearlyeconomygeographicidahoinsteadlandmanufacturingmethodsmillionnationalnorthwestofficialpeopleperiodspopulationproductssciencesectorseparatesignificantsmallsuppliestechnology+2
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
In 2025, the gross state product (state GDP) for Idaho was $135.5 billion and the state's per capita personal income was $64,846. Idaho had the 39th highest GDP per capita in the United States of America in 2025. In 2025, small businesses made up 99.2% and employed 56.0% of the state's work force. As of May 2025, the state's unemployment rate was 3.6%. Total employment in Idaho in 2024 was 965,824. Idaho is the top potato producing state in the United States and almost one-third of the nation's potatoes are grown in the Snake River Plain, a belt of low-lying land that extends across southern Idaho. Important industries in Idaho are food processing, lumber and wood products, machinery, chemical products, paper products, electronics manufacturing, silver and other mining, and tourism. The world's largest factory for barrel cheese, the raw product for processed cheese, is in Gooding, Idaho. It has a capacity of 120,000 metric tons per year of barrel cheese and belongs to the Glanbia group. As Idaho neared statehood, mining and other extractive industries played a significant role in its economy. Although the state's reliance on mining has diminished over time, Idaho remains renowned as "The Gem State" due to its production of seventy-two varieties of precious and semi-precious stones. Idaho is a leading national producer of potatoes, trout, Austrian winter peas, and lentils. The state's primary industries include manufacturing, agriculture, food processing, timber, and mining. Tourism is another way that Idaho capitalizes on its natural resources.
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "canyon", "component", "home", "idaho", "meridian", "metropolitan", "nampa", "nearly", "northwest", "population", "section", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
adaboisecanyoncomponenthomeidahomeridianmetropolitannampanearlynorthwestpopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "boise", "business", "college", "colleges", "division", "economics", "education", "engineering", "graduate", "health", "idaho", "independent", "master", "million", "program", "programs", "public", "reported".... | EXACT TITLE in interior_design_architecture: "Boise State University". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityamongboisebusinesscollegecollegesdivisioneconomicseducationengineeringgraduatehealthidahoindependentmastermillionprogramprogramspublicreportedresearchschoolteamsuniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (26): "academic", "ada", "board", "boise", "campus", "canyon", "college", "colleges", "community", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "student".... | EXACT TITLE in interior_design_architecture: "College of Western Idaho". | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
academicadaboardboisecampuscanyoncollegecollegescommunitydevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedstudentstudentstechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (12): "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in interior_design_architecture: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
associationboisehistoricallyidaholandlocalmetropolitanregionresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Idaho State University
Q1656608 EXACT TITLE 0.940
QID OVERLAP: Q1656608 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (12): "activity", "among", "campus", "enrollment", "idaho", "meridian", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in interior_design_architecture: "Idaho State University". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
activityamongcampusenrollmentidahomeridianprogramspublicresearchstudentsuniversitiesuniversity
ho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
O
Q3390477 QID OVERLAP 0.800
QID OVERLAP: Q3390477 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (19): "availability", "consumer", "consumers", "general", "higher", "information", "multiple", "online", "operator", "process", "product", "production", "products", "providers", "selection", "single", "site", "type", "users".
availabilityconsumerconsumersgeneralhigherinformationmultipleonlineoperatorprocessproductproductionproductsprovidersselectionsinglesitetypeusers
s of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
information is provided by multiple third parties. Online marketplaces are the primary type of multichannel ecommerce and can be a way to streamline the production process. In an online marketplace, consumer transactions are processed by the marketplace operator and then delivered and fulfilled by the participating retailers or wholesalers. These types of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
is wider, and availability is higher than in vendor-specific online retail stores. Some online marketplaces have a wide variety of general interest products that cater to almost all the needs of the consumers, others are consumer specific and cater to a particular segment. B2B online marketplaces Business-to-business (B2B) online marketplaces are platforms that allow companies to buy and sell products or services to other businesses. These marketplaces typically focus on a specific product or service category and are used by businesses to find suppliers, negotiate prices, and manage logistics. Some examples of B2B online marketplaces include VerticalNet, Commerce One, and Covisint, which were some of the earliest B2B marketplaces to emerge in the early days of e-commerce.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (42): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "certain", "consolidation", "control", "corporate", "create", "department", "direct", "economically", "entity", "federal", "governed"....
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcertainconsolidationcontrolcorporatecreatedepartmentdirecteconomicallyentityfederalgovernedgovernmentlawlegalmanagementmarketoperatingoperationsorganizationownershipposition+12
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "sectors", "technology", "treasure", "valley".
adaannualboisecapitalhomeidaholocallymajormanufacturingmetropolitanpopulationsectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
O
Q746186 QID OVERLAP 0.800
QID OVERLAP: Q746186 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (23): "act", "administration", "agency", "conditions", "costs", "department", "education", "employment", "established", "federal", "health", "inspections", "labor", "law", "occupational", "outreach", "reduce", "regulations", "regulatory", "safe"....
actadministrationagencyconditionscostsdepartmenteducationemploymentestablishedfederalhealthinspectionslaborlawoccupationaloutreachreduceregulationsregulatorysafesafetystandardstraining
States Department of Labor that originally had federal visitorial powers to inspect and examine workplaces. The United States Congress established the agency under the Occupational Safety and Health Act (OSH Act), which President Richard M. Nixon signed into law on December 29, 1970. OSHA's mission is to "assure safe and healthy working conditions for working men and women by setting and enforcing standards and by providing training, outreach, education, and assistance". The agency is also charged with enforcing a variety of whistleblower statutes and regulations.
History From its creation in 1934, the Bureau of Labor Standards of the Department of Labor addressed some work safety issues. The economic boom and associated labor turnover during World War II worsened work safety in nearly all areas of the United States economy, but after 1945 accidents again declined as long-term forces reasserted themselves. Additionally, new and powerful labor unions played an increasingly important role in worker safety post-World War II. In the 1960s, increasing economic expansion again led to rising injury rates, and the resulting political pressures led Congress to establish the Occupational Safety and Health Administration (OSHA) on April 28, 1971, the date that the Occupational Health and Safety Act became effective. The new agency incorporated much of what had been the original Bureau of Labor Standards. George Guenther was appointed by Labor Secretary James D. Hodgson as the agency's first director. OSHA has run a number of training, compliance assistance, and health and safety recognition programs throughout its history. The OSHA Training Institute, which trains government and private sector health and safety personnel, began in 1972. In 1978, the agency began a grant-making program, now called the Susan Harwood Training Grant Program, to train workers and employers in reducing workplace hazards.
OSH Act coverage The OSH Act covers most private-sector employers and their workers, in addition to some public-sector employers and workers in the 50 states and certain territories and jurisdictions under federal authority. Those jurisdictions include the District of Columbia, Puerto Rico, the Virgin Islands, American Samoa, Guam, Northern Mariana Islands, Wake Island, Johnston Island, and the Outer Continental Shelf Lands as defined in the Outer Continental Shelf Lands Act. Private sector employers The OSH Act covers most private sector employers in all 50 states, the District of Columbia, and other U.S. jurisdictions—either directly through federal OSHA or through an OSHA-approved state plan. State plans are OSHA-approved job safety and health programs operated by individual states instead of federal OSHA. Federal OSHA approves and monitors all state plans and provides as much as fifty percent of the funding for each program.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (25): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "financing", "firms", "general", "instead", "management", "operational", "ownership", "partnerships", "private", "product", "products", "provide"....
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancingfirmsgeneralinsteadmanagementoperationalownershippartnershipsprivateproductproductsprovidepublicratherrolespecializedstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "student", "university", "western".
boisecanyoncollegehomeidahomeridianmetropolitannampanorthwestpopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise River
Q891080 EXACT TITLE 0.780
QID OVERLAP: Q891080 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (4): "approximately", "boise", "idaho", "western". | EXACT TITLE in biotech_life_sciences: "Boise River".
approximatelyboiseidahowestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in interior_design_architecture (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
adaboisecapitalhomeidahojurisdictionlocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Snake River Plain
Q1396049 QID OVERLAP 0.580
QID OVERLAP: Q1396049 in interior_design_architecture (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (4): "idaho", "land", "major", "northwest".
idaholandmajornorthwest
The Snake River Plain is a geologic feature located primarily within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain has a significant effect on the climate of Yellowstone National Park and the adjacent areas to the south and west of Yellowstone. Over time, the Yellowstone hotspot left a 70-mile (110 km) wide channel through the Rocky Mountains. This channel is in line with the gap between the Cascade Range and the Sierra Nevada. The result is a moisture channel extending from the Pacific Ocean to Yellowstone. Moisture from the Pacific Ocean streams onshore in the form of clouds and humid air. It passes through the gap between the Sierra and Cascades and into the Snake River Plain where it is channeled through most of the Rocky Mountains with no high plateaus or mountain ranges to impede its progress. It finally encounters upslope conditions at the head of the Snake River Valley at Ashton, Idaho; at Island Park, Idaho; at the Teton Range east of Driggs, Idaho; and at the Yellowstone Plateau of Yellowstone National Park where the channeled moisture precipitates out as rain and snow. The result is a localized climate on the eastern side of the Rockies that is akin to a climate on the west slope of the Cascades or the northern Sierra. The head of the Snake River Valley, the Tetons, and the Yellowstone Plateau receive much more precipitation than other areas of the region, and the area is known for being wet, green, having many streams, and having abundant snow in winter. Although the topography of the Plain has largely gone unchanged for several million years, this region's climate has not been so constant. Current climatic conditions began to characterize the region in the early Pleistocene (approximately 2.5 million years ago). However, the arid climate of today was born from the gradual dissipation of a climate defined by greater moisture and narrower ranges of annual temperatures.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
255 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP255 edges
🌿 BRANCH212 edges
0.500
Houzz ↗ Q17055479 EXACT TITLE
acquisitionsapplicationsarchitecturebusinesscommunityconsumer-facingdesignexpandedhomeintelligencemanagementonlineplatformprojectsoftwaresupportsusers
SHARED TOKENS (17): "acquisitions", "applications", "architecture", "business", "community", "consumer-facing", "design", "expanded", "home", "intelligence", "management", "online", "platform", "project", "software", "supports", "users". | EXACT TITLE in interior_design_architecture: "Houzz".
0.500
Antibody ↗ Q79460 EXACT TITLE
allowingbecomebodycapacitycontainsdeliverydemonstratedescribesdescribingdifferentdirectlydistinctessentialformfunctionsgeneralhumanidentifyindependentlyindividual
SHARED TOKENS (33): "allowing", "become", "body", "capacity", "contains", "delivery", "demonstrate", "describes", "describing", "different", "directly", "distinct", "essential", "form", "functions", "general", "human", "identify", "independently", "individual".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
agricultureanotherapplicationsappliesapprovalcertainconsequentlydefinitionsdevelopdevelopeddevelopmentdirectlyemphasizesengineeringenvironmentalfunctionshigherhumanimportantinitial
SHARED TOKENS (59): "agriculture", "another", "applications", "applies", "approval", "certain", "consequently", "definitions", "develop", "developed", "development", "directly", "emphasizes", "engineering", "environmental", "functions", "higher", "human", "important", "initial".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
accessbuildingscentercertaincommercialcontainsdevelopmentdistrictshistoricalhomelegalprotectionregionrelatedsectionseparatesmallstatussupplyzoning
SHARED TOKENS (20): "access", "buildings", "center", "certain", "commercial", "contains", "development", "districts", "historical", "home", "legal", "protection", "region", "related", "section", "separate", "small", "status", "supply", "zoning". | EXACT TITLE in interior_design_architecture: "Historic district".
0.500
buildingconstructiondesigndevelopmentenvironmentinspectionsmanagementpeopleplanningprogrammingprojectprojectsresearchsciencesitespace
SHARED TOKENS (16): "building", "construction", "design", "development", "environment", "inspections", "management", "people", "planning", "programming", "project", "projects", "research", "science", "site", "space". | EXACT TITLE in interior_design_architecture: "Interior design".
0.500
activityconditionsdependsdirectlyenvironmentalfoodformhealthmaintainmajorpeoplephysicalpreparationrequiredsafewaterwork
SHARED TOKENS (17): "activity", "conditions", "depends", "directly", "environmental", "food", "form", "health", "maintain", "major", "people", "physical", "preparation", "required", "safe", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
applicationsarchitecturecodedatadesigndevelopmentenergyenvironmentalformhealthcareincreasedintelligencelargemodelsnetworksnewspeopleproductsectorssoftware
SHARED TOKENS (26): "applications", "architecture", "code", "data", "design", "development", "energy", "environmental", "form", "healthcare", "increased", "intelligence", "large", "models", "networks", "news", "people", "product", "sectors", "software".... | EXACT TITLE in interior_design_architecture: "Generative AI".
0.500
applicationsappliedcomputerdataformgraphmodernnodeoperationoperationsprocessprogramsrelatedrepresentationsinglestructure
SHARED TOKENS (16): "applications", "applied", "computer", "data", "form", "graph", "modern", "node", "operation", "operations", "process", "programs", "related", "representation", "single", "structure". | EXACT TITLE in interior_design_architecture: "Scene graph".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
allowinganothercreatedevelopmentessentialhigherinsidelifelightphysicalprocessremainssmallstudiessubjectstechnicalusesview
SHARED TOKENS (18): "allowing", "another", "create", "development", "essential", "higher", "inside", "life", "light", "physical", "process", "remains", "small", "studies", "subjects", "technical", "uses", "view". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
againstcertaincontrolsdesigndevelopmentexternalidentifymedicalprocessproductproductsregulatedrequirementsreviewthereforeverifywork
SHARED TOKENS (17): "against", "certain", "controls", "design", "development", "external", "identify", "medical", "process", "product", "products", "regulated", "requirements", "review", "therefore", "verify", "work". | EXACT TITLE in interior_design_architecture: "Design review".
0.500
componentsconcerningconstructioncontractcontractorscoordinationcriticaldifferentdocumentselectricalfirehandlinginformationplumbingproductproductionproductsprotectionrequiredshows
SHARED TOKENS (22): "components", "concerning", "construction", "contract", "contractors", "coordination", "critical", "different", "documents", "electrical", "fire", "handling", "information", "plumbing", "product", "production", "products", "protection", "required", "shows".... | EXACT TITLE in interior_design_architecture: "Shop drawing".
0.500
buildingbuildingscodecodescurrentdepartmentdevelopmentfacilitiesfirelawlocalmaintainingoperatorspersonnelpracticeproductionprotectionrelatedresearchresponsible
SHARED TOKENS (22): "building", "buildings", "code", "codes", "current", "department", "development", "facilities", "fire", "law", "local", "maintaining", "operators", "personnel", "practice", "production", "protection", "related", "research", "responsible".... | EXACT TITLE in biotech_life_sciences: "Fire protection".
0.500
academicanalysisanotherapplicationsbodybroaderbusinesscomputerdataengineeringessentialgeographichumanindustryinformationinstitutionalinsuranceintelligenceknowledgelogistics
SHARED TOKENS (41): "academic", "analysis", "another", "applications", "body", "broader", "business", "computer", "data", "engineering", "essential", "geographic", "human", "industry", "information", "institutional", "insurance", "intelligence", "knowledge", "logistics".... | EXACT TITLE in interior_design_architecture: "Geographic information system".
0.500
applicationsbuildingbuildingscomplexconstructioncontractorscoordinateddesigndisciplinesengineeringlicensedplanningprofessionalprojectsrequiresmallerspecificationstechnical
SHARED TOKENS (18): "applications", "building", "buildings", "complex", "construction", "contractors", "coordinated", "design", "disciplines", "engineering", "licensed", "planning", "professional", "projects", "require", "smaller", "specifications", "technical". | EXACT TITLE in interior_design_architecture: "Building design". | EXACT TITLE in biotech_life_sciences: "Building design".
0.500
Vaccine ↗ Q134808 EXACT TITLE
activeadministrationagainstalreadyassociatedcontainsdevelopeddevelopmentdifferenthealthlicensedlongorganizationpracticepreparationproductionproposedreportsresponsiblesafety
SHARED TOKENS (24): "active", "administration", "against", "already", "associated", "contains", "developed", "development", "different", "health", "licensed", "long", "organization", "practice", "preparation", "production", "proposed", "reports", "responsible", "safety".... | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
actadministrationauthoritycontrolfederalfoodformimplementationlawmarketedmedicalnationalprincipalproductprovisionsregulationsrequirementssafetystudytimes
SHARED TOKENS (20): "act", "administration", "authority", "control", "federal", "food", "form", "implementation", "law", "marketed", "medical", "national", "principal", "product", "provisions", "regulations", "requirements", "safety", "study", "times". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
Office ↗ EXACT TITLE
additionalbuildingsbusinesscomplexcontroldesignformfunctionsgrowthhomehouseindustrialinsteadinsurancelargelawmanufacturingmodernofficeofficial
SHARED TOKENS (38): "additional", "buildings", "business", "complex", "control", "design", "form", "functions", "growth", "home", "house", "industrial", "instead", "insurance", "large", "law", "manufacturing", "modern", "office", "official".... | EXACT TITLE in interior_design_architecture: "Office". | EXACT TITLE in biotech_life_sciences: "Office".
0.500
AutoCAD ↗ EXACT TITLE
accessapplicationsarchitectscommercialdesigndevelopedengineersgeneralindustrylaterlicensedonlineplannersplatformsprojectpurchaseseparatelysoftwaretechnicalusers
SHARED TOKENS (20): "access", "applications", "architects", "commercial", "design", "developed", "engineers", "general", "industry", "later", "licensed", "online", "planners", "platforms", "project", "purchase", "separately", "software", "technical", "users". | EXACT TITLE in interior_design_architecture: "AutoCAD".
0.500
approvalcannotcontractcostsdevelopmentevidenceexperienceexpertiseformhouseinstitutionsinternationallargelifemaintainmanagementmarketsmedicalorganizationorganizations
SHARED TOKENS (33): "approval", "cannot", "contract", "costs", "development", "evidence", "experience", "expertise", "form", "house", "institutions", "international", "large", "life", "maintain", "management", "markets", "medical", "organization", "organizations".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingbuildingscertaindensitydevelopeddevelopmentdifferentdiffersformgovernmentgrowthguidelinesindustriallandland-uselocalplacesplanningpolicy
SHARED TOKENS (32): "allowing", "building", "buildings", "certain", "density", "developed", "development", "different", "differs", "form", "government", "growth", "guidelines", "industrial", "land", "land-use", "local", "places", "planning", "policy".... | EXACT TITLE in interior_design_architecture: "Zoning". | EXACT TITLE in biotech_life_sciences: "Zoning".
0.500
actarchitectureassociatedbuildingbuildingschangescommercialcommunitydesigneducationalemploymentexperiencefocusedimportantinfluenceinstitutionspurposeschoolsignificantspecialized
SHARED TOKENS (22): "act", "architecture", "associated", "building", "buildings", "changes", "commercial", "community", "design", "educational", "employment", "experience", "focused", "important", "influence", "institutions", "purpose", "school", "significant", "specialized".... | EXACT TITLE in interior_design_architecture: "Educational architecture".
0.500
Carpentry ↗ Q203605 EXACT TITLE
buildingbuildingsconstructiondesignexperienceformalmaterialsmillionplacesprogramstructuretesttradetrainingwork
SHARED TOKENS (15): "building", "buildings", "construction", "design", "experience", "formal", "materials", "million", "places", "program", "structure", "test", "trade", "training", "work". | EXACT TITLE in interior_design_architecture: "Carpentry".
0.500
agenciesagencyapprovalsbuildingcategorycomplexcomponentsconditionsdifferentdirectlyengineeringgeneralhumanmarketmedicalpathwaysperformanceproductproductionproducts
SHARED TOKENS (32): "agencies", "agency", "approvals", "building", "category", "complex", "components", "conditions", "different", "directly", "engineering", "general", "human", "market", "medical", "pathways", "performance", "product", "production", "products".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
Architect ↗ Q42973 EXACT TITLE
academicaffectarchitectsarchitecturebuildingsconnectionconstructiondecisionsdesigndesignsdevelopmenteducationexperienceformalhumaninstitutionsjurisdictionlicensemeansoccupancy
SHARED TOKENS (35): "academic", "affect", "architects", "architecture", "buildings", "connection", "construction", "decisions", "design", "designs", "development", "education", "experience", "formal", "human", "institutions", "jurisdiction", "license", "means", "occupancy".... | EXACT TITLE in interior_design_architecture: "Architect". | EXACT TITLE in biotech_life_sciences: "Architect".
0.500
amonganalysisappearsappliedassessmentchangeconditionsdatadecisionsdescriptiondesigndevelopdisciplinesdrawengineeringenvironmentalgeneralhealthhealthcarehistorically
SHARED TOKENS (40): "among", "analysis", "appears", "applied", "assessment", "change", "conditions", "data", "decisions", "description", "design", "develop", "disciplines", "draw", "engineering", "environmental", "general", "health", "healthcare", "historically".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
actadministrationagencyappliesenvironmentalfederalfoodintendedlawprivateprotectionpublicqualityregulatedrequiredsafestandardssystemsystemswater
SHARED TOKENS (20): "act", "administration", "agency", "applies", "environmental", "federal", "food", "intended", "law", "private", "protection", "public", "quality", "regulated", "required", "safe", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
anotherbecomecomplexconsolidationconsumerscorporationdifferentdirectlyeconomyfinalinternationallargemakingmanagementmarketownershipportionspositionproblemproduces
SHARED TOKENS (26): "another", "become", "complex", "consolidation", "consumers", "corporation", "different", "directly", "economy", "final", "international", "large", "making", "management", "market", "ownership", "portions", "position", "problem", "produces".... | EXACT TITLE in interior_design_architecture: "Vertical integration".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeagainstapplicationsassociatedbecomebodycomponentsdisciplinesearlyessentialhealthimportantincreasingintegrityinterpretedlatermaintainphysicalratherrecognition
SHARED TOKENS (26): "active", "against", "applications", "associated", "become", "body", "components", "disciplines", "early", "essential", "health", "important", "increasing", "integrity", "interpreted", "later", "maintain", "physical", "rather", "recognition".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activitybehaviorcenteredcomplexcomputercouncilcovereddetaileddiscoveryearlyfocusedgoverninghigherinsteadlevelsmedicalmodelorganizationphysicalprocesses
SHARED TOKENS (29): "activity", "behavior", "centered", "complex", "computer", "council", "covered", "detailed", "discovery", "early", "focused", "governing", "higher", "instead", "levels", "medical", "model", "organization", "physical", "processes".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
accessagencieschangeclassifycommunitycomponentsconditionsdevelopmentdifferentdistincteconomiceconomyeducationalelectricalenforcementenvironmentenvironmentalessentialfacilitiesfirms
SHARED TOKENS (48): "access", "agencies", "change", "classify", "community", "components", "conditions", "development", "different", "distinct", "economic", "economy", "educational", "electrical", "enforcement", "environment", "environmental", "essential", "facilities", "firms".... | EXACT TITLE in interior_design_architecture: "Infrastructure". | EXACT TITLE in biotech_life_sciences: "Infrastructure".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
concentrationcontainsfacilitiesindustrialinsidemaintainsmanufacturingmaterialmaterialspermitsprocessesproductionresearchsemiconductorsmallerspacework
SHARED TOKENS (17): "concentration", "contains", "facilities", "industrial", "inside", "maintains", "manufacturing", "material", "materials", "permits", "processes", "production", "research", "semiconductor", "smaller", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.500
Virology ↗ Q7215 EXACT TITLE
agricultureappliedbeginningbroadcomponentcoveringdifferentdistinctfunctionshealthmedicalmethodsofficialproposedresearchsciencesignificantsourcestructurestudy
SHARED TOKENS (22): "agriculture", "applied", "beginning", "broad", "component", "covering", "different", "distinct", "functions", "health", "medical", "methods", "official", "proposed", "research", "science", "significant", "source", "structure", "study".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
annualanotherbecomebusinesscapitalcompleteconsequentlycontroldecisionsdevelopmentearlyentityfacefinancingfirmsformgrowthhistoryinformationinitial
SHARED TOKENS (42): "annual", "another", "become", "business", "capital", "complete", "consequently", "control", "decisions", "development", "early", "entity", "face", "financing", "firms", "form", "growth", "history", "information", "initial".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlyenvironmentshumanimportantlandlargemajorpopulationreducerelatedresourcestormwatertreatmentvolumewaterwritten
SHARED TOKENS (20): "become", "create", "demand", "developed", "directly", "environments", "human", "important", "land", "large", "major", "population", "reduce", "related", "resource", "stormwater", "treatment", "volume", "water", "written". | EXACT TITLE in interior_design_architecture: "Stormwater". | EXACT TITLE in biotech_life_sciences: "Stormwater".
0.500
analysisappliesapprovalbehaviorboardboardscertaincodescommitteeformhealthhumanindependentinstitutionalinternationallegallymaterialsmedicalmethodsnational
SHARED TOKENS (40): "analysis", "applies", "approval", "behavior", "board", "boards", "certain", "codes", "committee", "form", "health", "human", "independent", "institutional", "international", "legally", "materials", "medical", "methods", "national".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
agenciesarchitectsarchitecturebroadconditionsconstructioncontroldesignengineeringenvironmentalestateexpertisegeneralhumaninfrastructurelicenselicensedmanagementmasterplanning
SHARED TOKENS (31): "agencies", "architects", "architecture", "broad", "conditions", "construction", "control", "design", "engineering", "environmental", "estate", "expertise", "general", "human", "infrastructure", "license", "licensed", "management", "master", "planning".... | EXACT TITLE in interior_design_architecture: "Landscape architecture".
0.500
anotherbodyenvironmentfacilityindustrialindustrymunicipalphaseprocessprocessespurposeresultingsafelytreatmenttypeuseswater
SHARED TOKENS (17): "another", "body", "environment", "facility", "industrial", "industry", "municipal", "phase", "process", "processes", "purpose", "resulting", "safely", "treatment", "type", "uses", "water". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
approximatelybehaviorbuiltcomplexconcentrationcurrentdepartmentenergyengineeringenvironmentalfacilitiesfacilityhistoricallyhistoryidahoknowledgelaboratoriesnationalorganizationspeople
SHARED TOKENS (24): "approximately", "behavior", "built", "complex", "concentration", "current", "department", "energy", "engineering", "environmental", "facilities", "facility", "historically", "history", "idaho", "knowledge", "laboratories", "national", "organizations", "people".... | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
categorycertaincreatedevelopedeconomichumanindividualinformationlandlawlegalmodernownershippeopleprocessespropertypurposerightssystemstrade
SHARED TOKENS (20): "category", "certain", "create", "developed", "economic", "human", "individual", "information", "land", "law", "legal", "modern", "ownership", "people", "processes", "property", "purpose", "rights", "systems", "trade". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
Toxicology ↗ Q7218 EXACT TITLE
academiccombiningenvironmentinfluencemovementpracticepracticesrelationshipresearchroutestudysubjecttreatingtreatmentturn
SHARED TOKENS (15): "academic", "combining", "environment", "influence", "movement", "practice", "practices", "relationship", "research", "route", "study", "subject", "treating", "treatment", "turn". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.500
approximatelyarchitecturebecomechangecreatecreatescurrentdescribesdevelopeddevelopmentdisciplineseconomiceconomicseducationenvironmentalenvironmentsessentialfacegrowthhealth
SHARED TOKENS (56): "approximately", "architecture", "become", "change", "create", "creates", "current", "describes", "developed", "development", "disciplines", "economic", "economics", "education", "environmental", "environments", "essential", "face", "growth", "health".... | EXACT TITLE in interior_design_architecture: "Urbanization". | EXACT TITLE in biotech_life_sciences: "Urbanization".
0.500
Architecture ↗ Q12271 EXACT TITLE
architectsarchitecturebuildingbuildingsconstructiondesigndevelopdevelopedeconomicemergedengineeringengineersfocusedformhistoricalidentifiedlaterlocalmaterialmaterials
SHARED TOKENS (34): "architects", "architecture", "building", "buildings", "construction", "design", "develop", "developed", "economic", "emerged", "engineering", "engineers", "focused", "form", "historical", "identified", "later", "local", "material", "materials".... | EXACT TITLE in interior_design_architecture: "Architecture". | EXACT TITLE in biotech_life_sciences: "Architecture".
0.500
certificationcompleteformallaborlicensemasterpeopleplacementpracticepractitionersprofessionalreachregulatedrolessectorsstudysystemtradetraining
SHARED TOKENS (19): "certification", "complete", "formal", "labor", "license", "master", "people", "placement", "practice", "practitioners", "professional", "reach", "regulated", "roles", "sectors", "study", "system", "trade", "training". | EXACT TITLE in interior_design_architecture: "Apprenticeship".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecommunitydirecthealthinformationinstitutionallinksmodernofficepatientpracticeproductsprofessionalrelatedrolessafesafetysciencescopesupplies
SHARED TOKENS (22): "become", "community", "direct", "health", "information", "institutional", "links", "modern", "office", "patient", "practice", "products", "professional", "related", "roles", "safe", "safety", "science", "scope", "supplies".... | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
Textile ↗ Q28823 EXACT TITLE
amongappearanceapplicationsappliedcertaincomponentcomponentsconsumerdevelopeddifferentdirectlyfinalfinishedformhigherimportantindustrialintendedlaterlong
SHARED TOKENS (34): "among", "appearance", "applications", "applied", "certain", "component", "components", "consumer", "developed", "different", "directly", "final", "finished", "form", "higher", "important", "industrial", "intended", "later", "long".... | EXACT TITLE in interior_design_architecture: "Textile".
0.500
complexconsumerconsumersdirectdirectlyfacilitiesfinishedflowindependentlogisticsmanagementmaterialsnetworkoptimizationproductproductsstructuresupplysystemsystems
SHARED TOKENS (21): "complex", "consumer", "consumers", "direct", "directly", "facilities", "finished", "flow", "independent", "logistics", "management", "materials", "network", "optimization", "product", "products", "structure", "supply", "system", "systems".... | EXACT TITLE in interior_design_architecture: "Supply chain". | EXACT TITLE in biotech_life_sciences: "Supply chain".
0.500
applicationsbusinessdifferenteducationenvironmentenvironmentsequipmentexperiencelargemedicalmovemultiplephysicalpresenceresearchsafetysmallsystemstechnologytraining
SHARED TOKENS (21): "applications", "business", "different", "education", "environment", "environments", "equipment", "experience", "large", "medical", "move", "multiple", "physical", "presence", "research", "safety", "small", "systems", "technology", "training".... | EXACT TITLE in interior_design_architecture: "Virtual reality".
0.500
actadministrationagenciescertaincontroldecisionsenforcementfederalfoodinitialinternationallawmedicalnationalpolicyqualificationsregulatedrequiredsingletitle
SHARED TOKENS (21): "act", "administration", "agencies", "certain", "control", "decisions", "enforcement", "federal", "food", "initial", "international", "law", "medical", "national", "policy", "qualifications", "regulated", "required", "single", "title".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
activeanalysisapplicationsbeginningcomponentscontroldesigndevelopmentemergedexternalflowformhundredsmeansmediamovementpracticalprocessprocessesscience
SHARED TOKENS (27): "active", "analysis", "applications", "beginning", "components", "control", "design", "development", "emerged", "external", "flow", "form", "hundreds", "means", "media", "movement", "practical", "process", "processes", "science".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
appliedcontrolcreatedesigneconomicallyenergyengineeringengineersequipmentexpertiseknowledgematerialsmechanicalmedicalprocessprocessesproductsrapidresearchscience
SHARED TOKENS (24): "applied", "control", "create", "design", "economically", "energy", "engineering", "engineers", "equipment", "expertise", "knowledge", "materials", "mechanical", "medical", "process", "processes", "products", "rapid", "research", "science".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongdefineindustrialinternationallawlegalmakingmodelsnationalorganizationprivateprocedurepropertyprotectionpublicratherrequirementsrightsscope
SHARED TOKENS (24): "agreements", "among", "define", "industrial", "international", "law", "legal", "making", "models", "national", "organization", "private", "procedure", "property", "protection", "public", "rather", "requirements", "rights", "scope".... | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
analysisbuildingcomplexcomputerdatadevelopmentengineeringimportantinformationintegrateslargemethodsmodelingmodelsnetworkspathwaysprocessprogrammingrolescience
SHARED TOKENS (25): "analysis", "building", "complex", "computer", "data", "development", "engineering", "important", "information", "integrates", "large", "methods", "modeling", "models", "networks", "pathways", "process", "programming", "role", "science".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anotherbodydevelopmentdifferentengineeringgrowthhistorylargematerialmaterialsmedicalproductsproposedpurposesciencestudysystemsystems
SHARED TOKENS (18): "another", "body", "development", "different", "engineering", "growth", "history", "large", "material", "materials", "medical", "products", "proposed", "purpose", "science", "study", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
Urban design ↗ Q63100 EXACT TITLE
architecturebuildingscommunityconnectdesigneconomicenvironmentalenvironmentshistoricalhumanimportantlocalpagephysicalplanningprocessesprojectpublicregionalrelated
SHARED TOKENS (23): "architecture", "buildings", "community", "connect", "design", "economic", "environmental", "environments", "historical", "human", "important", "local", "page", "physical", "planning", "processes", "project", "public", "regional", "related".... | EXACT TITLE in interior_design_architecture: "Urban design".
0.500
accessibilityagenciesagencyappearanceblsbroadbureauconditionscoordinationcurrentdatadepartmenteconomiceconomicsessentialfederalgovernmentlaborlevelslife
SHARED TOKENS (37): "accessibility", "agencies", "agency", "appearance", "bls", "broad", "bureau", "conditions", "coordination", "current", "data", "department", "economic", "economics", "essential", "federal", "government", "labor", "levels", "life".... | EXACT TITLE in interior_design_architecture: "Bureau of Labor Statistics". | EXACT TITLE in biotech_life_sciences: "Bureau of Labor Statistics".
0.500
appliesbroadconstructioncontrolcreatedesigndevelopengineeringengineersenvironmentenvironmentalevaluatefocusedhealthhumanindustriallawlicensinglifelocal
SHARED TOKENS (39): "applies", "broad", "construction", "control", "create", "design", "develop", "engineering", "engineers", "environment", "environmental", "evaluate", "focused", "health", "human", "industrial", "law", "licensing", "life", "local".... | EXACT TITLE in biotech_life_sciences: "Environmental engineering".
0.500
Procurement ↗ Q829492 EXACT TITLE
acquisitionactivityaffectagencybusinessconcerningcorporatedecisionsdefinedeliveryexternalgovernmenthandlingintendedpracticepracticesprocessprocessesprocurementprovide
SHARED TOKENS (28): "acquisition", "activity", "affect", "agency", "business", "concerning", "corporate", "decisions", "define", "delivery", "external", "government", "handling", "intended", "practice", "practices", "process", "processes", "procurement", "provide".... | EXACT TITLE in interior_design_architecture: "Procurement". | EXACT TITLE in biotech_life_sciences: "Procurement".
0.500
actadministrationagencybureaucommunitydepartmentenforcementestablishedfederalgovernmentintelligencejurisdictionlawnationaloperationsprotectionratherreportsresponsibleuses
SHARED TOKENS (20): "act", "administration", "agency", "bureau", "community", "department", "enforcement", "established", "federal", "government", "intelligence", "jurisdiction", "law", "national", "operations", "protection", "rather", "reports", "responsible", "uses". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
analysiscombinesdesigndevelopmentdisciplineselectricalemergedengineeringengineersequipmentindustrialmaintainmanagementmanufacturingmaterialsmechanicalmedicalmovementphysicalproduct
SHARED TOKENS (26): "analysis", "combines", "design", "development", "disciplines", "electrical", "emerged", "engineering", "engineers", "equipment", "industrial", "maintain", "management", "manufacturing", "materials", "mechanical", "medical", "movement", "physical", "product".... | EXACT TITLE in interior_design_architecture: "Mechanical engineering". | EXACT TITLE in biotech_life_sciences: "Mechanical engineering".
0.500
activityapprovalapprovedauthoritybecomecentercentralcertaincommitteecompletecontractcostsdatadesigndevelopmentfunctionshealthhumanmedicalmedical-device
SHARED TOKENS (39): "activity", "approval", "approved", "authority", "become", "center", "central", "certain", "committee", "complete", "contract", "costs", "data", "design", "development", "functions", "health", "human", "medical", "medical-device".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
alreadyarchitecturebuildingbuildingsconnectionconstructiondesignenvironmentalenvironmentsgeneralhomehumaninitialinsideknowledgelaterlicensedmeansoccupancyphysical
SHARED TOKENS (36): "already", "architecture", "building", "buildings", "connection", "construction", "design", "environmental", "environments", "general", "home", "human", "initial", "inside", "knowledge", "later", "licensed", "means", "occupancy", "physical".... | EXACT TITLE in interior_design_architecture: "Interior architecture".
0.500
Accessibility ↗ EXACT TITLE
accessaccessibilityaccessiblecompatibilitycomputerdesigndevelopmentdirectentityenvironmentenvironmentsfocusedgeneralknowledgeoperatingpeoplepopulationpracticeprocessproduct
SHARED TOKENS (30): "access", "accessibility", "accessible", "compatibility", "computer", "design", "development", "direct", "entity", "environment", "environments", "focused", "general", "knowledge", "operating", "people", "population", "practice", "process", "product".... | EXACT TITLE in interior_design_architecture: "Accessibility". | EXACT TITLE in biotech_life_sciences: "Accessibility".
0.500
architectsbusinesscertaindevelopmenteducationengineersholdmanagementpossessprofessionalpublicrequirerequiringsectorsectorssupporttraining
SHARED TOKENS (17): "architects", "business", "certain", "development", "education", "engineers", "hold", "management", "possess", "professional", "public", "require", "requiring", "sector", "sectors", "support", "training". | EXACT TITLE in interior_design_architecture: "Professional services".
0.500
appliedcentralconsumersdesigndevelopdevelopmentdirectlyearlyevaluationfoodintegrateslifematerialsmethodsmodernpracticesprocessesproductionproductssafety
SHARED TOKENS (25): "applied", "central", "consumers", "design", "develop", "development", "directly", "early", "evaluation", "food", "integrates", "life", "materials", "methods", "modern", "practices", "processes", "production", "products", "safety".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
affectanalysisassociatedcomponentscostsdifferentformhigherlatermaterialmeasuringphasepresenceprocessproductionpurposeresultseparatesitessmaller
SHARED TOKENS (21): "affect", "analysis", "associated", "components", "costs", "different", "form", "higher", "later", "material", "measuring", "phase", "presence", "process", "production", "purpose", "result", "separate", "sites", "smaller".... | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
academicboardsdepartmentgovernedhealthholdhumaninstitutionalinstitutionsnearlyoversightpublicresearchreviewrightsrulesignificantsubjectstitlewelfare
SHARED TOKENS (20): "academic", "boards", "department", "governed", "health", "hold", "human", "institutional", "institutions", "nearly", "oversight", "public", "research", "review", "rights", "rule", "significant", "subjects", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongapplicationsbroadcurrentdesigndevelopmentemergedengineeringequipmentgrowthhealthhealthcarehospitalsindustryintegratesmaintenancemakingmanagementmedicalprocurement
SHARED TOKENS (28): "among", "applications", "broad", "current", "design", "development", "emerged", "engineering", "equipment", "growth", "health", "healthcare", "hospitals", "industry", "integrates", "maintenance", "making", "management", "medical", "procurement".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisbeginningcomponentsconstructiondevelopmentdisciplinesengineeringenvironmentequipmentestablishgovernmenthistoryhumanimportantlandlawlegallevelsownershipplanning
SHARED TOKENS (30): "analysis", "beginning", "components", "construction", "development", "disciplines", "engineering", "environment", "equipment", "establish", "government", "history", "human", "important", "land", "law", "legal", "levels", "ownership", "planning".... | EXACT TITLE in interior_design_architecture: "Surveying".
0.500
changescriticaldevelopmentengineeringhumaninterfaceinterpretedmajormechanicalmedicalmovementphysicalrolesciencestructurework
SHARED TOKENS (16): "changes", "critical", "development", "engineering", "human", "interface", "interpreted", "major", "mechanical", "medical", "movement", "physical", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
actassociatedcomplexcontrolsdesigndiscoveryengineeringestablishestablishedfederalfoodgeneralintendedlaterlifemajormarketmedicalmodernoversight
SHARED TOKENS (31): "act", "associated", "complex", "controls", "design", "discovery", "engineering", "establish", "established", "federal", "food", "general", "intended", "later", "life", "major", "market", "medical", "modern", "oversight".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
administersarchitectsassociationboardscouncilexperienceguidelineshealthlawlegallylicensinglicensuremaintainsmakesmodelnationalorganizationprofessionalprogrampublic
SHARED TOKENS (25): "administers", "architects", "association", "boards", "council", "experience", "guidelines", "health", "law", "legally", "licensing", "licensure", "maintains", "makes", "model", "national", "organization", "professional", "program", "public".... | EXACT TITLE in interior_design_architecture: "National Council of Architectural Registration Boards".
0.500
Pathology ↗ Q7208 EXACT TITLE
addressesanalysischangescomponentsconditionsdevelopmentdifferentdistinctgeneralhumanmajormedicalmodernphysicalpracticepracticesprocessesresearchsignificantstudy
SHARED TOKENS (22): "addresses", "analysis", "changes", "components", "conditions", "development", "different", "distinct", "general", "human", "major", "medical", "modern", "physical", "practice", "practices", "processes", "research", "significant", "study".... | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
analysisarchitectsarchitecturebuildingbuiltcodescomplianceconstructiondefinitionsdesignenvironmentalenvironmentshealthinternationallandmanagementplanplanningpolicypractice
SHARED TOKENS (26): "analysis", "architects", "architecture", "building", "built", "codes", "compliance", "construction", "definitions", "design", "environmental", "environments", "health", "international", "land", "management", "plan", "planning", "policy", "practice".... | EXACT TITLE in interior_design_architecture: "Landscape architect".
0.500
behaviorboardsbusinesscertificationconsumerconsumerscreateseconomicevidenceformgeneralgovernmentgrowthhealthhigherindividualinspectionslawlicenselicensed
SHARED TOKENS (42): "behavior", "boards", "business", "certification", "consumer", "consumers", "creates", "economic", "evidence", "form", "general", "government", "growth", "health", "higher", "individual", "inspections", "law", "license", "licensed".... | EXACT TITLE in interior_design_architecture: "Occupational licensing".
0.500
accessibleappliedcodeconsumerdatadescriptionsdetaileddevelopmentintelligencemodelmodelsnetworkorganizationsproductpubliclytechnologytexttraining
SHARED TOKENS (18): "accessible", "applied", "code", "consumer", "data", "descriptions", "detailed", "development", "intelligence", "model", "models", "network", "organizations", "product", "publicly", "technology", "text", "training". | EXACT TITLE in interior_design_architecture: "Stable Diffusion".
0.500
analysisappliedcapabilitieschangescomponentsdevelopmentdifferentdivisionengineeringevaluationformhealthhealthcareidentifyimportantinstrumentsinterfaceknowledgelaboratorieslater
SHARED TOKENS (37): "analysis", "applied", "capabilities", "changes", "components", "development", "different", "division", "engineering", "evaluation", "form", "health", "healthcare", "identify", "important", "instruments", "interface", "knowledge", "laboratories", "later".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
Furniture ↗ Q14745 EXACT TITLE
beginningcomplexconstructiondesigndesignsearlyexpandedformholdhumanintendedlocalmarchmaterialspeopleproductpurposeresearchroleshows
SHARED TOKENS (22): "beginning", "complex", "construction", "design", "designs", "early", "expanded", "form", "hold", "human", "intended", "local", "march", "materials", "people", "product", "purpose", "research", "role", "shows".... | EXACT TITLE in interior_design_architecture: "Furniture".
0.500
academicanalysisapplicationscommercialdatadegreedevelopdevelopmentdifferentengineersgovernmentgraduateinstrumentslaboratoriesproceduresprocessprocessesprogramprogramsquality
SHARED TOKENS (30): "academic", "analysis", "applications", "commercial", "data", "degree", "develop", "development", "different", "engineers", "government", "graduate", "instruments", "laboratories", "procedures", "process", "processes", "program", "programs", "quality".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturealteredappliescentralchangesconditionsconsolidationcontroldevelopeddirectlyenvironmentalflowformgrowthirrigationlandmaintainmanagementmethodsnetwork
SHARED TOKENS (39): "agriculture", "altered", "applies", "central", "changes", "conditions", "consolidation", "control", "developed", "directly", "environmental", "flow", "form", "growth", "irrigation", "land", "maintain", "management", "methods", "network".... | EXACT TITLE in interior_design_architecture: "Irrigation". | EXACT TITLE in biotech_life_sciences: "Irrigation".
0.500
alreadyarchitectsarchitecturebuildingcomplexcomputerconstructioncreatedesigndevelopdevelopmentdocumentformhistoricallymajormakingmanualmaterialsmechanicalmethods
SHARED TOKENS (28): "already", "architects", "architecture", "building", "complex", "computer", "construction", "create", "design", "develop", "development", "document", "form", "historically", "major", "making", "manual", "materials", "mechanical", "methods".... | EXACT TITLE in interior_design_architecture: "Architectural drawing".
0.500
agenciesanotherassociationbecomebusinesschangesconditionsconnectioncontractcorporationdatadescribesdesigndevelopeddevelopmentdifferentdocumenteddocumentsearlyengineering
SHARED TOKENS (50): "agencies", "another", "association", "become", "business", "changes", "conditions", "connection", "contract", "corporation", "data", "describes", "design", "developed", "development", "different", "documented", "documents", "early", "engineering".... | EXACT TITLE in interior_design_architecture: "Specification (technical standard)". | EXACT TITLE in biotech_life_sciences: "Specification (technical standard)".
0.500
agenciesbuildingsbuiltcomponentsconstructiondepartmentsdesignengineeringenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessional
SHARED TOKENS (23): "agencies", "buildings", "built", "components", "construction", "departments", "design", "engineering", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional".... | EXACT TITLE in interior_design_architecture: "Civil engineering".
0.500
actcodifieddistinguishesdocumentengineeringessentialfunctionsindustryintendedinternationalinterpretedmakespagepeoplepreparationprofessionalstandardssystemstechnical
SHARED TOKENS (19): "act", "codified", "distinguishes", "document", "engineering", "essential", "functions", "industry", "intended", "international", "interpreted", "makes", "page", "people", "preparation", "professional", "standards", "systems", "technical". | EXACT TITLE in interior_design_architecture: "Technical drawing".
0.500
Plumbing ↗ Q3241671 EXACT TITLE
amongapplicationscriticaldeliverydevelopedhealthinfrastructureplumbingpublicsystemsystemstradeuseswaterwork
SHARED TOKENS (15): "among", "applications", "critical", "delivery", "developed", "health", "infrastructure", "plumbing", "public", "system", "systems", "trade", "uses", "water", "work". | EXACT TITLE in interior_design_architecture: "Plumbing". | EXACT TITLE in biotech_life_sciences: "Plumbing".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureappliedassociatedbecomecontroldependsdevelopeddisciplinesdistinctenergyengineeringenvironmentexplainingfunctionshealthindustriallifemaintainmethodsprocesses
SHARED TOKENS (30): "agriculture", "applied", "associated", "become", "control", "depends", "developed", "disciplines", "distinct", "energy", "engineering", "environment", "explaining", "functions", "health", "industrial", "life", "maintain", "methods", "processes".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
actadministrationagencyassociatedauthoritycontrolcurrentdepartmentdirectlyfederalfoodhealthhumanlaboratoriesmedicalproductspublicregulatedregulationsrelated
SHARED TOKENS (26): "act", "administration", "agency", "associated", "authority", "control", "current", "department", "directly", "federal", "food", "health", "human", "laboratories", "medical", "products", "public", "regulated", "regulations", "related".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
accessibleaffectbecomebuildingscriticaldesignearlyexperiencegeneralgovernmentlegalownershipparticipationplacesprivatepropertypublicrequirerequiredrights
SHARED TOKENS (25): "accessible", "affect", "become", "buildings", "critical", "design", "early", "experience", "general", "government", "legal", "ownership", "participation", "places", "private", "property", "public", "require", "required", "rights".... | EXACT TITLE in interior_design_architecture: "Public space".
0.500
appliedassociatedcapacitycapitalcostsdetailsdirectlydocumentearlyformgrowthimportantinformationinitialinstitutionallegalmarketmethodspoolprivate
SHARED TOKENS (29): "applied", "associated", "capacity", "capital", "costs", "details", "directly", "document", "early", "form", "growth", "important", "information", "initial", "institutional", "legal", "market", "methods", "pool", "private".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
adaarchitectsarchitectureboisebuildingcapitalconstructiondepartmentdesignfederalfinalgovernmenthomeidaholatermaterialsmillionnationalplaceswhose
SHARED TOKENS (20): "ada", "architects", "architecture", "boise", "building", "capital", "construction", "department", "design", "federal", "final", "government", "home", "idaho", "later", "materials", "million", "national", "places", "whose". | EXACT TITLE in interior_design_architecture: "Idaho State Capitol".
0.500
academiccentercentralcertificationcollegescriticaleducationfacultyhigherinsteadinstitutionsknowledgelifeprivateproductionpublicratherresearchsitesstudent
SHARED TOKENS (25): "academic", "center", "central", "certification", "colleges", "critical", "education", "faculty", "higher", "instead", "institutions", "knowledge", "life", "private", "production", "public", "rather", "research", "sites", "student".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.480
behaviorcombinescomputerdifferentexpandedfunctionsindividualmodelingsciencescopestatisticsstudiesstudysystem
SHARED TOKENS (14): "behavior", "combines", "computer", "different", "expanded", "functions", "individual", "modeling", "science", "scope", "statistics", "studies", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.480
Microbiology ↗ Q7193 EXACT TITLE
complexcurrentdesigndevelopedenvironmentslifematerialmeansmedicalpossesssearchsmallstudywork
SHARED TOKENS (14): "complex", "current", "design", "developed", "environments", "life", "material", "means", "medical", "possess", "search", "small", "study", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.480
alreadyappliesbroadcomputercontroldesigndevelopdisciplineselectricalengineeringmaterialpurposessciencesystems
SHARED TOKENS (14): "already", "applies", "broad", "computer", "control", "design", "develop", "disciplines", "electrical", "engineering", "material", "purposes", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.450
govgovernmenthealthnationalregistrations
SHARED TOKENS (5): "gov", "government", "health", "national", "registrations". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
administrationcannotcommunitydemandformhospitalhospitalsmanufacturersmanufacturingpreparationprovideregulations
SHARED TOKENS (12): "administration", "cannot", "community", "demand", "form", "hospital", "hospitals", "manufacturers", "manufacturing", "preparation", "provide", "regulations". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.440
Biosensor ↗ Q669391 EXACT TITLE
anotherassociatedcombinescomponentconnectsdifferentengineeringmaterialresponsibleresultingstudyuser
SHARED TOKENS (12): "another", "associated", "combines", "component", "connects", "different", "engineering", "material", "responsible", "resulting", "study", "user". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.440
Lighting ↗ Q210064 EXACT TITLE
appearancebuildingscomponentdesignenergylightmajorperformancepracticalprojectsrepresentssource
SHARED TOKENS (12): "appearance", "buildings", "component", "design", "energy", "light", "major", "performance", "practical", "projects", "represents", "source". | EXACT TITLE in interior_design_architecture: "Lighting".
0.440
Tile ↗ Q468402 EXACT TITLE
anotherapplicationscomplexconstructioncoveringformmaterialmaterialsproductionrequireturnuses
SHARED TOKENS (12): "another", "applications", "complex", "construction", "covering", "form", "material", "materials", "production", "require", "turn", "uses". | EXACT TITLE in interior_design_architecture: "Tile".
0.420
Cell biology ↗ Q7141 EXACT TITLE
behaviorcomponentsessentiallifemedicalresearchresponsiblestructurestudiesstudywork
SHARED TOKENS (11): "behavior", "components", "essential", "life", "medical", "research", "responsible", "structure", "studies", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.420
agencyboisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulationsresponsible
SHARED TOKENS (11): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations", "responsible". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.420
agencydepartmentdevelopmenteconomicidahoinsurancelaborprocessesresponsibletechnologyworkforce
SHARED TOKENS (11): "agency", "department", "development", "economic", "idaho", "insurance", "labor", "processes", "responsible", "technology", "workforce". | EXACT TITLE in interior_design_architecture: "Idaho Department of Labor". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.420
Millwork ↗ Q17141333 EXACT TITLE
applicationsarchitectsbuildingcomponentsconstructioncreatedesignhistoricallymaterialproductsspecified
SHARED TOKENS (11): "applications", "architects", "building", "components", "construction", "create", "design", "historically", "material", "products", "specified". | EXACT TITLE in interior_design_architecture: "Millwork".
0.400
Procore ↗ Q25831309 EXACT TITLE
connectconstructionindustrymanagementplatformproductsprojectsoftwareviewworkflows
SHARED TOKENS (10): "connect", "construction", "industry", "management", "platform", "products", "project", "software", "view", "workflows". | EXACT TITLE in interior_design_architecture: "Procore".
0.400
Hazardous waste ↗ EXACT TITLE
environmenthealthhumaninternationallocalmaterialsmillionnationalproducesregulated
SHARED TOKENS (10): "environment", "health", "human", "international", "local", "materials", "million", "national", "produces", "regulated". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.400
actchaptercodecodifiedfederalhealthlawpublictitlewelfare
SHARED TOKENS (10): "act", "chapter", "code", "codified", "federal", "health", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.400
differentirrigationlawlegalphysicalsourcesystemsuseruserswater
SHARED TOKENS (10): "different", "irrigation", "law", "legal", "physical", "source", "systems", "user", "users", "water". | EXACT TITLE in interior_design_architecture: "Water right". | EXACT TITLE in biotech_life_sciences: "Water right".
0.400
differentfacilityinformationmaterialmaterialsmedicalpeopleresearchstudieswritten
SHARED TOKENS (10): "different", "facility", "information", "material", "materials", "medical", "people", "research", "studies", "written". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.400
actarchitecturebuildingscertaincollegeeducationalfacilitiesformmovementschool
SHARED TOKENS (10): "act", "architecture", "buildings", "certain", "college", "educational", "facilities", "form", "movement", "school". | EXACT TITLE in interior_design_architecture: "Collegiate Gothic".
0.380
SketchUp ↗ Q79604 EXACT TITLE
accessapplicationsarchitecturedesignmanufacturingmodelingmodelsproductsoftware
SHARED TOKENS (9): "access", "applications", "architecture", "design", "manufacturing", "modeling", "models", "product", "software". | EXACT TITLE in interior_design_architecture: "SketchUp".
0.380
Drafting ↗ Q5304779 EXACT TITLE
actelectricalengineeringfunctionsmanufacturingplumbingratherteamstechnical
SHARED TOKENS (9): "act", "electrical", "engineering", "functions", "manufacturing", "plumbing", "rather", "teams", "technical". | EXACT TITLE in interior_design_architecture: "Drafting".
0.380
accreditationarchitecturedegreegraduatelicensemastermoveprofessionalresult
SHARED TOKENS (9): "accreditation", "architecture", "degree", "graduate", "license", "master", "move", "professional", "result". | EXACT TITLE in interior_design_architecture: "Master of Architecture".
0.360
agriculturebuildingcomplexdevelopmentestatelandpurposereal
SHARED TOKENS (8): "agriculture", "building", "complex", "development", "estate", "land", "purpose", "real". | EXACT TITLE in biotech_life_sciences: "Land development".
0.360
analysisappliedcomputerdatamodelingrelationshipssciencesystems
SHARED TOKENS (8): "analysis", "applied", "computer", "data", "modeling", "relationships", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.360
associationfirmsindustrialindustryorganizationrelatedresearchserves
SHARED TOKENS (8): "association", "firms", "industrial", "industry", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.360
appliedbecomecomplexdifferentidentifiedidentityprocedurestructure
SHARED TOKENS (8): "applied", "become", "complex", "different", "identified", "identity", "procedure", "structure". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.360
buildingsbuiltdevelopmentenvironmenthistoricalmaintainsproductsspecifically
SHARED TOKENS (8): "buildings", "built", "development", "environment", "historical", "maintains", "products", "specifically". | EXACT TITLE in interior_design_architecture: "Historic preservation".
0.360
Flooring ↗ Q1433006 EXACT TITLE
appliedcoveringgeneralmaterialmaterialsprovidestructurework
SHARED TOKENS (8): "applied", "covering", "general", "material", "materials", "provide", "structure", "work". | EXACT TITLE in interior_design_architecture: "Flooring".
0.360
Phlebotomy ↗ Q3595842 EXACT TITLE
makingmedicalprocedureprocesspurposetechnicianstreatmentvolume
SHARED TOKENS (8): "making", "medical", "procedure", "process", "purpose", "technicians", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.360
developeddifferentengineeringgrowthpossessproductssciencetimes
SHARED TOKENS (8): "developed", "different", "engineering", "growth", "possess", "products", "science", "times". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.360
Cabinetry ↗ Q2741056 EXACT TITLE
anotherbuiltcommercialcoveredfinishedintendedmaterialssmall
SHARED TOKENS (8): "another", "built", "commercial", "covered", "finished", "intended", "materials", "small". | EXACT TITLE in interior_design_architecture: "Cabinetry".
0.360
Hospitality ↗ Q815825 EXACT TITLE
describesorganizationpeoplepracticerelationshiprolestudiesvolume
SHARED TOKENS (8): "describes", "organization", "people", "practice", "relationship", "role", "studies", "volume". | EXACT TITLE in interior_design_architecture: "Hospitality".
0.340
acquisitionbusinessconsolidationentitypurposessmallertreatment
SHARED TOKENS (7): "acquisition", "business", "consolidation", "entity", "purposes", "smaller", "treatment". | EXACT TITLE in interior_design_architecture: "Consolidation (business)". | EXACT TITLE in biotech_life_sciences: "Consolidation (business)".
0.340
amongbuildingbuildingsbuiltconstructioncostspurpose
SHARED TOKENS (7): "among", "building", "buildings", "built", "construction", "costs", "purpose". | EXACT TITLE in interior_design_architecture: "Adaptive reuse".
0.340
affectconditionscycleseconomicenvironmentalmanagementstudy
SHARED TOKENS (7): "affect", "conditions", "cycles", "economic", "environmental", "management", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.330
federalgovernmenthealthmedicalmillionnationalrelatedreportstechnical
SHARED TOKENS (9): "federal", "government", "health", "medical", "million", "national", "related", "reports", "technical". | URL->B (1): http://clinicaltrials.gov/.
0.320
Forage ↗ Q13377214 EXACT TITLE
annualbroaddefinedirectlyhistoricallymaterial
SHARED TOKENS (6): "annual", "broad", "define", "directly", "historically", "material". | EXACT TITLE in biotech_life_sciences: "Forage".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.320
mechanicalmethodsoperatesstructurestudysystems
SHARED TOKENS (6): "mechanical", "methods", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.320
Histology ↗ Q7168 EXACT TITLE
historicallymodernplacesstudiesstudyvisible
SHARED TOKENS (6): "historically", "modern", "places", "studies", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.320
changecontractmanagementordersprojectwork
SHARED TOKENS (6): "change", "contract", "management", "orders", "project", "work". | EXACT TITLE in interior_design_architecture: "Change order".
0.300
analysisappliedarchitecturebeyondcommercialcomponentcomponentsdatadevelopmentdifferentenvironmentalenvironmentsequipmentfacilitiesfunctionshistoricallyimplementationinformationinfrastructuremanagement
SHARED TOKENS (43): "analysis", "applied", "architecture", "beyond", "commercial", "component", "components", "data", "development", "different", "environmental", "environments", "equipment", "facilities", "functions", "historically", "implementation", "information", "infrastructure", "management"....
0.300
agriculturebeginningcommerciallycontroldevelopeddirectearlyenvironmentalexpansiongeneralgrowthhealthhistoryimportantindustryintensivelargemethodspipelineproduct
SHARED TOKENS (28): "agriculture", "beginning", "commercially", "control", "developed", "direct", "early", "environmental", "expansion", "general", "growth", "health", "history", "important", "industry", "intensive", "large", "methods", "pipeline", "product"....
0.300
appliedbusinesscapitalcollegescorporatedevelopmenteducationalemploymentgovernmenthigherinstitutionslocalnetworksplacesplannersprivatepublicrelatedresearchresult
SHARED TOKENS (24): "applied", "business", "capital", "colleges", "corporate", "development", "educational", "employment", "government", "higher", "institutions", "local", "networks", "places", "planners", "private", "public", "related", "research", "result"....
0.300
anotherappliedappliesauthorityboardcapacitycodifiedcommitteeconditionsdecisionsdefinitionsevidenceformhealthcareindividualinformationinstitutionalintendedinternationalissue
SHARED TOKENS (47): "another", "applied", "applies", "authority", "board", "capacity", "codified", "committee", "conditions", "decisions", "definitions", "evidence", "form", "healthcare", "individual", "information", "institutional", "intended", "international", "issue"....
0.300
actadministrationapprovalapprovedboardcertaincommercialcompletecontroldatademonstratedesignevaluationfoodhumaninformationinstitutionalintendedknowledgelegally
SHARED TOKENS (43): "act", "administration", "approval", "approved", "board", "certain", "commercial", "complete", "control", "data", "demonstrate", "design", "evaluation", "food", "human", "information", "institutional", "intended", "knowledge", "legally"....
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysisbodydistinctexpandedfoodfunctionsimportantlargerequirementsscalescopesinglespecificallystructurestudysystem
SHARED TOKENS (17): "activity", "analysis", "body", "distinct", "expanded", "food", "functions", "important", "large", "requirements", "scale", "scope", "single", "specifically", "structure", "study", "system".
0.300
3D modeling ↗ Q568742 KW CROSS HIGH
bodycomputerconnecteddataengineeringforminformationmodelingmodelsphysicalprocessrepresentationsoftwarespacespecialized
SHARED TOKENS (15): "body", "computer", "connected", "data", "engineering", "form", "information", "modeling", "models", "physical", "process", "representation", "software", "space", "specialized".
0.300
buildingconstructiondevelopersgeneralinformationlaborlargelegallylicensingmanagementoversightprojectprojectsrequirementsresponsiblesitesmallstaffvendorswork
SHARED TOKENS (20): "building", "construction", "developers", "general", "information", "labor", "large", "legally", "licensing", "management", "oversight", "project", "projects", "requirements", "responsible", "site", "small", "staff", "vendors", "work".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsideapplicationsbodybroadcapabilitiesdesigndiscoveryfunctionshealthmedicalpracticeprocessesresearchrolesciencespecificallystudiessystems
SHARED TOKENS (18): "alongside", "applications", "body", "broad", "capabilities", "design", "discovery", "functions", "health", "medical", "practice", "processes", "research", "role", "science", "specifically", "studies", "systems".
0.300
alongsideanalysisappliesbeginningbuildingbusinesscapitalcommercialconstraintsconstructioncontrolcriticaldesignestatefirmsincreasinglyinfrastructureknowledgemanagementpath
SHARED TOKENS (32): "alongside", "analysis", "applies", "beginning", "building", "business", "capital", "commercial", "constraints", "construction", "control", "critical", "design", "estate", "firms", "increasingly", "infrastructure", "knowledge", "management", "path"....
0.300
academicsactagencybecomebuildingbuildingsdepartmentdistrictsestablishedfederalgeneralgovernmenthistoricalhistoryidentifyindividualmillionmultiplenationalofficial
SHARED TOKENS (32): "academics", "act", "agency", "become", "building", "buildings", "department", "districts", "established", "federal", "general", "government", "historical", "history", "identify", "individual", "million", "multiple", "national", "official"....
0.300
Gentrification ↗ Q119380 KW CROSS HIGH
businesschangescommercialcommunitydevelopersdevelopmenteconomicestategovernmenthigherincreasedincreasinginfrastructurelocalmetropolitanpeopleplanningprocesspublicreal
SHARED TOKENS (23): "business", "changes", "commercial", "community", "developers", "development", "economic", "estate", "government", "higher", "increased", "increasing", "infrastructure", "local", "metropolitan", "people", "planning", "process", "public", "real"....
0.300
administrationagenciesagencyamongarchitectscertaincommercialdifferentengineersenvironmentalfederalgovernmenthealthindividualindustryjurisdictionlicenselicensedlicensurelinks
SHARED TOKENS (39): "administration", "agencies", "agency", "among", "architects", "certain", "commercial", "different", "engineers", "environmental", "federal", "government", "health", "individual", "industry", "jurisdiction", "license", "licensed", "licensure", "links"....
0.300
affectanotherapproximatelyassociatedconsequentlydifferentequipmentfinishedflowhumanindustrialinsteadinternationalissuelegallymakingnearlypolicyproductionproducts
SHARED TOKENS (29): "affect", "another", "approximately", "associated", "consequently", "different", "equipment", "finished", "flow", "human", "industrial", "instead", "international", "issue", "legally", "making", "nearly", "policy", "production", "products"....
0.300
SolidWorks ↗ Q751281 EXACT TITLE
applicationsdesignengineeringmodelingsoftware
SHARED TOKENS (5): "applications", "design", "engineering", "modeling", "software". | EXACT TITLE in interior_design_architecture: "SolidWorks".
0.300
builtcentralchangesconcentrationdevelopmenteconomicemergedenvironmentalexpansiongrowthmodelmovementplannedpopulationprocess
SHARED TOKENS (15): "built", "central", "changes", "concentration", "development", "economic", "emerged", "environmental", "expansion", "growth", "model", "movement", "planned", "population", "process".
0.300
componentexplainshealthcarehistoryidentifyinformationmajormedicalpatientphysicalprocedureproceduresprocessprofessionalrecognitionrequiredstatisticsstudyview
SHARED TOKENS (19): "component", "explains", "healthcare", "history", "identify", "information", "major", "medical", "patient", "physical", "procedure", "procedures", "process", "professional", "recognition", "required", "statistics", "study", "view".
0.300
Green building ↗ Q242606 KW CROSS HIGH
administrationagenciesappliedarchitectsarchitectureassessmentbuildingbuildingsbuiltcertificationcommercialconstructioncontainingcouncilcurrentdatadesigndevelopeddistrictseconomy
SHARED TOKENS (89): "administration", "agencies", "applied", "architects", "architecture", "assessment", "building", "buildings", "built", "certification", "commercial", "construction", "containing", "council", "current", "data", "design", "developed", "districts", "economy"....
0.300
Acoustics ↗ Q82811 KW CROSS HIGH
anotherarchitecturecontroldevelopmenthumanindustrialknowledgemeansmechanicalmodernoverviewproductionsciencestudytechnology
SHARED TOKENS (15): "another", "architecture", "control", "development", "human", "industrial", "knowledge", "means", "mechanical", "modern", "overview", "production", "science", "study", "technology".
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmenteconomyemploymentexpansionfinancinggovernmenthouselawlocalnationalobtainpermitsplan
SHARED TOKENS (28): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "economy", "employment", "expansion", "financing", "government", "house", "law", "local", "national", "obtain", "permits", "plan"....
0.300
alreadyanotherapplicationsassociatedbecomechangeconcerningconditionscreatecurrentdevelopmentemergedimportantmajormedicalmethodsphasephysicalprocessespurposes
SHARED TOKENS (28): "already", "another", "applications", "associated", "become", "change", "concerning", "conditions", "create", "current", "development", "emerged", "important", "major", "medical", "methods", "phase", "physical", "processes", "purposes"....
0.300
affectapplicationsassistantsconditionscontrolcoveringdifferentfoodhealthhumanmaintainmanagementmedicalprofessionalresearchrolessafesafetysciencescope
SHARED TOKENS (28): "affect", "applications", "assistants", "conditions", "control", "covering", "different", "food", "health", "human", "maintain", "management", "medical", "professional", "research", "roles", "safe", "safety", "science", "scope"....
0.300
annualbuildingbusinesscertificationconstructioncouncilcredentialsdesigndevelopmentenergyenvironmentalexpertiseinternationalleadershipnationaloperationorganizationprivateprofessionalprojects
SHARED TOKENS (22): "annual", "building", "business", "certification", "construction", "council", "credentials", "design", "development", "energy", "environmental", "expertise", "international", "leadership", "national", "operation", "organization", "private", "professional", "projects"....
0.300
agenciesassetsbuildingbuildingsbuiltcomputercontainingdatadesigndevelopeddevelopmentdifferentearlyfacilitiesgovernmentindustryinformationinternationalmaintainmanagement
SHARED TOKENS (33): "agencies", "assets", "building", "buildings", "built", "computer", "containing", "data", "design", "developed", "development", "different", "early", "facilities", "government", "industry", "information", "international", "maintain", "management"....
0.300
affectarchitecturebuildingsbuiltbusinessconstructioncurrentdesignecosystemenergyenvironmentenvironmentalhandlingindividuallongmaterialobtainresourcessustainableuses
SHARED TOKENS (20): "affect", "architecture", "buildings", "built", "business", "construction", "current", "design", "ecosystem", "energy", "environment", "environmental", "handling", "individual", "long", "material", "obtain", "resources", "sustainable", "uses".
0.300
beginningbusinesschangecompleteconstrainedconstraintscontractorsdecisionsdevelopmentdistinctdocumentationestablishedinfluenceinformationmanagementoperationspracticeprocessproductproduction
SHARED TOKENS (32): "beginning", "business", "change", "complete", "constrained", "constraints", "contractors", "decisions", "development", "distinct", "documentation", "established", "influence", "information", "management", "operations", "practice", "process", "product", "production"....
0.300
actfederalgoverninglawresource
SHARED TOKENS (5): "act", "federal", "governing", "law", "resource". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.300
collegecollegescommunityeconomiceducationeducationalformalgeneralhigherindividualknowledgelevelslifemethodsprovidepurposesrelatedschoolsectorsspecialized
SHARED TOKENS (28): "college", "colleges", "community", "economic", "education", "educational", "formal", "general", "higher", "individual", "knowledge", "levels", "life", "methods", "provide", "purposes", "related", "school", "sectors", "specialized"....
0.300
buildingconstructioncontractingcontractorscostsindustryknowledgelawprofessionalprojectprojectsprotectedqualifiedresponsiblesidetitletradework
SHARED TOKENS (18): "building", "construction", "contracting", "contractors", "costs", "industry", "knowledge", "law", "professional", "project", "projects", "protected", "qualified", "responsible", "side", "title", "trade", "work".
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
adaptedadditionalagenciesapplicationscomplexconditionscreatedevelopmentdifferentenvironmentsfoodgovernmenthigherimportantindustryinstitutionsinternationalknowledgelandlong
SHARED TOKENS (34): "adapted", "additional", "agencies", "applications", "complex", "conditions", "create", "development", "different", "environments", "food", "government", "higher", "important", "industry", "institutions", "international", "knowledge", "land", "long"....
0.300
actapplicableappliedassessmentassociationauthoritybehaviorcentralchangechangescommunityconditionscostsdependdependsdesigndevelopmentdistrictseconomicenvironmental
SHARED TOKENS (44): "act", "applicable", "applied", "assessment", "association", "authority", "behavior", "central", "change", "changes", "community", "conditions", "costs", "depend", "depends", "design", "development", "districts", "economic", "environmental"....
0.300
applicationsappliedassociatedbroadcertaindefinitionsdifferentengineeringfunctionsmaintainmaterialsmechanicalmedicalmethodsportionspracticepurposerequirescopesupport
SHARED TOKENS (22): "applications", "applied", "associated", "broad", "certain", "definitions", "different", "engineering", "functions", "maintain", "materials", "mechanical", "medical", "methods", "portions", "practice", "purpose", "require", "scope", "support"....
0.300
appliedarchitectsbuildingbuildingsbuiltcomplexconstructioncontractorscreatedesigndesignsdifferentengineeringengineersequipmentformintegrityknowledgemakingmaterials
SHARED TOKENS (30): "applied", "architects", "building", "buildings", "built", "complex", "construction", "contractors", "create", "design", "designs", "different", "engineering", "engineers", "equipment", "form", "integrity", "knowledge", "making", "materials"....
0.300
Retail design ↗ Q2044769 KW CROSS HIGH
actarchitecturecommercialconstructionconsumerconsumersdesigndrawenvironmentsexperienceformindividualindustrialinsidelargepeopleproductproductspurposerequires
SHARED TOKENS (26): "act", "architecture", "commercial", "construction", "consumer", "consumers", "design", "draw", "environments", "experience", "form", "individual", "industrial", "inside", "large", "people", "product", "products", "purpose", "requires"....
0.300
accessadministrationagencyassociationcapacitychangescontroldepartmenteducationalenvironmentalfederalfoodgovernmentheadquarteredhealthhumaninformationinstitutionalinternationalleadership
SHARED TOKENS (36): "access", "administration", "agency", "association", "capacity", "changes", "control", "department", "educational", "environmental", "federal", "food", "government", "headquartered", "health", "human", "information", "institutional", "international", "leadership"....
0.300
activeagainstanalysisapplicationsarchitectsbehaviorbuildingbuildingscentercontroldesigndeveloperseconomicengineeringengineersenvironmentenvironmentsfacilitiesfireformal
SHARED TOKENS (46): "active", "against", "analysis", "applications", "architects", "behavior", "building", "buildings", "center", "control", "design", "developers", "economic", "engineering", "engineers", "environment", "environments", "facilities", "fire", "formal"....
0.300
activitybusinesscategorycodedirectoriesdirectoryinformationonlinepagessearchsectionsoftwaretypeuserusers
SHARED TOKENS (15): "activity", "business", "category", "code", "directories", "directory", "information", "online", "pages", "search", "section", "software", "type", "user", "users".
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
bodyconditionscontainingdevelopmentenvironmentessentialformgrowthhistoricalmaintainingmethodspopulationpracticeprocessregulatesrelatedrequiresinglesourcesupplies
SHARED TOKENS (21): "body", "conditions", "containing", "development", "environment", "essential", "form", "growth", "historical", "maintaining", "methods", "population", "practice", "process", "regulates", "related", "require", "single", "source", "supplies"....
0.300
academicaccessagenciesannualapplicationsapproximatelycapitalcovereddevelopeddevelopmentdiscoverydistinctdocumentededucationessentialevaluationexpansionfirmsgrowthhealth
SHARED TOKENS (52): "academic", "access", "agencies", "annual", "applications", "approximately", "capital", "covered", "developed", "development", "discovery", "distinct", "documented", "education", "essential", "evaluation", "expansion", "firms", "growth", "health"....
0.300
administrationannualapprovalcenterchangescomplianceentityevaluationfacilitiesfoodforminformationlegallicensemanufacturingphaseproductproductsregulatedreports
SHARED TOKENS (27): "administration", "annual", "approval", "center", "changes", "compliance", "entity", "evaluation", "facilities", "food", "form", "information", "legal", "license", "manufacturing", "phase", "product", "products", "regulated", "reports"....
0.300
academicbroadercollegescompletedirectlyeducationeducationalenterpreparationprofessionalprovideratherrequiredschoolstudentstechnicaltradetrainingtypeworkforce
SHARED TOKENS (20): "academic", "broader", "colleges", "complete", "directly", "education", "educational", "enter", "preparation", "professional", "provide", "rather", "required", "school", "students", "technical", "trade", "training", "type", "workforce".
0.300
buildingbuildingschangescodecodesconstructioncostscouncilcreateshealthindustryintendedinternationalmaterialsmethodsmodelorganizationorganizationspracticespublic
SHARED TOKENS (29): "building", "buildings", "changes", "code", "codes", "construction", "costs", "council", "creates", "health", "industry", "intended", "international", "materials", "methods", "model", "organization", "organizations", "practices", "public"....
0.300
currentdevelopedeconomiceconomyfocusedformhealthhealthcareindustrymedicalproductproductspurchasingrequirementssectorsectorssystemteams
SHARED TOKENS (18): "current", "developed", "economic", "economy", "focused", "form", "health", "healthcare", "industry", "medical", "product", "products", "purchasing", "requirements", "sector", "sectors", "system", "teams".
0.300
agencyapprovedassessmentcommitteedepartmenteducationemployeeenergyenforcementengineersenvironmentalfederalgovernmenthouseindependentinformationlaboratorieslegallevelslocal
SHARED TOKENS (35): "agency", "approved", "assessment", "committee", "department", "education", "employee", "energy", "enforcement", "engineers", "environmental", "federal", "government", "house", "independent", "information", "laboratories", "legal", "levels", "local"....
0.300
activeagainstapprovalbecomecommercialcomplexdevelopeddevelopmentdiscoveryentityexperiencehealthhistoricallyhumanidentifiedidentifyidentifyingindustrylargemarket
SHARED TOKENS (42): "active", "against", "approval", "become", "commercial", "complex", "developed", "development", "discovery", "entity", "experience", "health", "historically", "human", "identified", "identify", "identifying", "industry", "large", "market"....
0.300
appearsassociatedbodyclinicscontainingdetaileddiffersdistinctenvironmentenvironmentalfacilitiesgeneralhealthhealthcarehomehospitalhospitalshumanindustriallaboratories
SHARED TOKENS (31): "appears", "associated", "body", "clinics", "containing", "detailed", "differs", "distinct", "environment", "environmental", "facilities", "general", "health", "healthcare", "home", "hospital", "hospitals", "human", "industrial", "laboratories"....
0.300
accessagentscontrolequipmentestablishedfacilitiesfacilityhealthhigherlaboratorieslevelsmultiplepersonnelproceduresprotectionreportsrequiredspecifiedsystemstraining
SHARED TOKENS (20): "access", "agents", "control", "equipment", "established", "facilities", "facility", "health", "higher", "laboratories", "levels", "multiple", "personnel", "procedures", "protection", "reports", "required", "specified", "systems", "training".
0.300
agencyappliedbuildingcommercialconnectionsconstructiondegreedesigndevelopmentfunctionsinstitutionalmultipleplanningpolicyprivateprojectsresidentialsinglesitespace
SHARED TOKENS (24): "agency", "applied", "building", "commercial", "connections", "construction", "degree", "design", "development", "functions", "institutional", "multiple", "planning", "policy", "private", "projects", "residential", "single", "site", "space"....
0.300
accessibilityactadaagainstbroadbusinesschangescostscouncilcoveredfinalhouseidentitylaterlawnationalprotectionprovidepublicrequirements
SHARED TOKENS (23): "accessibility", "act", "ada", "against", "broad", "business", "changes", "costs", "council", "covered", "final", "house", "identity", "later", "law", "national", "protection", "provide", "public", "requirements"....
0.300
affectaloneanalysisannualbuildingbuildingscomponentcomputercontrolenvironmentalenvironmentsfaceflowformhealthhumaninfluenceinsidelifemaintaining
SHARED TOKENS (33): "affect", "alone", "analysis", "annual", "building", "buildings", "component", "computer", "control", "environmental", "environments", "face", "flow", "form", "health", "human", "influence", "inside", "life", "maintaining"....
0.300
associatedassociationcontrolsdesigndisciplineseducationhealthhumaninternationalpractitionersprofessionalrequirementsscopestudentssupportsystemswork
SHARED TOKENS (17): "associated", "association", "controls", "design", "disciplines", "education", "health", "human", "international", "practitioners", "professional", "requirements", "scope", "students", "support", "systems", "work".
0.300
beyondbusinessdevelopearlyexternalfacegrowthinfluencelargemodelprivateprojectpublicrapidscalablesignificant
SHARED TOKENS (16): "beyond", "business", "develop", "early", "external", "face", "growth", "influence", "large", "model", "private", "project", "public", "rapid", "scalable", "significant".
0.300
agenciesavailabilitybroadbuildingbusinesscapabilitiesdeliverydocumentdocumentsfinalformgovernmentinformationinsteadlegalonlinepdfprocessproductprovide
SHARED TOKENS (29): "agencies", "availability", "broad", "building", "business", "capabilities", "delivery", "document", "documents", "final", "form", "government", "information", "instead", "legal", "online", "pdf", "process", "product", "provide"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycodescommunitydesigndesignsdevelopmentdifferentearlyeconomicengineering
SHARED TOKENS (66): "accessibility", "administration", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "codes", "community", "design", "designs", "development", "different", "early", "economic", "engineering"....
0.300
LEED ↗ Q1521623 KW CROSS HIGH
adaptedagenciesanotherbuildingbuildingscertificationchangeconstructioncouncildesigndevelopedeconomyenergyenvironmentalfederalfinalframeworkhealthcarehigherindustry
SHARED TOKENS (45): "adapted", "agencies", "another", "building", "buildings", "certification", "change", "construction", "council", "design", "developed", "economy", "energy", "environmental", "federal", "final", "framework", "healthcare", "higher", "industry"....
0.300
applicationscodedesigndetailedengineeringexpandedgeneralindustrialknowledgemarketmethodsprocessproductproductionrecognitionresearchstructurevalue
SHARED TOKENS (18): "applications", "code", "design", "detailed", "engineering", "expanded", "general", "industrial", "knowledge", "market", "methods", "process", "product", "production", "recognition", "research", "structure", "value".
0.300
administersagencyagricultureapproximatelycommercialcomponentcurrentdepartmentdirectlyfederalfoodgovernmentnationalproductionprogramprogramsreportsresourcessafetytrade
SHARED TOKENS (20): "administers", "agency", "agriculture", "approximately", "commercial", "component", "current", "department", "directly", "federal", "food", "government", "national", "production", "program", "programs", "reports", "resources", "safety", "trade".
0.300
actapplicationsbuildingcenterchangeconditionscorridorsdependdevelopmentdistinctenergyenvironmentexperienceflowhigherincreasedincreasinglandlocalmaterials
SHARED TOKENS (26): "act", "applications", "building", "center", "change", "conditions", "corridors", "depend", "development", "distinct", "energy", "environment", "experience", "flow", "higher", "increased", "increasing", "land", "local", "materials"....
0.300
actaffectanotherapplicationschangecommercialcurrentdemanddevelopmentgrowthhumanincreasedirrigationlocalmakesmanagementmanufacturingmunicipalpopulationpractices
SHARED TOKENS (31): "act", "affect", "another", "applications", "change", "commercial", "current", "demand", "development", "growth", "human", "increased", "irrigation", "local", "makes", "management", "manufacturing", "municipal", "population", "practices"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
appliedapprovedarchitectsauthoritybuildingbuildingscodecodescomplianceconstructioncontrolcouncildepartmentsdesigndeveloperselectricalengineersenvironmentalestatefacility
SHARED TOKENS (53): "applied", "approved", "architects", "authority", "building", "buildings", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "developers", "electrical", "engineers", "environmental", "estate", "facility"....
0.300
buildingbuildingscontrolcostsdesignelectricalenergyengineersenvironmentalevaluatemaintenancemechanicalmodelingoperatingperformanceplumbingprojectsprovidequalitysystems
SHARED TOKENS (22): "building", "buildings", "control", "costs", "design", "electrical", "energy", "engineers", "environmental", "evaluate", "maintenance", "mechanical", "modeling", "operating", "performance", "plumbing", "projects", "provide", "quality", "systems"....
0.300
actadministersadministrationagencycertificationdepartmentfacilitiesfederalfinancinggovhealthhealthcarehomehumaninsurancemaintainingoversightprocessprogramprograms
SHARED TOKENS (24): "act", "administers", "administration", "agency", "certification", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "home", "human", "insurance", "maintaining", "oversight", "process", "program", "programs"....
0.300
componentscomputercontainingdataengineeringflowfocusedhealthinstrumentslightmeasuringphysicalpopulationpracticeprocessresearchseparateuses
SHARED TOKENS (18): "components", "computer", "containing", "data", "engineering", "flow", "focused", "health", "instruments", "light", "measuring", "physical", "population", "practice", "process", "research", "separate", "uses".
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscontroldepartmentfacilitiesholdingintendedmajormodernparkingpeopleproviderequirerequirestransportationwater
SHARED TOKENS (15): "buildings", "control", "department", "facilities", "holding", "intended", "major", "modern", "parking", "people", "provide", "require", "requires", "transportation", "water".
0.300
agentsanalysisapplicationsbecomebroadbuildingchangesconstructioncorporationcyclesdetaileddevelopeddifferentessentialexposesmedicalmethodsproceduresprocessrapidly
SHARED TOKENS (27): "agents", "analysis", "applications", "become", "broad", "building", "changes", "construction", "corporation", "cycles", "detailed", "developed", "different", "essential", "exposes", "medical", "methods", "procedures", "process", "rapidly"....
0.300
bodycertificationcomputercontroldegreedesigndevelopeddifferentdisciplineselectricalemergedengineeringengineersequipmenthistoricallyholdindividualinternationalmanagementmanufacturing
SHARED TOKENS (34): "body", "certification", "computer", "control", "degree", "design", "developed", "different", "disciplines", "electrical", "emerged", "engineering", "engineers", "equipment", "historically", "hold", "individual", "international", "management", "manufacturing"....
0.300
accessibilityassociatedbroaderbusinesscertaindevelopmentdistrictsenvironmentincreasedlinkslocallocallypeoplepropertyprovideratherrulessafetysignificantsingle
SHARED TOKENS (20): "accessibility", "associated", "broader", "business", "certain", "development", "districts", "environment", "increased", "links", "local", "locally", "people", "property", "provide", "rather", "rules", "safety", "significant", "single".
0.300
analysisappearanceapplicationsbuildingcomputercreatedesigndesignsdocumentationeconomicengineeringengineersformimportantindustrialinformationmajormanualmanufacturingmaterials
SHARED TOKENS (38): "analysis", "appearance", "applications", "building", "computer", "create", "design", "designs", "documentation", "economic", "engineering", "engineers", "form", "important", "industrial", "information", "major", "manual", "manufacturing", "materials"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherbusinesscapitalcertainconditionscorporatecorporationdirecteconomicentityexpansionexplicitlygrowthindividuallargelegalliabilitylicensingmarketmeans
SHARED TOKENS (33): "another", "business", "capital", "certain", "conditions", "corporate", "corporation", "direct", "economic", "entity", "expansion", "explicitly", "growth", "individual", "large", "legal", "liability", "licensing", "market", "means"....
0.300
agricultureanotherapplicationscertainfoodhealthhumaninformationlifemajorphysicalqualityscalesciencestudiesstudytype
SHARED TOKENS (17): "agriculture", "another", "applications", "certain", "food", "health", "human", "information", "life", "major", "physical", "quality", "scale", "science", "studies", "study", "type".
0.300
adaptedagainstalreadyarchitecturebuildingbuildingscompletedetailsdevelopmentemphasizesformincreasedinitialinsteadmaintainsmodernmovementpurposesratherrecords
SHARED TOKENS (24): "adapted", "against", "already", "architecture", "building", "buildings", "complete", "details", "development", "emphasizes", "form", "increased", "initial", "instead", "maintains", "modern", "movement", "purposes", "rather", "records"....
0.300
activityanalysischangeconsumerscontrolcurrentdefinitionsdemanddependdifferentdirecteconomicfinalindividualinternationallifemakesmethodsnationalonline
SHARED TOKENS (35): "activity", "analysis", "change", "consumers", "control", "current", "definitions", "demand", "depend", "different", "direct", "economic", "final", "individual", "international", "life", "makes", "methods", "national", "online"....
0.300
addressesassociationauthoritybuildingcodecodesconstructiondocumentsfiregenerallawlegallifenationaloccupancyprotectionsafetysmokestatutorytitle
SHARED TOKENS (20): "addresses", "association", "authority", "building", "code", "codes", "construction", "documents", "fire", "general", "law", "legal", "life", "national", "occupancy", "protection", "safety", "smoke", "statutory", "title".
0.300
architectureassociatedbecomebeginbeginningbuildingsconstructionearlygrowthincreasinglyinfluencelargelatermaterialsmethodsmovementrelatedwestern
SHARED TOKENS (18): "architecture", "associated", "become", "begin", "beginning", "buildings", "construction", "early", "growth", "increasingly", "influence", "large", "later", "materials", "methods", "movement", "related", "western".
0.300
amonganalysisanotherbehaviorcentercompletecomplexcomponentcomponentsconcerningconstructionconventionalcreatedatadatasetsdescriptiondetaileddevelopdifferentdisciplines
SHARED TOKENS (52): "among", "analysis", "another", "behavior", "center", "complete", "complex", "component", "components", "concerning", "construction", "conventional", "create", "data", "datasets", "description", "detailed", "develop", "different", "disciplines"....
0.300
Technology transfer ↗ KW CROSS HIGH
academicactivityanalysisanothercapacitycommercialconnectingcontroldevelopmentenvironmentestablishesgovernmentimportantindustrialinfluenceinstitutionsknowledgelevelslicensingmarket
SHARED TOKENS (36): "academic", "activity", "analysis", "another", "capacity", "commercial", "connecting", "control", "development", "environment", "establishes", "government", "important", "industrial", "influence", "institutions", "knowledge", "levels", "licensing", "market"....
0.300
agencyanotherapplicableapprovedauthoritybuildingbuiltchangescodescommercialcomplianceconstructioncontractdepartmentdocumentevidencegovernmenthouseindustrialjurisdiction
SHARED TOKENS (35): "agency", "another", "applicable", "approved", "authority", "building", "built", "changes", "codes", "commercial", "compliance", "construction", "contract", "department", "document", "evidence", "government", "house", "industrial", "jurisdiction"....
0.300
accessarchitectsbuildingcomponentsconstructioncontractorscorporationdesigndevelopedelectricalengineersinformationlatermaintenancemechanicalmodelmodelingplanplumbingsoftware
SHARED TOKENS (23): "access", "architects", "building", "components", "construction", "contractors", "corporation", "design", "developed", "electrical", "engineers", "information", "later", "maintenance", "mechanical", "model", "modeling", "plan", "plumbing", "software"....
0.300
approximatelyarchitectschangescompleteconstructioncontractcontractingcostsdeliverydesignentityhistoricalimportantindependentlyindustrylegallongmasterphaseposition
SHARED TOKENS (37): "approximately", "architects", "changes", "complete", "construction", "contract", "contracting", "costs", "delivery", "design", "entity", "historical", "important", "independently", "industry", "legal", "long", "master", "phase", "position"....
0.300
actagentsapprovalapprovalsapprovedarchitectsbuildingcommercialconstructioncontractorscostscreatesdesigndevelopdevelopersdevelopmentdifferenteconomicengineersenvironmental
SHARED TOKENS (43): "act", "agents", "approval", "approvals", "approved", "architects", "building", "commercial", "construction", "contractors", "costs", "creates", "design", "develop", "developers", "development", "different", "economic", "engineers", "environmental"....
0.300
authoritybuildingbuildingsbusinesscapitalcertaincommercialcontainingestatefunctionsintendedlandlevelslocalmaintainmedicalmultipleofficepropertypurposes
SHARED TOKENS (26): "authority", "building", "buildings", "business", "capital", "certain", "commercial", "containing", "estate", "functions", "intended", "land", "levels", "local", "maintain", "medical", "multiple", "office", "property", "purposes"....
0.300
amongdecisionsdevelopmentdifferentengineeringhealthidentifiedindividualmedicalmodelnationalorganizationspatientpeoplepracticesproductsproviderelatedriskseparates
SHARED TOKENS (23): "among", "decisions", "development", "different", "engineering", "health", "identified", "individual", "medical", "model", "national", "organizations", "patient", "people", "practices", "products", "provide", "related", "risk", "separates"....
🫐 BERRY43 edges
0.280
consumersdecisionsevaluationexperienceforminsteadonlineproductproductsprofessionalpurchasingreviewsitesusers
SHARED TOKENS (14): "consumers", "decisions", "evaluation", "experience", "form", "instead", "online", "product", "products", "professional", "purchasing", "review", "sites", "users".
0.280
Micron Technology ↗ KW CROSS HIGH
boisecomputerconsumerdatademandidahomajormanufacturersmarketmarketedproductsreachsemiconductortechnology
SHARED TOKENS (14): "boise", "computer", "consumer", "data", "demand", "idaho", "major", "manufacturers", "market", "marketed", "products", "reach", "semiconductor", "technology".
0.280
Subcontractor ↗ Q2144423 KW CROSS HIGH
anotherbusinesscontractcostsgeneralprocurementprojectpublicreduceriskrulessectorsmallsupport
SHARED TOKENS (14): "another", "business", "contract", "costs", "general", "procurement", "project", "public", "reduce", "risk", "rules", "sector", "small", "support".
0.280
federalregulatoryresearchstandards
SHARED TOKENS (4): "federal", "regulatory", "research", "standards". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.280
economyelectricalenergylightmechanicalperformanceprocessproducespurposesourcetransportationtypevisiblework
SHARED TOKENS (14): "economy", "electrical", "energy", "light", "mechanical", "performance", "process", "produces", "purpose", "source", "transportation", "type", "visible", "work".
0.280
Biophysics ↗ Q7100 EXACT TITLE
appliesmethodssciencestudy
SHARED TOKENS (4): "applies", "methods", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.280
Cold chain ↗ KW CROSS HIGH
associatedequipmentfoodintegritylogisticsmaintainmanagementproductionproductsqualityrequiressafetysupplyuses
SHARED TOKENS (14): "associated", "equipment", "food", "integrity", "logistics", "maintain", "management", "production", "products", "quality", "requires", "safety", "supply", "uses".
0.280
clinicsfacilitieshealthhealthcarehomehospitalhospitalsidahonetworkoperatesoperatingpeoplesupportsystem
SHARED TOKENS (14): "clinics", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "network", "operates", "operating", "people", "support", "system".
0.260
Serology ↗ Q502159 EXACT TITLE
againstbodystudy
SHARED TOKENS (3): "against", "body", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.260
affectenvironmentalestablishedhealthhumanmillionmultiplequalityresultrisksafestandardstype
SHARED TOKENS (13): "affect", "environmental", "established", "health", "human", "million", "multiple", "quality", "result", "risk", "safe", "standards", "type".
0.260
Water quality ↗ Q625376 KW CROSS HIGH
againstassessmentcompliancehealthhumanphysicalqualitysafetysignificantstandardssupplytreatmentwater
SHARED TOKENS (13): "against", "assessment", "compliance", "health", "human", "physical", "quality", "safety", "significant", "standards", "supply", "treatment", "water".
0.260
architectsassociationcommunityconstructiondesigneducationgovernmentheadquarteredorganizationoutreachprofessionalprogramspublic
SHARED TOKENS (13): "architects", "association", "community", "construction", "design", "education", "government", "headquartered", "organization", "outreach", "professional", "programs", "public".
0.260
architectureopeningtransportation
SHARED TOKENS (3): "architecture", "opening", "transportation". | EXACT TITLE in interior_design_architecture: "Daylighting".
0.260
purposesresearchstudy
SHARED TOKENS (3): "purposes", "research", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.240
architectureassistantsdatalargemodelmodernnetworksafetytechnologytexttrainingtype
SHARED TOKENS (12): "architecture", "assistants", "data", "large", "model", "modern", "network", "safety", "technology", "text", "training", "type".
0.240
academicbachelordegreeeducationgraduatehigherphaseprofessionalqualificationsschoolstudentsundergraduate
SHARED TOKENS (12): "academic", "bachelor", "degree", "education", "graduate", "higher", "phase", "professional", "qualifications", "school", "students", "undergraduate".
0.220
amongarchitecturebroaderbuildingschangesengineeringfocusedhistorypracticeprotectionspecialized
SHARED TOKENS (11): "among", "architecture", "broader", "buildings", "changes", "engineering", "focused", "history", "practice", "protection", "specialized".
0.220
administrationapprovedcouncilfoodhumaninternationalmeansproceduresprogramregulationsregulatory
SHARED TOKENS (11): "administration", "approved", "council", "food", "human", "international", "means", "procedures", "program", "regulations", "regulatory".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
importantlong
SHARED TOKENS (2): "important", "long". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.220
administrationbodyconcentrationdescribingfoodinfluencemodelingmodelsplacesrelationshipstudy
SHARED TOKENS (11): "administration", "body", "concentration", "describing", "food", "influence", "modeling", "models", "places", "relationship", "study".
0.210
Biomarker ↗ EXACT TITLE
processes
SHARED TOKENS (1): "processes". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.200
Upholstery ↗ KW CROSS HIGH
applicableappliedbuildingcoveringdesignlayermakesmaterialsuseswork
SHARED TOKENS (10): "applicable", "applied", "building", "covering", "design", "layer", "makes", "materials", "uses", "work".
0.200
certaindifferentenvironmentenvironmentalformpathwaysrelationshiprelationshipsrolesstudy
SHARED TOKENS (10): "certain", "different", "environment", "environmental", "form", "pathways", "relationship", "relationships", "roles", "study".
0.200
subdivision
EXACT TITLE in interior_design_architecture: "Subdivision".
0.200
complexconcentrationenergyinfluencemodelmodelsplacesrelationshipsrepresentsstudy
SHARED TOKENS (10): "complex", "concentration", "energy", "influence", "model", "models", "places", "relationships", "represents", "study".
0.200
applicationscertaindevelopedintendedmedicalprogramregulatedresearchsingletest
SHARED TOKENS (10): "applications", "certain", "developed", "intended", "medical", "program", "regulated", "research", "single", "test".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonhouseidahometropolitanpopulationrapidlyschoolshared
SHARED TOKENS (10): "ada", "boise", "canyon", "house", "idaho", "metropolitan", "population", "rapidly", "school", "shared".
0.200
buildingenergyhumanmaterialmeasuringproductpurposerealrequiredresources
SHARED TOKENS (10): "building", "energy", "human", "material", "measuring", "product", "purpose", "real", "required", "resources".
0.180
adaboisegovernmentidahometropolitanmunicipalnearlypopulationseparate
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "nearly", "population", "separate".
0.180
architectsbuildingsdesigndesignsengineeringplanprogramsrecordssoftware
SHARED TOKENS (9): "architects", "buildings", "design", "designs", "engineering", "plan", "programs", "records", "software".
0.180
Select agent ↗ KW CROSS HIGH
affectingagentsagriculturedepartmenthealthhumanlawpublicsafety
SHARED TOKENS (9): "affecting", "agents", "agriculture", "department", "health", "human", "law", "public", "safety".
0.180
applicationsbehaviorconstructionengineeringknowledgematerialsrelatedstudyuses
SHARED TOKENS (9): "applications", "behavior", "construction", "engineering", "knowledge", "materials", "related", "study", "uses".
0.160
boisecaldwellcanyonidahomakingmetropolitannampapopulation
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
0.160
Stone veneer ↗ Q2470272 KW CROSS HIGH
appliedbuildingbuildingsdesignlayermaterialstructuretype
SHARED TOKENS (8): "applied", "building", "buildings", "design", "layer", "material", "structure", "type".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitannearlypopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "metropolitan", "nearly", "population".
0.140
Medical test ↗ Q2671652 KW CROSS HIGH
analysismedicalphysicalprocedureprocessestesttreatment
SHARED TOKENS (7): "analysis", "medical", "physical", "procedure", "processes", "test", "treatment".
0.140
becomedifferentmultiplesitesspecificallysubsequenttreatment
SHARED TOKENS (7): "become", "different", "multiple", "sites", "specifically", "subsequent", "treatment".
0.140
Seed testing ↗ Q7445654 KW CROSS HIGH
analysiscommerciallyevaluatelaboratoriespurposesqualityresearch
SHARED TOKENS (7): "analysis", "commercially", "evaluate", "laboratories", "purposes", "quality", "research".
0.120
academicarchitecturebachelordegreeprofessionalundergraduate
SHARED TOKENS (6): "academic", "architecture", "bachelor", "degree", "professional", "undergraduate".
0.120
buildingsbuiltenvironmenthistoricallysignificantsites
SHARED TOKENS (6): "buildings", "built", "environment", "historically", "significant", "sites".
0.120
assetsidentifiedpagesratherseparatelyvalue
SHARED TOKENS (6): "assets", "identified", "pages", "rather", "separately", "value".
0.100
architectsarchitecturebusinesslicensedpractices
SHARED TOKENS (5): "architects", "architecture", "business", "licensed", "practices".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahonorthwestpopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population".
◈ Frequently Asked Questions
Interior Design Architecture × Biotech Life Sciences — Treasure Valley
HAIKU · HIGH GATE
How do laboratory design standards affect interior architecture projects in Boise biotech facilities?
Biotech firms operating in Ada County require specialized interior layouts that comply with Occupational Safety and Health Administration regulations for hazardous materials and contamination control. Interior designers working on these projects in the Boise metropolitan area must integrate ventilation systems, biosafety cabinets, and sterile workspace configurations that meet both OSHA requirements and company-specific operational needs.
What role do Boise State University and University of Idaho play in designing biotech research spaces?
Both Boise State University and University of Idaho conduct biotech research requiring specialized interior environments, creating demand for architecture firms in Nampa and Boise to design adaptable laboratory and office spaces. These university partnerships often inform local design standards that private biotech companies in the Treasure Valley later adopt for their own facilities.
How do mergers and acquisitions in Treasure Valley biotech influence interior design renovation projects?
When private equity firms or larger companies acquire biotech startups in Ada County, interior redesigns typically follow to consolidate operations and rebrand spaces across Boise and Nampa locations. These M&A-driven renovations create significant work for local interior architecture professionals who must reconcile multiple facility designs into unified corporate standards.
Why do biotech companies in the Boise metropolitan area invest in specialized interior design for employee spaces?
Biotech employers in the Treasure Valley compete for talent from Idaho State University, Boise State University, and College of Western Idaho graduates by offering modern, functionally designed work environments. Interior architects in Boise design collaborative spaces, break rooms, and offices that reflect the region's growing population and appeal to scientists and technicians relocating to Ada County.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Interior Design Architecture × Biotech Life Sciences 18 QID bridges 273 edges 7,200 ext links 2026-07-17 21:33:19 UTC b8f84bfc573c9213
Interior Design Architecture corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Interior Design Architecture ↗ boisestandard.org/standard ↗
Parent Corridors
Interior Design Architecture × All Other Verticals