—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Faith Religious ↔ relates to ↔ Substance Use Recovery

18 Wikipedia bridge articles confirmed in both vertical ledgers. 260 deterministic cross-vertical edges. 7,157 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
260 Cross Edges
7,157 External Sources
284 Wikipedia Articles
20 🌲 Evergreen
192 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Faith Religious
× Substance Use Recovery
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
260
External Sources Harvested
7,157
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  22 shared tokens
QID Bridge Titles (18)
IdahoBoise metropolitan areaChild protectionSocial workBoise State UniversityTelehealthAffordable housingTreasure ValleyAda County, IdahoMergers and acquisitionsCivil Rights Act of 1968Boise, IdahoPrivate equityNonprofit organizationNampa, IdahoCanyon County, IdahoCaldwell, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationhomemetropolitancapitallocalprivatepubliclargestpeopleadacanyondevelopmenteducationgovernmenthealthsocialmanagementbusiness
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:50:26 UTC
Content Hash
6ebc97c530534bb5
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in faith_religious (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (22): "approximately", "around", "boise", "capital", "contains", "country", "death", "distinct", "eastern", "idaho", "largest", "national", "official", "organized", "people", "population", "separate", "significant", "small", "supplies".... | EXACT TITLE in faith_religious: "Idaho". | EXACT TITLE in substance_use_recovery: "Idaho".
approximatelyaroundboisecapitalcontainscountrydeathdistincteasternidaholargestnationalofficialorganizedpeoplepopulationseparatesignificantsmallsuppliestechnologyuses
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in faith_religious (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "canyon", "combined", "counties", "home", "idaho", "largest", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley". | EXACT TITLE in faith_religious: "Boise metropolitan area".
adaboisecanyoncombinedcountieshomeidaholargestmeridianmetropolitannampapercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
C
Q1029430 EXACT TITLE 1.000
QID OVERLAP: Q1029430 in faith_religious (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (65): "access", "affect", "agencies", "article", "beyond", "child", "children", "collaboration", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "education", "environment", "even", "families".... | EXACT TITLE in faith_religious: "Child protection".
accessaffectagenciesarticlebeyondchildchildrencollaborationcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteducationenvironmentevenfamiliesfamilyfreegovernmentgovernmentsgroupshealthhealthcarehomeidentifyidentifying+35
rom harm and their rights are respected. This includes providing a safe environment for children to grow and develop, protecting them from physical, emotional and sexual abuse, and ensuring they have access to education, healthcare, and resources to fulfill their basic needs. Child protection systems are a set of services, usually government-run, designed to protect children and young people who are underage and to encourage family stability. UNICEF defines a 'child protection system' as: "The set of laws, policies, regulations and services needed across all social sectors – especially social welfare, education, health, security and justice – to support prevention and response to protection-related risks. These systems are part of social protection, and extend beyond it. At the level of prevention, their aim includes supporting and strengthening families to reduce social exclusion, and to lower the risk of separation, violence and exploitation. Responsibilities are often spread across government agencies, with services delivered by local authorities, non-State providers, and community groups, making coordination between sectors and levels, including routine referral systems etc.., a necessary component of effective child protection systems."Under Article 19 of the UN Convention on the Rights of the Child, a 'child protection system' provides for the protection of children in and out of the home. One of the ways this can be enabled is through the provision of quality education, the fourth of the United Nations Sustainable Development Goals, in addition to other child protection systems.
Challenges Child protection systems, particularly in Africa and other less developed regions, face significant structural and systemic challenges that prevent effective implementation. These include poverty, disease, conflict, weak institutional capacity, external influences, cultural norms, and emerging threats. Poverty and Economic Constraints Poverty is a major barrier to child protection, affecting both prevention programs and response mechanisms. Financial instability limits access to education, healthcare, and basic needs, often forcing kids into exploitative situations such as child labor, street life, and early marriage. In extreme cases, children engage in "survival sex" for food or money.
Emerging Threats New challenges, such as climate-induced disasters, digital exploitation, and the COVID-19 pandemic, have intensified risks for children. School closures during the pandemic led to spikes in child marriage and gender-based violence, while economic collapse pushed more children into street situations. Online abuse and trafficking have also risen with increased internet access. These intersecting challenges create a complex environment where child protection systems struggle to function effectively, often leaving vulnerable children without adequate safeguards. History Provincial or state governments' child protection legislation empowers the government department or agency to provide services in the area and to intervene in families where child abuse or other problems are suspected. The agency that manages these services has various names in different provinces and states, e.g., Department of Children's Services, Children's Aid, Department of Child and Family Services.
S
Q205398 EXACT TITLE 1.000
QID OVERLAP: Q205398 in faith_religious (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (51): "academic", "administration", "advocacy", "agencies", "arts", "become", "child", "communities", "community", "counseling", "developed", "development", "directly", "education", "effects", "families", "family", "government", "group", "groups".... | EXACT TITLE in faith_religious: "Social work". | EXACT TITLE in substance_use_recovery: "Social work".
academicadministrationadvocacyagenciesartsbecomechildcommunitiescommunitycounselingdevelopeddevelopmentdirectlyeducationeffectsfamiliesfamilygovernmentgroupgroupshealthhumanindividualsinterventionslaborlawlevelsmanagementmeetingneeds+21
Social work is an academic discipline and practice-based profession concerned with meeting the basic needs of individuals, families, groups, communities, and society as a whole to enhance their individual and collective well-being. Social work practice draws from liberal arts, social science, and interdisciplinary areas such as psychology, sociology, health, political science, community development, law, and economics to engage with systems and policies, conduct assessments, develop interventions, and enhance social functioning and responsibility. The ultimate goals of social work include the improvement of people's lives, alleviation of biopsychosocial concerns, empowerment of individuals and communities, and the achievement of social reform. Social work practice is often divided into three levels. Micro-work involves working directly with individuals and families, such as providing individual counseling/therapy or assisting a family in accessing services. Mezzo-work involves working with groups and communities, such as conducting group therapy or providing services for community agencies. Macro-work involves fostering change on a larger scale through advocacy, social policy, research development, non-profit and public service administration, or working with government agencies. Starting in the 1960s, a few universities began social work management programmes, to prepare students for the management of social and human service organizations, in addition to classical social work education. The social work profession developed in the 19th century, with some of its roots in voluntary philanthropy and in grassroots organizing. However, responses to social needs had existed long before then, primarily from public almshouses, private charities and religious organizations.
Definition Social work is a broad profession that intersects with several disciplines. Social work organizations offer the following definitions: Social work is a practice-based profession and an academic discipline that promotes social change and development, social cohesion, and the empowerment and liberation of people. Principles of social justice, human rights, collective responsibility and respect for diversities are central to social work. Underpinned by theories of social work, social sciences, humanities, and indigenous knowledge, social work engages people and structures to address life challenges and enhance well-being. —International Federation of Social Workers Social work is a profession concerned with helping individuals, families, groups and communities to enhance their individual and collective well-being. It aims to help people develop their skills and their ability to use their resources and those of the community to resolve problems. Social work is concerned with individual and personal problems but also with broader social issues such as poverty, unemployment, and domestic violence. — Canadian Association of Social Workers Social work practice consists of the professional application of social principles, and techniques to one or more of the following ends: helping people obtain tangible services; counseling and psychotherapy with individuals, families, and groups; helping communities or groups provide or improve social and health services, and participating in legislative processes. The practice of social work requires knowledge of human development and behavior; of social and economic, and cultural institutions; and the interaction of all these factors. —[US] National Association of Social Workers Social workers work with individuals and families to help improve outcomes in their lives. This may be helping to protect vulnerable people from harm or abuse or supporting people to live independently. Social workers support people, act as advocates and direct people to the services they may require.
The education of social workers begins with a bachelor's degree (BA, BSc, BSSW, BSW, etc.) or diploma in social work or a Bachelor of Social Services. Some countries offer postgraduate degrees in social work, such as a master's degree (MSW, MSSW, MSS, MSSA, MA, MSc, MRes, MPhil.) or doctoral studies (Ph.D. and DSW (Doctor of Social Work)). Several countries and jurisdictions require registration or license for working as social workers, and there are mandated qualifications. In other places, the professional association sets academic requirements as the qualification for practicing the profession. However, certain types of workers are exempted from needing a registration license. The success of these professionals is based on the recognition of and by the employers that provide social work services.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in faith_religious (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "arts", "boise", "business", "classified", "college", "colleges", "degrees", "division", "education", "founded", "graduate", "health", "idaho", "independent", "institution", "program", "programs", "public".... | EXACT TITLE in faith_religious: "Boise State University". | EXACT TITLE in substance_use_recovery: "Boise State University".
activityamongartsboisebusinessclassifiedcollegecollegesdegreesdivisioneducationfoundedgraduatehealthidahoindependentinstitutionprogramprogramspublicreportedresearchschoolteamsuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Telehealth
Q46994 EXACT TITLE 1.000
QID OVERLAP: Q46994 in faith_religious (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (45): "access", "administration", "another", "application", "applications", "boards", "care", "case", "clinical", "communication", "conditions", "continuous", "data", "defines", "digital", "education", "even", "facilities", "funding", "health".... | EXACT TITLE in faith_religious: "Telehealth". | EXACT TITLE in substance_use_recovery: "Telehealth".
accessadministrationanotherapplicationapplicationsboardscarecaseclinicalcommunicationconditionscontinuousdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcarehomeinformationintegrationlimitedmanagementmedicalpatientpatientspractice+15
t an intervening health care provider." When rural settings, lack of transport, a lack of mobility, conditions due to outbreaks, epidemics or pandemics, decreased funding, or a lack of staff restrict access to care, telemedicine may bridge the gap and can even improve retention in treatment as well as provide distance-learning; meetings, supervision, and presentations between practitioners; online information and health data management and healthcare system integration.
gration. EHealth encompasses a wide range of applications, including but not limited to the following: Two clinicians discussing a case via video conference; Robotic surgery performed through remote access; Physical therapy conducted using digital monitoring instruments, live feed, and application combinations; Diagnostic tests transferred between facilities for interpretation by a higher specialist; Home monitoring through continuous transmission of patient health data; Online consultations between patients and practitioners; Video remote interpretation services for clinical visits.
Telehealth versus telemedicine Telehealth is sometimes discussed interchangeably with telemedicine, the latter being more common than the former. Telehealth has been described as a disruptive innovation in healthcare because it enables medical services to be delivered remotely using communication technologies. The Health Resources and Services Administration distinguishes telehealth from telemedicine in its scope, defining telemedicine only as describing remote clinical services, such as diagnosis and monitoring, while telehealth includes preventative, promotive, and curative care delivery. This includes the above-mentioned non-clinical applications, like administration and provider education. The United States Department of Health and Human Services states that the term telehealth includes "non-clinical services, such as provider training, administrative meetings, and continuing medical education", and that the term telemedicine means "remote clinical services". The World Health Organization uses telemedicine to describe all aspects of health care including preventive care. The American Telemedicine Association uses the terms telemedicine and telehealth interchangeably, although it acknowledges that telehealth is sometimes used more broadly for remote health not involving active clinical treatments. eHealth is another related term, used particularly in the U.K. and Europe, as an umbrella term that includes telehealth, electronic medical records, and other components of health information technology. Methods and modalities Telehealth requires good Internet access by participants, usually in the form of a strong, reliable broadband connection, and broadband mobile communication technology of at least the fourth generation (4G) or long-term evolution (LTE) standard to overcome issues with video stability and bandwidth restrictions. As broadband infrastructure has improved, telehealth usage has become more widely feasible. Healthcare providers often begin telehealth with a needs assessment which assesses hardships that can be improved by telehealth such as travel time, costs or time off work. Collaborators such as technology companies can ease the transition. Delivery can come within four distinct domains: live video (synchronous), store-and-forward (asynchronous), remote patient monitoring, and mobile health. Audio-based telemedicine, primarily through telephone consultations, has been studied as a tool for managing chronic conditions.
Affordable housing
Q4689034 EXACT TITLE 1.000
QID OVERLAP: Q4689034 in faith_religious (tier:branch) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (20): "affordability", "demand", "emergency", "government", "home", "homelessness", "household", "housing", "increased", "index", "literature", "local", "markets", "national", "ownership", "recognized", "rental", "response", "social", "supply". | EXACT TITLE in substance_use_recovery: "Affordable housing".
affordabilitydemandemergencygovernmenthomehomelessnesshouseholdhousingincreasedindexliteraturelocalmarketsnationalownershiprecognizedrentalresponsesocialsupply
Affordable housing is housing which is deemed affordable to those with a household income at or below the median, as rated by the national government or a local government by a recognized housing affordability index. Most of the literature on affordable housing refers to mortgages and a number of forms that exist along a continuum – from emergency homeless shelters, to transitional housing, to non-market rental (also known as social or subsidized housing), to formal and informal rental, indigenous housing, and ending with affordable home ownership. Demand for affordable housing is generally associated with a decrease in housing affordability, such as rent increases, in addition to increased homelessness. Housing choice is a response to a complex set of economic, social, and psychological impulses.
or subsidized housing), to formal and informal rental, indigenous housing, and ending with affordable home ownership. Demand for affordable housing is generally associated with a decrease in housing affordability, such as rent increases, in addition to increased homelessness. Housing choice is a response to a complex set of economic, social, and psychological impulses.
ore on housing because they feel they can afford to, while others may not have a choice. Increases in any housing supply (whether affordable housing or market-rate housing) leads to increased housing affordability across all segments of the housing markets. Definition and measurement There are several means of defining and measuring affordable housing.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in faith_religious (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "eastern", "historically", "idaho", "local", "metropolitan", "offered", "opportunities", "region", "resources", "rural", "treasure", "valley". | EXACT TITLE in faith_religious: "Treasure Valley". | EXACT TITLE in substance_use_recovery: "Treasure Valley".
associationboiseeasternhistoricallyidaholocalmetropolitanofferedopportunitiesregionresourcesruraltreasurevalley
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Ada County, Idaho
Q109820 QID OVERLAP 0.870
QID OVERLAP: Q109820 in faith_religious (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "home", "idaho", "largest", "local", "metropolitan", "population", "private". | URL->A (1): https://adacounty.id.gov/Assessor.
adaboisecapitaldistricthomeidaholargestlocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in faith_religious (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (39): "acquisition", "act", "activity", "another", "business", "capital", "central", "combined", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "expand", "federal"....
acquisitionactactivityanotherbusinesscapitalcentralcombinedconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityexpandfederalgovernedgovernmentjusticelawlegalmanagementmarketoperatingoperationsorganization+9
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Civil Rights Act of 1968
Q1094483 QID OVERLAP 0.800
QID OVERLAP: Q1094483 in faith_religious (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (34): "act", "applicable", "april", "child", "children", "code", "concerning", "development", "different", "enforcement", "expanded", "fair", "families", "family", "federal", "financing", "force", "funding", "housing", "law"....
actapplicableaprilchildchildrencodeconcerningdevelopmentdifferentenforcementexpandedfairfamiliesfamilyfederalfinancingforcefundinghousinglawnationalorganizedpeopleprivateprogramsprotectsprovisionprovisionsrentalrights+4
The Civil Rights Act of 1968 (Pub. L. 90–284, 82 Stat. 73, enacted April 11, 1968) is a landmark law in the United States signed into law by President Lyndon B. Johnson during the King assassination riots. Titles II through VII comprise the Indian Civil Rights Act, which applies to the Native American tribes of the United States and makes many but not all of the guarantees of the U.S. Bill of Rights applicable within the tribes. (That Act appears today in Title 25, sections 1301 to 1303 of the United States Code). Titles VIII and IX are commonly known as the Fair Housing Act, which was meant as a follow-up to the Civil Rights Act of 1964. (This is different legislation than the Housing and Urban Development Act of 1968, which expanded housing funding programs.) While the Civil Rights Act of 1866 prohibited discrimination in housing, there were no federal enforcement provisions. The 1968 act expanded on previous acts and prohibited discrimination concerning the sale, rental, and financing of housing based on race, religion, national origin, and since 1974, sex. Since 1988, the act protects people with disabilities and families with children. Pregnant women are also protected from illegal discrimination because they have been given familial status with their unborn child being the other family member. Victims of discrimination may use both the 1968 act and the 1866 act's section 1983 to seek redress. The 1968 act provides for federal solutions while the 1866 act provides for private solutions (i.e., civil suits). The act also made it a federal crime to "by force or by threat of force, injure, intimidate, or interfere with anyone...
e Indian Civil Rights Act, which applies to the Native American tribes of the United States and makes many but not all of the guarantees of the U.S. Bill of Rights applicable within the tribes. (That Act appears today in Title 25, sections 1301 to 1303 of the United States Code). Titles VIII and IX are commonly known as the Fair Housing Act, which was meant as a follow-up to the Civil Rights Act of 1964. (This is different legislation than the Housing and Urban Development Act of 1968, which expanded housing funding programs.) While the Civil Rights Act of 1866 prohibited discrimination in housing, there were no federal enforcement provisions. The 1968 act expanded on previous acts and prohibited discrimination concerning the sale, rental, and financing of housing based on race, religion, national origin, and since 1974, sex. Since 1988, the act protects people with disabilities and families with children. Pregnant women are also protected from illegal discrimination because they have been given familial status with their unborn child being the other family member. Victims of discrimination may use both the 1968 act and the 1866 act's section 1983 to seek redress. The 1968 act provides for federal solutions while the 1866 act provides for private solutions (i.e., civil suits). The act also made it a federal crime to "by force or by threat of force, injure, intimidate, or interfere with anyone...
That Act appears today in Title 25, sections 1301 to 1303 of the United States Code). Titles VIII and IX are commonly known as the Fair Housing Act, which was meant as a follow-up to the Civil Rights Act of 1964. (This is different legislation than the Housing and Urban Development Act of 1968, which expanded housing funding programs.) While the Civil Rights Act of 1866 prohibited discrimination in housing, there were no federal enforcement provisions. The 1968 act expanded on previous acts and prohibited discrimination concerning the sale, rental, and financing of housing based on race, religion, national origin, and since 1974, sex. Since 1988, the act protects people with disabilities and families with children. Pregnant women are also protected from illegal discrimination because they have been given familial status with their unborn child being the other family member. Victims of discrimination may use both the 1968 act and the 1866 act's section 1983 to seek redress. The 1968 act provides for federal solutions while the 1866 act provides for private solutions (i.e., civil suits). The act also made it a federal crime to "by force or by threat of force, injure, intimidate, or interfere with anyone...
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployershomeidaholocallymajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (25): "active", "business", "capital", "category", "control", "described", "development", "expansion", "financial", "financing", "general", "investment", "limited", "management", "offered", "operational", "ownership", "private", "private-equity", "public"....
activebusinesscapitalcategorycontroldescribeddevelopmentexpansionfinancialfinancinggeneralinvestmentlimitedmanagementofferedoperationalownershipprivateprivate-equitypublicratherreturnsrolespecializedspecific
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
N
Q163740 QID OVERLAP 0.800
QID OVERLAP: Q163740 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (24): "business", "community", "entity", "faith", "hospitals", "institution", "local", "mission", "nonprofit", "nonprofits", "operated", "operates", "operations", "organization", "organizations", "private", "program", "public", "rather", "result"....
businesscommunityentityfaithhospitalsinstitutionlocalmissionnonprofitnonprofitsoperatedoperatesoperationsorganizationorganizationsprivateprogrampublicratherresultrevenueschoolssocialstatus
A nonprofit organization (NPO), also known as a nonbusiness entity, nonprofit institution, not-for-profit organization (NFPO), or simply nonprofit, is a non-governmental entity that operates for a collective, public, or social benefit, rather than to generate profit for private owners. Nonprofit organizations are subject to a non-distribution constraint, meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
Management Most nonprofits have staff that work for the organization, possibly using volunteers to perform the nonprofit's services under the direction of the paid staff. Nonprofits must be careful to balance the salaries paid to staff against the money paid to provide services to the nonprofit's beneficiaries. Organizations whose salary expenses are too high relative to their program expenses may face regulatory scrutiny. Some have the misconception that nonprofit organizations may not make a profit. Although the goal of nonprofits is not specifically to maximize profits, they still have to operate as a fiscally responsible business. They must manage their income (grants, donations, and income from services) and expenses so as to remain a fiscally viable entity. Nonprofits have the responsibility of focusing on being professional and financially responsible, replacing self-interest and profit motive with mission motive. Though nonprofits are managed differently from for-profit businesses, they have felt pressure to be more businesslike. To combat private and public business growth in the public service industry, some nonprofits have modeled their business management and mission, shifting their reason of existing to establish sustainability and growth. Setting effective missions is a key for the successful management of nonprofit organizations. There are three important conditions for effective mission: opportunity, competence, and commitment. One way of managing the sustainability of nonprofit organizations is to establish strong relations with donor groups. This requires a donor marketing strategy, something many nonprofits lack. Nonprofit organizations need to motivate staff, maintain and communicate a vision, set a strategic direction, manage change effectively, and provide a safe working environment for employees, volunteers, and visitors.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university".
boisecanyoncollegehomeidahomeridianmetropolitannampapopulationprincipalstudentuniversity
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in faith_religious (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
242 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP242 edges
🌲 EVERGREEN2 edges
0.650
accessagencyestablishedfoundedhistoricalidahomaintainsmaterialofficeofficialprogrampublicrecordssitessociety
SHARED TOKENS (15): "access", "agency", "established", "founded", "historical", "idaho", "maintains", "material", "office", "official", "program", "public", "records", "sites", "society". | URL->A (1): http://www.history.idaho.gov/. | EXACT TITLE in faith_religious: "Idaho State Historical Society".
0.650
actadministrationagencyassistanceconditionsdecemberdepartmenteducationeffectsemploymentestablishedfederalhealthlaborlawmenmissionoccupationalprovidingregulations
SHARED TOKENS (28): "act", "administration", "agency", "assistance", "conditions", "december", "department", "education", "effects", "employment", "established", "federal", "health", "labor", "law", "men", "mission", "occupational", "providing", "regulations".... | URL->A (1): https://www.osha.gov/. | EXACT TITLE in faith_religious: "Occupational Safety and Health Administration".
🌿 BRANCH192 edges
0.530
boisebuildingbuildingscapitaldistrictidahojohnnationalneighborhood
SHARED TOKENS (9): "boise", "building", "buildings", "capital", "district", "idaho", "john", "national", "neighborhood". | URL->A (1): http://www.boisecathedral.org/. | EXACT TITLE in faith_religious: "Cathedral of St. John the Evangelist (Boise, Idaho)".
0.510
agencydepartmentdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (8): "agency", "department", "development", "idaho", "insurance", "labor", "technology", "workforce". | URL->A (1): https://www.labor.idaho.gov/. | EXACT TITLE in faith_religious: "Idaho Department of Labor".
0.500
adoptedagecentercentralcommunitiescontinuouseasternfoundedfreehumanidentifiedidentifyidentityinternationallawleastlifelimitedmajorpeople
SHARED TOKENS (34): "adopted", "age", "center", "central", "communities", "continuous", "eastern", "founded", "free", "human", "identified", "identify", "identity", "international", "law", "least", "life", "limited", "major", "people".... | EXACT TITLE in faith_religious: "Reform Judaism".
0.500
businessenvironmentfinancialgrouphousehousesindependentlaterlivingmodeloperatingorganizationresidentsrulessystemtreatmentweek
SHARED TOKENS (17): "business", "environment", "financial", "group", "house", "houses", "independent", "later", "living", "model", "operating", "organization", "residents", "rules", "system", "treatment", "week". | EXACT TITLE in substance_use_recovery: "Oxford House".
0.500
Food bank ↗ Q113603 EXACT TITLE
activeadministrationassistancecharitablecommunitiescommunityconditionscreatecrisisdirectlydistributionemergencyestablishedevenexperiencefinancialfoodhealthcarehistoryindividuals
SHARED TOKENS (33): "active", "administration", "assistance", "charitable", "communities", "community", "conditions", "create", "crisis", "directly", "distribution", "emergency", "established", "even", "experience", "financial", "food", "healthcare", "history", "individuals".... | EXACT TITLE in faith_religious: "Food bank".
0.500
academicamongappropriatebecomecarecoordinationdepartmentsdirectlyemergencygeneralhospitalinternationalinterventionslimitedmedicalmodelpatientspracticepractitionersprimary
SHARED TOKENS (32): "academic", "among", "appropriate", "become", "care", "coordination", "departments", "directly", "emergency", "general", "hospital", "international", "interventions", "limited", "medical", "model", "patients", "practice", "practitioners", "primary".... | EXACT TITLE in substance_use_recovery: "Emergency medicine".
0.500
contextdemocracydevelopeddevelopmentestablishedexperiencefunctionjusticelawnationaloperateorganizationspercentpracticeprovisionpublicrecognizedrecordrelatedrequired
SHARED TOKENS (23): "context", "democracy", "developed", "development", "established", "experience", "function", "justice", "law", "national", "operate", "organizations", "percent", "practice", "provision", "public", "recognized", "record", "related", "required".... | EXACT TITLE in faith_religious: "Religious broadcasting".
0.500
accessbecomecarecenterdepartmentdepartmentsemergencyfacilityhospitalhospitalshoursimportantlevelsmedicaloperatepatientpatientspresentprimaryrequire
SHARED TOKENS (21): "access", "become", "care", "center", "department", "departments", "emergency", "facility", "hospital", "hospitals", "hours", "important", "levels", "medical", "operate", "patient", "patients", "present", "primary", "require".... | EXACT TITLE in substance_use_recovery: "Emergency department".
0.500
anotherapplyassistancecapacitydeatheffectemergencyfoundationintendedlawlegallukemedicalneedoperatepeopleprofessionalprotectionrequiresrights
SHARED TOKENS (23): "another", "apply", "assistance", "capacity", "death", "effect", "emergency", "foundation", "intended", "law", "legal", "luke", "medical", "need", "operate", "people", "professional", "protection", "requires", "rights".... | EXACT TITLE in substance_use_recovery: "Good Samaritan law".
0.500
appropriatecarecasecommunitycoordinationgeneralhealthindividualslawlegalmanagementmedicalmentalspecificsystemtreatment
SHARED TOKENS (16): "appropriate", "care", "case", "community", "coordination", "general", "health", "individuals", "law", "legal", "management", "medical", "mental", "specific", "system", "treatment". | EXACT TITLE in faith_religious: "Case management". | EXACT TITLE in substance_use_recovery: "Case management".
0.500
affectsageagencyamongbecomecarechildchildrenclientscommunityconditionscreateddatadegreedescribedfamiliesfamilygeneralgovernmentgroup
SHARED TOKENS (37): "affects", "age", "agency", "among", "become", "care", "child", "children", "clients", "community", "conditions", "created", "data", "degree", "described", "families", "family", "general", "government", "group".... | EXACT TITLE in faith_religious: "Foster care".
0.500
activecommunitydepartmentsdevelopeddifferentfamiliesfundinghealthhomelessnesshousingindividualsintendedmentalpeopleprofessionalwork
SHARED TOKENS (16): "active", "community", "departments", "developed", "different", "families", "funding", "health", "homelessness", "housing", "individuals", "intended", "mental", "people", "professional", "work". | EXACT TITLE in substance_use_recovery: "Supportive housing".
0.500
activitiesaffectscharitablecorporatecountrydefinitiondemonstrateeducationalexclusivelyfinancialforminformationinvestmentlawleadershiplegalmajormeetnonprofitoperated
SHARED TOKENS (34): "activities", "affects", "charitable", "corporate", "country", "definition", "demonstrate", "educational", "exclusively", "financial", "form", "information", "investment", "law", "leadership", "legal", "major", "meet", "nonprofit", "operated".... | EXACT TITLE in faith_religious: "Charitable organization".
0.500
agencybuildbusinesscommunitiescommunitycurrentdatadepartmentdepartmentsfederalgovernmenthospitalshouseinformationinfrastructurelocalmakingmissionpeoplepopulation
SHARED TOKENS (26): "agency", "build", "business", "communities", "community", "current", "data", "department", "departments", "federal", "government", "hospitals", "house", "information", "infrastructure", "local", "making", "mission", "people", "population".... | EXACT TITLE in faith_religious: "United States Census Bureau".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingbuildingscasedeterminedevelopeddevelopmentdifferentformgovernmentgovernmentsguideland-uselocalplanningpolicyregulationsregulatoryresidentialrules
SHARED TOKENS (26): "activities", "building", "buildings", "case", "determine", "developed", "development", "different", "form", "government", "governments", "guide", "land-use", "local", "planning", "policy", "regulations", "regulatory", "residential", "rules".... | EXACT TITLE in faith_religious: "Zoning". | EXACT TITLE in substance_use_recovery: "Zoning".
0.500
amongcommunitydifferentfoundationinstitutionalinstitutionsinternationallevelslocalmajornationalnetworkspeopleregionalrolestudytraining
SHARED TOKENS (17): "among", "community", "different", "foundation", "institutional", "institutions", "international", "levels", "local", "major", "national", "networks", "people", "regional", "role", "study", "training". | EXACT TITLE in faith_religious: "Interfaith dialogue".
0.500
Fentanyl ↗ Q407541 EXACT TITLE
actionamongcaseclinicaldeathdetermineeffectsfamilyfederalformhealthhealthcareincreasedinvolvinglocalmanagementmedicalnationalorganizationoutside
SHARED TOKENS (27): "action", "among", "case", "clinical", "death", "determine", "effects", "family", "federal", "form", "health", "healthcare", "increased", "involving", "local", "management", "medical", "national", "organization", "outside".... | EXACT TITLE in substance_use_recovery: "Fentanyl".
0.500
approximatelyboisedatadistrictevengovernmenthouseidaholegislativelimitsmemberspeoplepopulationresidentssinglesubsequent
SHARED TOKENS (16): "approximately", "boise", "data", "district", "even", "government", "house", "idaho", "legislative", "limits", "members", "people", "population", "residents", "single", "subsequent". | EXACT TITLE in faith_religious: "Idaho Legislature".
0.500
analysisanotherapplicationclinicalcommunitycontroleducationaleffectfamilyframeworkhealthinterventionslargestmanagementmentalmodelpatientsproduceprogramregulations
SHARED TOKENS (25): "analysis", "another", "application", "clinical", "community", "control", "educational", "effect", "family", "framework", "health", "interventions", "largest", "management", "mental", "model", "patients", "produce", "program", "regulations".... | EXACT TITLE in substance_use_recovery: "Contingency management".
0.500
actionagencyappropriatechildrencreatedcreatingdepartmentenforcementforceidaholawmunicipalofficersorganizationpresentpublicstatewide
SHARED TOKENS (17): "action", "agency", "appropriate", "children", "created", "creating", "department", "enforcement", "force", "idaho", "law", "municipal", "officers", "organization", "present", "public", "statewide". | EXACT TITLE in substance_use_recovery: "Idaho State Police".
0.500
administrationadministrativeanalysisappropriateconcerningdegreedifferentdocumentedeffectestablishedfairfundinginformationintendedjoblawmanagementmarketparticipantpeople
SHARED TOKENS (44): "administration", "administrative", "analysis", "appropriate", "concerning", "degree", "different", "documented", "effect", "established", "fair", "funding", "information", "intended", "job", "law", "management", "market", "participant", "people".... | EXACT TITLE in substance_use_recovery: "Program evaluation".
0.500
activityaffectsalreadyamongcauseclassificationdifferenteffecteffectshealthhistoryhourhoursimportantmedicalorganizationproducereportedrisksafe
SHARED TOKENS (22): "activity", "affects", "already", "among", "cause", "classification", "different", "effect", "effects", "health", "history", "hour", "hours", "important", "medical", "organization", "produce", "reported", "risk", "safe".... | EXACT TITLE in substance_use_recovery: "Buprenorphine".
0.500
articlecentralclientsclinicalcounselingdescribeddescriptiondevelopedeffectsexperienceinfluencemakingproblempublishedratherrelationshiptherapiststherapytreatment
SHARED TOKENS (19): "article", "central", "clients", "clinical", "counseling", "described", "description", "developed", "effects", "experience", "influence", "making", "problem", "published", "rather", "relationship", "therapists", "therapy", "treatment". | EXACT TITLE in substance_use_recovery: "Motivational interviewing".
0.500
accommodationapproximatelyconsequentlycountrydefinitiondesignedemergencyexperiencefamilyformgovernmenthomelessnesshousehouseshousinghumanidentifyingindividualslegalliving
SHARED TOKENS (34): "accommodation", "approximately", "consequently", "country", "definition", "designed", "emergency", "experience", "family", "form", "government", "homelessness", "house", "houses", "housing", "human", "identifying", "individuals", "legal", "living".... | EXACT TITLE in faith_religious: "Homelessness". | EXACT TITLE in substance_use_recovery: "Homelessness".
0.500
Pharmacy ↗ EXACT TITLE
becomecareclassifiedclinicalclinicallycommunitydirecthealthinformationinstitutionallinksofficepatientpatientspracticeprimaryprofessionalprovidingrelatedsafe
SHARED TOKENS (27): "become", "care", "classified", "clinical", "clinically", "community", "direct", "health", "information", "institutional", "links", "office", "patient", "patients", "practice", "primary", "professional", "providing", "related", "safe".... | EXACT TITLE in substance_use_recovery: "Pharmacy".
0.500
againstapplicationbecomecannotcaseemploymentfreegoverninggovernmentgroupsinstitutioninstitutionslaterlegalrelationshiprelationshipsschoolseekingserveswomen
SHARED TOKENS (20): "against", "application", "become", "cannot", "case", "employment", "free", "governing", "government", "groups", "institution", "institutions", "later", "legal", "relationship", "relationships", "school", "seeking", "serves", "women". | EXACT TITLE in faith_religious: "Ministerial exception".
0.500
ageamongcapturecareclinicalcombinescommunicationconditionsdatadesigneddifferentdigitalhealthhealthcarehistoryidentifyinformationmedicalmultipleneed
SHARED TOKENS (41): "age", "among", "capture", "care", "clinical", "combines", "communication", "conditions", "data", "designed", "different", "digital", "health", "healthcare", "history", "identify", "information", "medical", "multiple", "need".... | EXACT TITLE in substance_use_recovery: "Electronic health record".
0.500
clinicalconnectioncontinuingcontrolcounselingcounselorsdistincteducationemergencyexperienceknowledgemedicalmeetmembersorganizationspeoplepersonnelproblemsrelationshiprelevant
SHARED TOKENS (30): "clinical", "connection", "continuing", "control", "counseling", "counselors", "distinct", "education", "emergency", "experience", "knowledge", "medical", "meet", "members", "organizations", "people", "personnel", "problems", "relationship", "relevant".... | EXACT TITLE in substance_use_recovery: "Peer support".
0.500
actadministrationagenciesapplicationclassificationcomprehensivecontrolcreateddeterminedistributionenforcementestablishingfederalfoodinternationallawmedicalnationalpolicyregulated
SHARED TOKENS (25): "act", "administration", "agencies", "application", "classification", "comprehensive", "control", "created", "determine", "distribution", "enforcement", "establishing", "federal", "food", "international", "law", "medical", "national", "policy", "regulated".... | EXACT TITLE in substance_use_recovery: "Controlled Substances Act".
0.500
adultschildrenclientclinicalclinicallyconditionscounselorsdesigneddifferdifferenteffecteffectsfamiliesfamilygeneralgroupshealthinvolvingitselfleast
SHARED TOKENS (44): "adults", "children", "client", "clinical", "clinically", "conditions", "counselors", "designed", "differ", "different", "effect", "effects", "families", "family", "general", "groups", "health", "involving", "itself", "least".... | EXACT TITLE in faith_religious: "Psychotherapy".
0.500
actagainstageamongbroaderchildchildrenconflictscontextcontrolcountrycreatedeathdefinitiondirectdocumentationestablishedexperiencefamilyfinances
SHARED TOKENS (51): "act", "against", "age", "among", "broader", "child", "children", "conflicts", "context", "control", "country", "create", "death", "definition", "direct", "documentation", "established", "experience", "family", "finances".... | EXACT TITLE in substance_use_recovery: "Domestic violence".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultsannualbecomecarechildrencoverageeligibilityestablishedexpandexpandedfamiliesfederalfinancialfundinggeneralgovernmentgovernmentshealth
SHARED TOKENS (52): "access", "act", "adults", "annual", "become", "care", "children", "coverage", "eligibility", "established", "expand", "expanded", "families", "federal", "financial", "funding", "general", "government", "governments", "health".... | EXACT TITLE in substance_use_recovery: "Medicaid".
0.500
behavioralcareclientsclinicaleducationexperiencefaithgroupgroupshealthcarehistoryhospitalhoursintegrationorganizationspatientsplacepracticeprimaryproviders
SHARED TOKENS (31): "behavioral", "care", "clients", "clinical", "education", "experience", "faith", "group", "groups", "healthcare", "history", "hospital", "hours", "integration", "organizations", "patients", "place", "practice", "primary", "providers".... | EXACT TITLE in faith_religious: "Clinical pastoral education".
0.500
authoritybuiltclaimscrisiscurrentdeathdescribeddistincteasternestablishedfinancesfoundedhealthhistoricalhistoryindependentinternationallargestlaterleadership
SHARED TOKENS (44): "authority", "built", "claims", "crisis", "current", "death", "described", "distinct", "eastern", "established", "finances", "founded", "health", "historical", "history", "independent", "international", "largest", "later", "leadership".... | EXACT TITLE in faith_religious: "The Church of Jesus Christ of Latter-day Saints".
0.500
approximatelycentercentralcreatedecemberdesignedformerfoundedgeneralgroupidentifiedjohnleadersmajormarriagemembersmissionorganizationorganizedpercent
SHARED TOKENS (25): "approximately", "center", "central", "create", "december", "designed", "former", "founded", "general", "group", "identified", "john", "leaders", "major", "marriage", "members", "mission", "organization", "organized", "percent".... | EXACT TITLE in faith_religious: "United Methodist Church".
0.500
academicactivitiesageagenciesbeyondcollegecontinuingcurriculumdegreedevelopmentdifferentdivisiondomaineducationfrequentlygeneralgovernmentinstitutionalintendedleast
SHARED TOKENS (37): "academic", "activities", "age", "agencies", "beyond", "college", "continuing", "curriculum", "degree", "development", "different", "division", "domain", "education", "frequently", "general", "government", "institutional", "intended", "least".... | EXACT TITLE in substance_use_recovery: "Continuing education".
0.500
actagainstapplicationapplydivisionemploymentenforcementfederalfreegeneralgovernmentgovernmentshouselawleastlocalneutralprovidingrelatedrequires
SHARED TOKENS (21): "act", "against", "application", "apply", "division", "employment", "enforcement", "federal", "free", "general", "government", "governments", "house", "law", "least", "local", "neutral", "providing", "related", "requires".... | EXACT TITLE in faith_religious: "Religious Freedom Restoration Act".
0.500
Quakers ↗ Q170208 EXACT TITLE
adoptedauthorityconsistentcontextdegreesdevelopeddirectestablishedexperiencefaithfinancialformfoundedgroupshistoricallyhumanidentifyindependentinstitutionsjohn
SHARED TOKENS (39): "adopted", "authority", "consistent", "context", "degrees", "developed", "direct", "established", "experience", "faith", "financial", "form", "founded", "groups", "historically", "human", "identify", "independent", "institutions", "john".... | EXACT TITLE in faith_religious: "Quakers".
0.500
agenciesagencyconditionscoordinationcurrentdatadepartmentfamiliesfederalgovernmentgovernmentslaborlevelslifelocalmajormanagementneedofficeprincipal
SHARED TOKENS (27): "agencies", "agency", "conditions", "coordination", "current", "data", "department", "families", "federal", "government", "governments", "labor", "levels", "life", "local", "major", "management", "need", "office", "principal".... | EXACT TITLE in faith_religious: "Bureau of Labor Statistics".
0.500
againstdescribeddifferentemploymentevengrouphousinginstitutionallawlegalpeoplepoliciespublicregulatedrelatedremainsresultsettingsthemtreating
SHARED TOKENS (20): "against", "described", "different", "employment", "even", "group", "housing", "institutional", "law", "legal", "people", "policies", "public", "regulated", "related", "remains", "result", "settings", "them", "treating". | EXACT TITLE in faith_religious: "Religious discrimination".
0.500
Rabbi ↗ Q133485 EXACT TITLE
activitiesanothercommunitycounselingdevelopeddifferentformheavilyhistoryincreasedincreasinglyoutsideoverlappingrecognizedreformrequirementsstudytitle
SHARED TOKENS (18): "activities", "another", "community", "counseling", "developed", "different", "form", "heavily", "history", "increased", "increasingly", "outside", "overlapping", "recognized", "reform", "requirements", "study", "title". | EXACT TITLE in faith_religious: "Rabbi".
0.500
academicagainstcurriculumdifferenteducationfreegeneralinstructionintendedlawopenoperatingparentspubliclyseparatesocialstudysupport
SHARED TOKENS (18): "academic", "against", "curriculum", "different", "education", "free", "general", "instruction", "intended", "law", "open", "operating", "parents", "publicly", "separate", "social", "study", "support". | EXACT TITLE in faith_religious: "Religious education".
0.500
actadministrationagencycausecommunitydepartmentdistributionenforcementestablishedfederalgovernmentinvolvingjusticelawnationaloperationsprotectionratherreportsscheduling
SHARED TOKENS (21): "act", "administration", "agency", "cause", "community", "department", "distribution", "enforcement", "established", "federal", "government", "involving", "justice", "law", "national", "operations", "protection", "rather", "reports", "scheduling".... | EXACT TITLE in substance_use_recovery: "Drug Enforcement Administration".
0.500
approximatelybodycountryearlierformgeneralgrouphistoricallyindependentleadershipmaintainsmattersmembersnationalopenparticipationpercentpopulationpositionspractice
SHARED TOKENS (23): "approximately", "body", "country", "earlier", "form", "general", "group", "historically", "independent", "leadership", "maintains", "matters", "members", "national", "open", "participation", "percent", "population", "positions", "practice".... | EXACT TITLE in faith_religious: "United Church of Christ".
0.500
Methadone ↗ Q179996 EXACT TITLE
amongdevelopedeffecteffectsfrequentlyfunctionhealthhoursinvolvinglifemaintenancemanagementorganizationpatientpeoplerapidriskssinglesoldtherapy
SHARED TOKENS (21): "among", "developed", "effect", "effects", "frequently", "function", "health", "hours", "involving", "life", "maintenance", "management", "organization", "patient", "people", "rapid", "risks", "single", "sold", "therapy".... | EXACT TITLE in substance_use_recovery: "Methadone".
0.500
Probation ↗ Q13961 EXACT TITLE
casechildcommunityconditionscontactcriminaleducationalformerlawleavelimitedpermitplaceprogramremainrequiredrulessubmitsupervisiontreatment
SHARED TOKENS (20): "case", "child", "community", "conditions", "contact", "criminal", "educational", "former", "law", "leave", "limited", "permit", "place", "program", "remain", "required", "rules", "submit", "supervision", "treatment". | EXACT TITLE in substance_use_recovery: "Probation".
0.500
activitiescareframeworkhealthcarelifemodeloperatespatientsproviderprovidingprovisionsettingssocialspecificsupport
SHARED TOKENS (15): "activities", "care", "framework", "healthcare", "life", "model", "operates", "patients", "provider", "providing", "provision", "settings", "social", "specific", "support". | EXACT TITLE in faith_religious: "Pastoral care".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesageagenciescanyoncentralcommercialcontrolcreateddevelopedeasterngovernmentsheavilyhistoryhumanidahoimportantlargestlimitedmajornational
SHARED TOKENS (31): "activities", "age", "agencies", "canyon", "central", "commercial", "control", "created", "developed", "eastern", "governments", "heavily", "history", "human", "idaho", "important", "largest", "limited", "major", "national".... | EXACT TITLE in faith_religious: "Snake River".
0.500
Drug court ↗ Q5308883 EXACT TITLE
addresscombinedcommunitiescriminalenforcementhealthlawmentalmodelprocesspublicsocialspecializedtreatmentwork
SHARED TOKENS (15): "address", "combined", "communities", "criminal", "enforcement", "health", "law", "mental", "model", "process", "public", "social", "specialized", "treatment", "work". | EXACT TITLE in substance_use_recovery: "Drug court".
0.500
addressassociationbehavioralchildrenclientcombinedcombinesconditionsdesigneddevelopeddevelopmentformhealthidentifiedlimitedmaintenancemedicalmentalnationalpatients
SHARED TOKENS (33): "address", "association", "behavioral", "children", "client", "combined", "combines", "conditions", "designed", "developed", "development", "form", "health", "identified", "limited", "maintenance", "medical", "mental", "national", "patients".... | EXACT TITLE in substance_use_recovery: "Cognitive behavioral therapy".
0.500
Psychology ↗ Q9418 EXACT TITLE
academicactivityanotherbehavioralboundariesclassifiedclinicalcounselingdevelopmenteducationfamilyfunctionsgroupgroupshealthhospitalshumanindividualsknowledgemedia
SHARED TOKENS (40): "academic", "activity", "another", "behavioral", "boundaries", "classified", "clinical", "counseling", "development", "education", "family", "functions", "group", "groups", "health", "hospitals", "human", "individuals", "knowledge", "media".... | EXACT TITLE in substance_use_recovery: "Psychology".
0.500
accessactivitiesactivityagainstanothercampaignscaredesigneddifferenteducationenvironmentfacilitiesfoodfreehealthhomelessnesshumaninformationlegallife
SHARED TOKENS (42): "access", "activities", "activity", "against", "another", "campaigns", "care", "designed", "different", "education", "environment", "facilities", "food", "free", "health", "homelessness", "human", "information", "legal", "life".... | EXACT TITLE in substance_use_recovery: "Harm reduction".
0.500
Pharmacist ↗ Q105186 EXACT TITLE
actionamongbachelorcareclinicalcollegescommunitydegreedifferenteducationeffectsgovernmenthealthhealthcarehospitalindustryknowledgelegallicensingmanagement
SHARED TOKENS (42): "action", "among", "bachelor", "care", "clinical", "colleges", "community", "degree", "different", "education", "effects", "government", "health", "healthcare", "hospital", "industry", "knowledge", "legal", "licensing", "management".... | EXACT TITLE in substance_use_recovery: "Pharmacist".
0.500
charitablecompletecurrentdifferentdocumentedfederalfreehomeinternationalliabilitylocalorganizationsoutsidepaidqualifyingreducedrulessalestatusveterans
SHARED TOKENS (20): "charitable", "complete", "current", "different", "documented", "federal", "free", "home", "international", "liability", "local", "organizations", "outside", "paid", "qualifying", "reduced", "rules", "sale", "status", "veterans". | EXACT TITLE in faith_religious: "Tax exemption".
0.500
Alcoholism ↗ Q15326 EXACT TITLE
affectsamongbehavioralchildclinicalcontextdefinitionsdevelopmentdirectlydrinkingeffectsenvironmentevidencegroupgroupshealthhistoricalincreasedinformationinterventions
SHARED TOKENS (44): "affects", "among", "behavioral", "child", "clinical", "context", "definitions", "development", "directly", "drinking", "effects", "environment", "evidence", "group", "groups", "health", "historical", "increased", "information", "interventions".... | EXACT TITLE in substance_use_recovery: "Alcoholism".
0.500
alreadyanothercounselingfinancialguidehumanlifepeopleplanningpracticepracticesprocessquestionsrelationshipschoolsseeking
SHARED TOKENS (16): "already", "another", "counseling", "financial", "guide", "human", "life", "people", "planning", "practice", "practices", "process", "questions", "relationship", "schools", "seeking". | EXACT TITLE in faith_religious: "Spiritual direction".
0.500
addressedamongapproximatelyconcerningcounselingdefinitiondesigneddevelopmentfamilygeneralgrouphealthhousesincorporatedliteraturemedicalmembersmentalorganizationspathway
SHARED TOKENS (33): "addressed", "among", "approximately", "concerning", "counseling", "definition", "designed", "development", "family", "general", "group", "health", "houses", "incorporated", "literature", "medical", "members", "mental", "organizations", "pathway".... | EXACT TITLE in substance_use_recovery: "Addiction medicine".
0.500
adultsagebehavioralcategoriescategorydirectdirectlyhealthincreasedmenmentaloperatingpatternpeoplepercentproblemsrelatedwomen
SHARED TOKENS (18): "adults", "age", "behavioral", "categories", "category", "direct", "directly", "health", "increased", "men", "mental", "operating", "pattern", "people", "percent", "problems", "related", "women". | EXACT TITLE in substance_use_recovery: "Substance use disorder".
0.500
adultsamongbehavioralcausecentralcombinedconcerningconditionsdeathdepartmenteffecteffectsenvironmentfacilitiesfrequentlygovernmenthealthincreasedmajormedical
SHARED TOKENS (36): "adults", "among", "behavioral", "cause", "central", "combined", "concerning", "conditions", "death", "department", "effect", "effects", "environment", "facilities", "frequently", "government", "health", "increased", "major", "medical".... | EXACT TITLE in substance_use_recovery: "Benzodiazepine".
0.500
activeaddressesappropriatecomprehensivecounselingeducationalfacilitiesfacilityfamilygroupgroupshealthhospitalhoursmentalofferedoperatesparticipationpatientsprogram
SHARED TOKENS (34): "active", "addresses", "appropriate", "comprehensive", "counseling", "educational", "facilities", "facility", "family", "group", "groups", "health", "hospital", "hours", "mental", "offered", "operates", "participation", "patients", "program".... | EXACT TITLE in substance_use_recovery: "Intensive outpatient program".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcarecertificationclinicalcredentialsdegreedemandeducationfamiliesgraduatehealthhealthcarehumanintegrateslargestlevelslifemembersnursingpatients
SHARED TOKENS (36): "act", "care", "certification", "clinical", "credentials", "degree", "demand", "education", "families", "graduate", "health", "healthcare", "human", "integrates", "largest", "levels", "life", "members", "nursing", "patients".... | EXACT TITLE in faith_religious: "Nursing". | EXACT TITLE in substance_use_recovery: "Nursing".
0.500
accessactiveaffectsageagencyanotheravailabilitybeyondchildrenconsistentcreatedegreedevelopmenteffectsevenfamilyfoodhealthhouseholdimportant
SHARED TOKENS (38): "access", "active", "affects", "age", "agency", "another", "availability", "beyond", "children", "consistent", "create", "degree", "development", "effects", "even", "family", "food", "health", "household", "important".... | EXACT TITLE in faith_religious: "Food security".
0.500
academicaccommodationappropriatecasecountrydefinesfairhumanlawmentalneedresultsrightssystemthem
SHARED TOKENS (15): "academic", "accommodation", "appropriate", "case", "country", "defines", "fair", "human", "law", "mental", "need", "results", "rights", "system", "them". | EXACT TITLE in faith_religious: "Reasonable accommodation".
0.500
agenciescarecasecontactdegreesdepartmentemergencyfacilitieshistoricallyhospitalleastlevelslifemedicalmembersmodeloperatepatientpatientspersonnel
SHARED TOKENS (37): "agencies", "care", "case", "contact", "degrees", "department", "emergency", "facilities", "historically", "hospital", "least", "levels", "life", "medical", "members", "model", "operate", "patient", "patients", "personnel".... | EXACT TITLE in substance_use_recovery: "Emergency medical services".
0.500
aloneamongcharitablecommunityeducationestablishesfoundedfundinggeneralgroupsinstitutioninternationallargestmajormeetingmissionnationalneedneedsofficers
SHARED TOKENS (35): "alone", "among", "charitable", "community", "education", "establishes", "founded", "funding", "general", "groups", "institution", "international", "largest", "major", "meeting", "mission", "national", "need", "needs", "officers".... | EXACT TITLE in faith_religious: "Salvation Army".
0.500
carecausecontrolcreatesdistributionevenhealthhealthcareindividualsinformationmanagementmedicalopportunitiesorganizationspatientspeopleremainsafescalesystem
SHARED TOKENS (23): "care", "cause", "control", "creates", "distribution", "even", "health", "healthcare", "individuals", "information", "management", "medical", "opportunities", "organizations", "patients", "people", "remain", "safe", "scale", "system".... | EXACT TITLE in substance_use_recovery: "Drug disposal".
0.500
accessadministrationapproximatelyaroundcannotcauseeffectsindividualsindustryinterventionsleastlevelsmentalpeoplepermanentprovidingrisksafesmallsubsequent
SHARED TOKENS (23): "access", "administration", "approximately", "around", "cannot", "cause", "effects", "individuals", "industry", "interventions", "least", "levels", "mental", "people", "permanent", "providing", "risk", "safe", "small", "subsequent".... | EXACT TITLE in substance_use_recovery: "Opioid overdose".
0.500
anotherbelongscasecommercialcontrolsdescribedentityevenfoundationinternationallawlegalownershiprecordrightsspecificstatutorythemthoughtitle
SHARED TOKENS (21): "another", "belongs", "case", "commercial", "controls", "described", "entity", "even", "foundation", "international", "law", "legal", "ownership", "record", "rights", "specific", "statutory", "them", "though", "title".... | EXACT TITLE in faith_religious: "Beneficial ownership".
0.500
carecomprehensivecontinuingfacilitieshealthhealthcarehomehospitalhospitalsidaholivingnetworkoperatesoperatingpatientspeoplesupportsystem
SHARED TOKENS (18): "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "living", "network", "operates", "operating", "patients", "people", "support", "system". | EXACT TITLE in faith_religious: "Trinity Health".
0.500
accessacteducationfederalfederallyformgroupslawprogramspublicschoolschoolssecuritystudentstudentsstudytitle
SHARED TOKENS (17): "access", "act", "education", "federal", "federally", "form", "groups", "law", "programs", "public", "school", "schools", "security", "student", "students", "study", "title". | EXACT TITLE in faith_religious: "Equal Access Act".
0.500
Chaplain ↗ Q208762 EXACT TITLE
adultsbuildingscasecodedepartmentdistinguisheducationalfacilityfaithgroupshealthcarehospitalshousesinstitutioninstitutionsitselflawmembersneedofficial
SHARED TOKENS (36): "adults", "buildings", "case", "code", "department", "distinguish", "educational", "facility", "faith", "groups", "healthcare", "hospitals", "houses", "institution", "institutions", "itself", "law", "members", "need", "official".... | EXACT TITLE in faith_religious: "Chaplain".
0.490
adaboiseidahooperatedprivateschoolschools
SHARED TOKENS (7): "ada", "boise", "idaho", "operated", "private", "school", "schools". | URL->A (1): http://www.bk.org/. | EXACT TITLE in faith_religious: "Bishop Kelly High School".
0.480
amongapproximatelybecomebodyconcerningcurrentdistinguishdistricteasternestablishedlargestpopulationsignificanttitle
SHARED TOKENS (14): "among", "approximately", "become", "body", "concerning", "current", "distinguish", "district", "eastern", "established", "largest", "population", "significant", "title". | EXACT TITLE in faith_religious: "Coptic Orthodox Church".
0.460
actionbodycharitableclaimsevidencehumanlimitedlivingpractitionersreturnsspecificallysupportingtherapy
SHARED TOKENS (13): "action", "body", "charitable", "claims", "evidence", "human", "limited", "living", "practitioners", "returns", "specifically", "supporting", "therapy". | EXACT TITLE in substance_use_recovery: "Detoxification".
0.460
authoritybuildingsestategoverninggovernmentmultiplenationalrealregionrentalrequiressystemwhose
SHARED TOKENS (13): "authority", "buildings", "estate", "governing", "government", "multiple", "national", "real", "region", "rental", "requires", "system", "whose". | EXACT TITLE in faith_religious: "Property tax".
0.460
agenciesconsumercreatedenforcementgeneralidaholawlegallimitslocalofficeownershipprotection
SHARED TOKENS (13): "agencies", "consumer", "created", "enforcement", "general", "idaho", "law", "legal", "limits", "local", "office", "ownership", "protection". | EXACT TITLE in faith_religious: "Idaho Attorney General".
0.460
communitycriminaldistinctformfreegroupjusticepeopleprogramsreplacerequirementsschoolwork
SHARED TOKENS (13): "community", "criminal", "distinct", "form", "free", "group", "justice", "people", "programs", "replace", "requirements", "school", "work". | EXACT TITLE in faith_religious: "Community service". | EXACT TITLE in substance_use_recovery: "Community service".
0.450
actagencyaggregatecapacitydifferententityformfunctiongovernmentincorporatedlawneednonprofitofficialorganizationrecognizedrecordsrequiressinglestandard
SHARED TOKENS (21): "act", "agency", "aggregate", "capacity", "different", "entity", "form", "function", "government", "incorporated", "law", "need", "nonprofit", "official", "organization", "recognized", "records", "requires", "single", "standard".... | URL->A (1): https://www.irs.gov/charities-non-profits/churches-integrated-auxiliaries-and-conventions-or-associations-of-churches.
0.450
boiseidahojohnmetropolitanwhose
SHARED TOKENS (5): "boise", "idaho", "john", "metropolitan", "whose". | URL->A (1): https://www.boisecathedral.org/. | EXACT TITLE in faith_religious: "Diocese of Boise".
0.440
actfederalhousehousesindividualsinstitutionslawpdfproblemsprotectstextzoning
SHARED TOKENS (12): "act", "federal", "house", "houses", "individuals", "institutions", "law", "pdf", "problems", "protects", "text", "zoning". | EXACT TITLE in faith_religious: "Religious Land Use and Institutionalized Persons Act".
0.440
associationcounselingcounselorsdistinctintegratesinternationallicensedsolelysourcesubmittherapiststherefore
SHARED TOKENS (12): "association", "counseling", "counselors", "distinct", "integrates", "international", "licensed", "solely", "source", "submit", "therapists", "therefore". | EXACT TITLE in faith_religious: "Christian counseling".
0.440
Imam ↗ Q125482 EXACT TITLE
applicablebecomecommunitycontextfamilyfoundedguidanceleadersleadershipmembersstudytitle
SHARED TOKENS (12): "applicable", "become", "community", "context", "family", "founded", "guidance", "leaders", "leadership", "members", "study", "title". | EXACT TITLE in faith_religious: "Imam".
0.440
authorityclaimscommunitiescreateddegreeseasternformerhistorymetropolitanoutsideprimarystatus
SHARED TOKENS (12): "authority", "claims", "communities", "created", "degrees", "eastern", "former", "history", "metropolitan", "outside", "primary", "status". | EXACT TITLE in faith_religious: "Russian Orthodox Church".
0.430
boisecollegeidahoprivate
SHARED TOKENS (4): "boise", "college", "idaho", "private". | URL->A (1): https://www.boisebible.edu/. | EXACT TITLE in faith_religious: "Boise Bible College".
0.430
idahonampaprivateuniversity
SHARED TOKENS (4): "idaho", "nampa", "private", "university". | URL->A (1): https://nnu.edu/. | EXACT TITLE in faith_religious: "Northwest Nazarene University".
0.400
announcedaprilarchitecturebuilddesigndesignedgeneralidahomeridianschool
SHARED TOKENS (10): "announced", "april", "architecture", "build", "design", "designed", "general", "idaho", "meridian", "school". | EXACT TITLE in faith_religious: "Meridian Idaho Temple".
0.400
Naltrexone ↗ Q409587 EXACT TITLE
amongeffectsmedicalmodelpeoplesafesoldthemthoughtreatment
SHARED TOKENS (10): "among", "effects", "medical", "model", "people", "safe", "sold", "them", "though", "treatment". | EXACT TITLE in substance_use_recovery: "Naltrexone".
0.380
adaboisecanyoncountiesidahometropolitanregiontreasurevalley
SHARED TOKENS (9): "ada", "boise", "canyon", "counties", "idaho", "metropolitan", "region", "treasure", "valley". | EXACT TITLE in faith_religious: "Southwestern Idaho".
0.380
controldefinitionsdifferenteducationforminformationlicensemedicalpatient
SHARED TOKENS (9): "control", "definitions", "different", "education", "form", "information", "license", "medical", "patient". | EXACT TITLE in substance_use_recovery: "Prescription drug".
0.360
Clergy ↗ Q177826 EXACT TITLE
differentestablishedfunctionshistoryleaderspositionspracticesspecific
SHARED TOKENS (8): "different", "established", "functions", "history", "leaders", "positions", "practices", "specific". | EXACT TITLE in faith_religious: "Clergy".
0.360
counselingcounselorsfaithhealthmentalpractitionerssupporttraining
SHARED TOKENS (8): "counseling", "counselors", "faith", "health", "mental", "practitioners", "support", "training". | EXACT TITLE in faith_religious: "Pastoral counseling".
0.360
emergencyhousingpeoplepermanentpopulationresidentssheltersupport
SHARED TOKENS (8): "emergency", "housing", "people", "permanent", "population", "residents", "shelter", "support". | EXACT TITLE in substance_use_recovery: "Transitional housing".
0.360
bodyfederalgeneralgovernmentprogramsregionalrevenuesmaller
SHARED TOKENS (8): "body", "federal", "general", "government", "programs", "regional", "revenue", "smaller". | EXACT TITLE in substance_use_recovery: "Block grant".
0.340
buildingsbuiltdevelopmentenvironmenthistoricalmaintainsspecifically
SHARED TOKENS (7): "buildings", "built", "development", "environment", "historical", "maintains", "specifically". | EXACT TITLE in faith_religious: "Historic preservation".
0.340
Relapse ↗ Q2292472 EXACT TITLE
activitydevelopedformindividualsmedicalmentalmultiple
SHARED TOKENS (7): "activity", "developed", "form", "individuals", "medical", "mental", "multiple". | EXACT TITLE in substance_use_recovery: "Relapse".
0.320
businesscaredeathfamilieshomeprovision
SHARED TOKENS (6): "business", "care", "death", "families", "home", "provision". | EXACT TITLE in faith_religious: "Funeral home".
0.320
announcedboisebuildbuiltidahooperating
SHARED TOKENS (6): "announced", "boise", "build", "built", "idaho", "operating". | EXACT TITLE in faith_religious: "Boise Idaho Temple".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in substance_use_recovery: "Idaho Department of Health and Welfare".
0.320
associatebuildinghousedidahojusticepresent
SHARED TOKENS (6): "associate", "building", "housed", "idaho", "justice", "present". | EXACT TITLE in substance_use_recovery: "Idaho Supreme Court".
0.320
agencycertificationeducationaljobprofessionalpublic
SHARED TOKENS (6): "agency", "certification", "educational", "job", "professional", "public". | EXACT TITLE in faith_religious: "Professional certification".
0.300
actcenterciviccommunityeducationfaithformergroupgroupsidentifyincreasedinstituteintegrationlargestlegallevelslifelivingmakingorganizations
SHARED TOKENS (36): "act", "center", "civic", "community", "education", "faith", "former", "group", "groups", "identify", "increased", "institute", "integration", "largest", "legal", "levels", "life", "living", "making", "organizations"....
0.300
administeredamonganothercaseexperienceincreasedlifemaintenancepatientspeopleprogramsroughlysocialtherapytreatment
SHARED TOKENS (15): "administered", "among", "another", "case", "experience", "increased", "life", "maintenance", "patients", "people", "programs", "roughly", "social", "therapy", "treatment".
0.300
actadministrationagainstchildrencountrycreatedeasternestablishedfederalhistoryincreasedincreasinglyindividualsjohnlawlegalmakingmembersnationalopposition
SHARED TOKENS (29): "act", "administration", "against", "children", "country", "created", "eastern", "established", "federal", "history", "increased", "increasingly", "individuals", "john", "law", "legal", "making", "members", "national", "opposition"....
0.300
accessannualaroundassociationcannotcountrydepartmentdevelopmentevenfoodhealthhistoricallyhomehomelessnesshousinghumanincreasedincreasinglyindividualsindustry
SHARED TOKENS (39): "access", "annual", "around", "association", "cannot", "country", "department", "development", "even", "food", "health", "historically", "home", "homelessness", "housing", "human", "increased", "increasingly", "individuals", "industry"....
0.300
agencycenterscommunityconditionscreateemergencyexperiencingfamilieshomelessnesshousingindividualsinstitutionmanagementoperateoperatedpeoplepopulationsproblemsprotectionresidents
SHARED TOKENS (26): "agency", "centers", "community", "conditions", "create", "emergency", "experiencing", "families", "homelessness", "housing", "individuals", "institution", "management", "operate", "operated", "people", "populations", "problems", "protection", "residents"....
0.300
aroundassociatecannotcarecountrydirecteducationalhealthhealthcarejobleastmedicalmodelpracticepractitionerpresentprincipalproviderprovidersrequired
SHARED TOKENS (28): "around", "associate", "cannot", "care", "country", "direct", "educational", "health", "healthcare", "job", "least", "medical", "model", "practice", "practitioner", "present", "principal", "provider", "providers", "required"....
0.300
Family therapy ↗ Q870449 KW CROSS HIGH
childrenclientscounselingdevelopeddevelopmentdifferentdirectfamiliesfamilyhumaninfluenceinvolvingmarriagemembersnarrowparentsparticipationpeopleproblemrelated
SHARED TOKENS (29): "children", "clients", "counseling", "developed", "development", "different", "direct", "families", "family", "human", "influence", "involving", "marriage", "members", "narrow", "parents", "participation", "people", "problem", "related"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectaffectsaroundbehavioralclinicalclinicallycommunitycontextdifferentdisabilityfunctionshealthhospitalsinterventionsmajormakingmedicalmentalpatternpeople
SHARED TOKENS (29): "affect", "affects", "around", "behavioral", "clinical", "clinically", "community", "context", "different", "disability", "functions", "health", "hospitals", "interventions", "major", "making", "medical", "mental", "pattern", "people"....
0.300
activitiesadoptedanotherapplyarticleauthorityauthorizedboardcapacitychildclinicalconditionsdecision-makingdefinitionsdisabilitydiscloseevidenceforceformfree
SHARED TOKENS (53): "activities", "adopted", "another", "apply", "article", "authority", "authorized", "board", "capacity", "child", "clinical", "conditions", "decision-making", "definitions", "disability", "disclose", "evidence", "force", "form", "free"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actactivitiesadmissionsbecomecarecontrolsgrouphealthhealthcareincreasedinsuranceintendedlifemaintenancemanagementmechanismsmedicalorganizationorganizationspatients
SHARED TOKENS (29): "act", "activities", "admissions", "become", "care", "controls", "group", "health", "healthcare", "increased", "insurance", "intended", "life", "maintenance", "management", "mechanisms", "medical", "organization", "organizations", "patients"....
0.300
Group home ↗ Q442993 KW CROSS HIGH
activityadultsarticlecannotcarecasechildrenclientsfacilitiesfacilityfamiliesfamilygrouphealthhomehomeshourshouseindividualsleast
SHARED TOKENS (35): "activity", "adults", "article", "cannot", "care", "case", "children", "clients", "facilities", "facility", "families", "family", "group", "health", "home", "homes", "hours", "house", "individuals", "least"....
0.300
American Jews ↗ Q678551 KW CROSS HIGH
adultsapproximatelycategoriescategorychildrencommunitiescommunitydatadefinitionsgroupsidentifylargestlawleastpeoplepopulationresearchsmallsmaller
SHARED TOKENS (19): "adults", "approximately", "categories", "category", "children", "communities", "community", "data", "definitions", "groups", "identify", "largest", "law", "least", "people", "population", "research", "small", "smaller".
0.300
Cocaine ↗ Q41576 KW CROSS HIGH
administrationaffectcausecentralcontroldeathdevelopmenteffectsexpandinggroupshistoricallyincreasedinternationalleastlegallimitedlocalmarketmedicalorganized
SHARED TOKENS (30): "administration", "affect", "cause", "central", "control", "death", "development", "effects", "expanding", "groups", "historically", "increased", "international", "least", "legal", "limited", "local", "market", "medical", "organized"....
0.300
accessactivebodycapacitycollaborationcommunitycreateeducationenforcementhealthhealthcarehumanincreasedincreasinglyindexinternationalproblemprotectionregulationsregulatory
SHARED TOKENS (30): "access", "active", "body", "capacity", "collaboration", "community", "create", "education", "enforcement", "health", "healthcare", "human", "increased", "increasingly", "index", "international", "problem", "protection", "regulations", "regulatory"....
0.300
Cremation ↗ Q207315 EXACT TITLE
bodyhealthremainsrisksite
SHARED TOKENS (5): "body", "health", "remains", "risk", "site". | EXACT TITLE in faith_religious: "Cremation".
0.300
anotherbecomecontrolestablishingfederalformfreegovernmentgovernmentsjohnlaterlawlimitsofficialpracticepracticesrightssecurityspecifictext
SHARED TOKENS (20): "another", "become", "control", "establishing", "federal", "form", "free", "government", "governments", "john", "later", "law", "limits", "official", "practice", "practices", "rights", "security", "specific", "text".
0.300
actcareconfidentialitydegreedevelopedemployersfacilityhealthinstitutionsinsurancemaintainingmanagementmedicalpatientpatientspeoplepracticeprivacyprovidersrecords
SHARED TOKENS (23): "act", "care", "confidentiality", "degree", "developed", "employers", "facility", "health", "institutions", "insurance", "maintaining", "management", "medical", "patient", "patients", "people", "practice", "privacy", "providers", "records"....
0.300
behavioralconditionscounselingfinancialgeneralgroupslegalmedicalparticipationpatientpeoplepresentprocesssocialtrainedtreatment
SHARED TOKENS (16): "behavioral", "conditions", "counseling", "financial", "general", "groups", "legal", "medical", "participation", "patient", "people", "present", "process", "social", "trained", "treatment".
0.300
actapplicationarticleauthoritydifferentemploymenthistoryhousejohnlaborlaterlawlegislativenationalprotectionpublicregistrationrequirementsrightsschools
SHARED TOKENS (22): "act", "application", "article", "authority", "different", "employment", "history", "house", "john", "labor", "later", "law", "legislative", "national", "protection", "public", "registration", "requirements", "rights", "schools"....
0.300
activityamongapproximatelyauthoritybecomebodycentralcommunitieseasternestablishedfaithformergovernedgroupgroupshistoryincreasedinstitutionsjurisdictionallocal
SHARED TOKENS (34): "activity", "among", "approximately", "authority", "become", "body", "central", "communities", "eastern", "established", "faith", "former", "governed", "group", "groups", "history", "increased", "institutions", "jurisdictional", "local"....
0.300
Ecumenism ↗ Q156112 KW CROSS HIGH
activitiesaddressedadoptedamongcausecentralcommunitycontemporarycooperationdifferenteasternestablishfaithfoundedhistoricallyjohnleaderslifelivinglocal
SHARED TOKENS (35): "activities", "addressed", "adopted", "among", "cause", "central", "community", "contemporary", "cooperation", "different", "eastern", "establish", "faith", "founded", "historically", "john", "leaders", "life", "living", "local"....
0.300
accreditedactadministrationagainstagenciesagencyanotherassociationauthorityauthorizedcommunitycompletecomprehensiveconsolidationcontrolcreatesdatadepartmentdeterminesdistribution
SHARED TOKENS (60): "accredited", "act", "administration", "against", "agencies", "agency", "another", "association", "authority", "authorized", "community", "complete", "comprehensive", "consolidation", "control", "creates", "data", "department", "determines", "distribution"....
0.300
actaddressedagainstarticleassociationboardbuildingeducationeffectestablishedfaithfreefunctiongovernmentinstitutionsintendeditselfjusticelawlies
SHARED TOKENS (32): "act", "addressed", "against", "article", "association", "board", "building", "education", "effect", "established", "faith", "free", "function", "government", "institutions", "intended", "itself", "justice", "law", "lies"....
0.300
Heroin ↗ Q60168 KW CROSS HIGH
administrationamongapproximatelyaroundbehavioralclinicalcontexteffecteffectsformfunctionhistoryhoursincreasedlicensementalpeoplepercentpossessrapid
SHARED TOKENS (27): "administration", "among", "approximately", "around", "behavioral", "clinical", "context", "effect", "effects", "form", "function", "history", "hours", "increased", "license", "mental", "people", "percent", "possess", "rapid"....
0.300
adultsagainstamongbeyondcenterconnectioncountrycriminaleducationestablishedhistoricalidentifyimportantinstituteinstitutionsjusticelargestlegallevelsmembers
SHARED TOKENS (33): "adults", "against", "among", "beyond", "center", "connection", "country", "criminal", "education", "established", "historical", "identify", "important", "institute", "institutions", "justice", "largest", "legal", "levels", "members"....
0.300
ageassociationbehavioralcurrentdeathdifferenteffectsfamilygrouphealthhistoryhomeimportantincreasedlivingmedicalmeetingmentalpeopleproblems
SHARED TOKENS (32): "age", "association", "behavioral", "current", "death", "different", "effects", "family", "group", "health", "history", "home", "important", "increased", "living", "medical", "meeting", "mental", "people", "problems"....
0.300
activityaddressedcommunitiescontracteddecemberdegreedifferentdistincteasternfreegenerallargestlifelivingmembersmenofficepermitrulesspecific
SHARED TOKENS (22): "activity", "addressed", "communities", "contracted", "december", "degree", "different", "distinct", "eastern", "free", "general", "largest", "life", "living", "members", "men", "office", "permit", "rules", "specific"....
0.300
anotherclaimscountrydifferentdiversityformhistoricalinstitutionleastopenoppositionpolicypublicresultschoolsinglesocietysourcesupportingsystems
SHARED TOKENS (21): "another", "claims", "country", "different", "diversity", "form", "historical", "institution", "least", "open", "opposition", "policy", "public", "result", "school", "single", "society", "source", "supporting", "systems"....
0.300
administeredagencyamongassociationbusinesscarecasecentralcommunitycontractcoveragedeathdisabilityentityevidencegovernmenthealthindividualsinsurancemedical
SHARED TOKENS (31): "administered", "agency", "among", "association", "business", "care", "case", "central", "community", "contract", "coverage", "death", "disability", "entity", "evidence", "government", "health", "individuals", "insurance", "medical"....
0.300
activitiesanotheraroundauthoritybecomecareclientclinicalcoachingcontroldirecteducationeffectsevidenceexperiencefinancialgeneralhealthhealthcareinvestment
SHARED TOKENS (50): "activities", "another", "around", "authority", "become", "care", "client", "clinical", "coaching", "control", "direct", "education", "effects", "evidence", "experience", "financial", "general", "health", "healthcare", "investment"....
0.300
activitiesadoptedapplicationcannotexpresslyfederalformfreegovernmenthumaninvolvinglaterlawlimitsopportunitypracticepracticesprotectionreducedrelated
SHARED TOKENS (25): "activities", "adopted", "application", "cannot", "expressly", "federal", "form", "free", "government", "human", "involving", "later", "law", "limits", "opportunity", "practice", "practices", "protection", "reduced", "related"....
0.300
Epidemiology ↗ Q133805 KW CROSS HIGH
amonganalysisapplicationappropriateclinicalconditionsdatadescriptiondesigndistinctiondistributioneffectsfunctiongeneralhealthhealthcarehistoricallyhumanidentifyingknowledge
SHARED TOKENS (42): "among", "analysis", "application", "appropriate", "clinical", "conditions", "data", "description", "design", "distinction", "distribution", "effects", "function", "general", "health", "healthcare", "historically", "human", "identifying", "knowledge"....
0.300
academicacquisitionapplicationapplicationscarecommunicationcontextdatadesigndevelopmentdomainhealthhealthcarehospitalsinformationinstitutionsmanagementmedicalpatientproblems
SHARED TOKENS (24): "academic", "acquisition", "application", "applications", "care", "communication", "context", "data", "design", "development", "domain", "health", "healthcare", "hospitals", "information", "institutions", "management", "medical", "patient", "problems"....
0.300
Evangelicalism ↗ Q194253 KW CROSS HIGH
amongaroundauthoritybodiescentralclaimscommunityconfineddefinitiondescribedexpandingfaithfreegeneralgrouphistoricallyjohnlargestleadersmaking
SHARED TOKENS (30): "among", "around", "authority", "bodies", "central", "claims", "community", "confined", "definition", "described", "expanding", "faith", "free", "general", "group", "historically", "john", "largest", "leaders", "making"....
0.300
alreadybodycentercreateddevelopmentestablishedevenfunctionlifelocalnetworkprocessrelationshipresultsseparate
SHARED TOKENS (15): "already", "body", "center", "created", "development", "established", "even", "function", "life", "local", "network", "process", "relationship", "results", "separate".
0.300
aroundassociationcollegeconnectionscontemporaryexpandedidentifiesindependentinternationaljohnleadershiplocalmaintainingmaintainsnetworkoperatespracticesprogramsremains
SHARED TOKENS (19): "around", "association", "college", "connections", "contemporary", "expanded", "identifies", "independent", "international", "john", "leadership", "local", "maintaining", "maintains", "network", "operates", "practices", "programs", "remains".
0.300
actaddressedadministrativeauthorizedcareconcerningconfidentialitycoverageemployersentityfamiliesfamilyfederalgrouphealthhealthcareindividualsinformationinsurancelaw
SHARED TOKENS (36): "act", "addressed", "administrative", "authorized", "care", "concerning", "confidentiality", "coverage", "employers", "entity", "families", "family", "federal", "group", "health", "healthcare", "individuals", "information", "insurance", "law"....
0.300
Public health ↗ Q189603 KW CROSS HIGH
accessamongbehavioralcarecasechildcommunitiescommunitycomprehensivecontrolcountrycrisesdesigneddevelopeddevelopmentdifferentdisabilitydistributioneducationeven
SHARED TOKENS (58): "access", "among", "behavioral", "care", "case", "child", "communities", "community", "comprehensive", "control", "country", "crises", "designed", "developed", "development", "different", "disability", "distribution", "education", "even"....
0.300
activityadultsagainstamongcentralclassifiedcontainingcontainscountrydeathdistinctdrinkingeffectsgrouphealthincreasedindustrylegalnewsopportunity
SHARED TOKENS (27): "activity", "adults", "against", "among", "central", "classified", "containing", "contains", "country", "death", "distinct", "drinking", "effects", "group", "health", "increased", "industry", "legal", "news", "opportunity"....
0.300
Morphine ↗ Q81225 KW CROSS HIGH
administeradministeredadministrationaffectamongapproximatelycausecentraldevelopeddirectlyeffecteffectsfamilyfrequentlyhealthhourslabormultipleorganizationprimary
SHARED TOKENS (25): "administer", "administered", "administration", "affect", "among", "approximately", "cause", "central", "developed", "directly", "effect", "effects", "family", "frequently", "health", "hours", "labor", "multiple", "organization", "primary"....
0.300
behavioralexpandedexperiencefinancialformframeworkidentifiedmentalprocessratherrelatedrisksocialsolelysystem
SHARED TOKENS (15): "behavioral", "expanded", "experience", "financial", "form", "framework", "identified", "mental", "process", "rather", "related", "risk", "social", "solely", "system".
0.300
agenciesauthorizedboardscaredatadistributesenforcementestablishedevidenceexperiencingfederallyhealthidentifyingincreasedlawlicensingmultiplepatientspractitionersprogram
SHARED TOKENS (31): "agencies", "authorized", "boards", "care", "data", "distributes", "enforcement", "established", "evidence", "experiencing", "federally", "health", "identifying", "increased", "law", "licensing", "multiple", "patients", "practitioners", "program"....
0.300
analysiscareclinicalcurrentdatadecision-makingevidenceexperienceguidehealthhealthcarehumaninformationleastmakingmanagementpatientpatientspracticepublic
SHARED TOKENS (22): "analysis", "care", "clinical", "current", "data", "decision-making", "evidence", "experience", "guide", "health", "healthcare", "human", "information", "least", "making", "management", "patient", "patients", "practice", "public"....
0.300
addressingadministeredauthorizedconcerningcreateddepartmenteducationfederalfundinggeneralgovernmenthealthhealthcarehumanmattersmedicalmissionprimaryprivateproviding
SHARED TOKENS (25): "addressing", "administered", "authorized", "concerning", "created", "department", "education", "federal", "funding", "general", "government", "health", "healthcare", "human", "matters", "medical", "mission", "primary", "private", "providing"....
0.300
actapplicableassociationauthoritycentralcommunitiescommunitycomprehensiveconditionsconflictscountrycreatingdefinitiondesigndevelopmentfacilitiesfoundedfunctiongovernmentshealth
SHARED TOKENS (39): "act", "applicable", "association", "authority", "central", "communities", "community", "comprehensive", "conditions", "conflicts", "country", "creating", "definition", "design", "development", "facilities", "founded", "function", "governments", "health"....
0.300
actcommunitiescountrycrisisfederalhistorylargestlawmedicalpatientspdfsinglesupporttexttreatment
SHARED TOKENS (15): "act", "communities", "country", "crisis", "federal", "history", "largest", "law", "medical", "patients", "pdf", "single", "support", "text", "treatment".
0.300
adultsamongapproximatelyaroundcategoriescategorycentercommunitiescountrydifferenteasternfaithformfoundationgeneralgroupsidentifiedidentifyidentifyingincreased
SHARED TOKENS (38): "adults", "among", "approximately", "around", "categories", "category", "center", "communities", "country", "different", "eastern", "faith", "form", "foundation", "general", "groups", "identified", "identify", "identifying", "increased"....
0.300
accessactivitiesadministrationagencyannouncedassociationcapacitycenterscontrolcooperationdepartmentdesigneddisabilityeducationalfederalfoodfoundinggovernmenthealthhuman
SHARED TOKENS (41): "access", "activities", "administration", "agency", "announced", "association", "capacity", "centers", "control", "cooperation", "department", "designed", "disability", "educational", "federal", "food", "founding", "government", "health", "human"....
0.300
bodycontinuouscontractedcontrolcooperationexperiencefaithhistoryincreasedindependentinstitutionlargestleadershiplifelocalmarriagemembersorganizationparticipationpositions
SHARED TOKENS (31): "body", "continuous", "contracted", "control", "cooperation", "experience", "faith", "history", "increased", "independent", "institution", "largest", "leadership", "life", "local", "marriage", "members", "organization", "participation", "positions"....
0.300
becomedescribesdevelopedfoundeditselfmajormenmodelnonprofitorganizationpeopleproblemsocietyusesweekwomen
SHARED TOKENS (16): "become", "describes", "developed", "founded", "itself", "major", "men", "model", "nonprofit", "organization", "people", "problem", "society", "uses", "week", "women".
0.300
actagainstagencyapproximatelyassistancebodycarecodecreateddepartmentenforcementfederalfundinggovernmenthandlinghistoryimportantlaterlawoffice
SHARED TOKENS (35): "act", "against", "agency", "approximately", "assistance", "body", "care", "code", "created", "department", "enforcement", "federal", "funding", "government", "handling", "history", "important", "later", "law", "office"....
0.300
actageapplicantscannotcareconditionscoverageeducationeffecteligibilityexpandedexpansionfederalforcefundinghealthhealthcareincreasedindividualsinsurance
SHARED TOKENS (47): "act", "age", "applicants", "cannot", "care", "conditions", "coverage", "education", "effect", "eligibility", "expanded", "expansion", "federal", "force", "funding", "health", "healthcare", "increased", "individuals", "insurance"....
0.300
Imprisonment ↗ Q841236 KW CROSS HIGH
againstauthorityauthorizedbecomecasecauseconditionsevenevidenceforcegovernmenthumanitselflawopenpeopleplaceplacingprovisionsrecognized
SHARED TOKENS (21): "against", "authority", "authorized", "become", "case", "cause", "conditions", "even", "evidence", "force", "government", "human", "itself", "law", "open", "people", "place", "placing", "provisions", "recognized"....
0.300
Juvenile court ↗ Q468501 KW CROSS HIGH
adultsageauthoritycapacitycausechildchildrenconcerningcontextcreatecriminaldatadevelopmentdiffergeneralincreasinglyinternationaljusticelegallocally
SHARED TOKENS (39): "adults", "age", "authority", "capacity", "cause", "child", "children", "concerning", "context", "create", "criminal", "data", "development", "differ", "general", "increasingly", "international", "justice", "legal", "locally"....
0.300
activeactivityamongavailabilitybelongsbeyondcentralclassifiedcontinuouslydistributioneffectsfreefunctionhumaninvolvingliabilitylimitspossessrapidregulatory
SHARED TOKENS (29): "active", "activity", "among", "availability", "belongs", "beyond", "central", "classified", "continuously", "distribution", "effects", "free", "function", "human", "involving", "liability", "limits", "possess", "rapid", "regulatory"....
0.300
Drug checking ↗ Q3519101 KW CROSS HIGH
actionbecomedevelopedhealthidentifyinginformationlaterlimitslocalnationalpeopleprogramspublicresultsrisksrolesafesinglesitessmall
SHARED TOKENS (24): "action", "become", "developed", "health", "identifying", "information", "later", "limits", "local", "national", "people", "programs", "public", "results", "risks", "role", "safe", "single", "sites", "small"....
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
accommodationaddressaddressedaddressesaffectagainstcarecausechildrencommunitycomprehensivedifferenteducationemergencyemploymentevidencefamilyformgovernmenthealthcare
SHARED TOKENS (53): "accommodation", "address", "addressed", "addresses", "affect", "against", "care", "cause", "children", "community", "comprehensive", "different", "education", "emergency", "employment", "evidence", "family", "form", "government", "healthcare"....
0.300
activitiesadultsapplicationcarecausechildrencounselingdisabilityeducationevenhealthhealthcarehomeidentifyimportantindexindividualsinformationorganizationoutside
SHARED TOKENS (29): "activities", "adults", "application", "care", "cause", "children", "counseling", "disability", "education", "even", "health", "healthcare", "home", "identify", "important", "index", "individuals", "information", "organization", "outside"....
0.300
addressingamongcommunityestablishedfamilyfoundedinternationallocalmaterialmembersneedsorganizationorganizationsprogramssocialsociety
SHARED TOKENS (16): "addressing", "among", "community", "established", "family", "founded", "international", "local", "material", "members", "needs", "organization", "organizations", "programs", "social", "society".
0.300
activitiesclientscommunitiescommunitydifferentgrouphousesincreasinglylivingmentalpathpatientproblemsresidentialtherapiststherapytreatmentunits
SHARED TOKENS (18): "activities", "clients", "communities", "community", "different", "group", "houses", "increasingly", "living", "mental", "path", "patient", "problems", "residential", "therapists", "therapy", "treatment", "units".
0.300
addressassociationbehavioralcannotcodecontroldevelopedfoundedlifemakingmenorganizationsproblemsprocessprogramprogramspublishedsponsorsupporting
SHARED TOKENS (19): "address", "association", "behavioral", "cannot", "code", "control", "developed", "founded", "life", "making", "men", "organizations", "problems", "process", "program", "programs", "published", "sponsor", "supporting".
0.300
applybehavioralfederalgovernmenthealthinstituteknowledgemissionnationalpublicresearchsocialstudysupplywhose
SHARED TOKENS (15): "apply", "behavioral", "federal", "government", "health", "institute", "knowledge", "mission", "national", "public", "research", "social", "study", "supply", "whose".
0.300
administrationagencyassistancecasecenterscountrydepartmentdisabilityeducationemergencyestablishedexpandedfacilitiesfamilyfederalgovernmenthealthcarehomeinsuranceliability
SHARED TOKENS (30): "administration", "agency", "assistance", "case", "centers", "country", "department", "disability", "education", "emergency", "established", "expanded", "facilities", "family", "federal", "government", "healthcare", "home", "insurance", "liability"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfinancingfoundedgovernmenthomehousehousingpoliciesprogramreportssociety
SHARED TOKENS (17): "administers", "agency", "department", "departments", "development", "directly", "federal", "financing", "founded", "government", "home", "house", "housing", "policies", "program", "reports", "society".
0.300
actionadoptedagainstagenciesarticleassociationdecemberexpandedfreefrequentlygovernmentinformationmakingmediaoppositionplaceprocessprotectionsprotectsprovisions
SHARED TOKENS (22): "action", "adopted", "against", "agencies", "article", "association", "december", "expanded", "free", "frequently", "government", "information", "making", "media", "opposition", "place", "process", "protections", "protects", "provisions"....
0.300
assistanceassociationbecomecausecharitablecommunitiescountrydocumentedfinancialformerfoundedgeneralgovernmenthistoryhospitalsidentifiesincorporatedinfluenceinstitutionallargest
SHARED TOKENS (40): "assistance", "association", "become", "cause", "charitable", "communities", "country", "documented", "financial", "former", "founded", "general", "government", "history", "hospitals", "identifies", "incorporated", "influence", "institutional", "largest"....
0.300
actactiveaddressadoptedageamongaroundbecomecentralcollegecommunitydegreesdevelopedformerfoundinghistoricallyimportantinfluencejohnlocal
SHARED TOKENS (33): "act", "active", "address", "adopted", "age", "among", "around", "become", "central", "college", "community", "degrees", "developed", "former", "founding", "historically", "important", "influence", "john", "local"....
0.300
actadaagainstbusinesscoalitiondisabilityemployershouseidentityindividualslaterlawnationalprotectionprotectionspublicrequirementsrequiresrights
SHARED TOKENS (19): "act", "ada", "against", "business", "coalition", "disability", "employers", "house", "identity", "individuals", "later", "law", "national", "protection", "protections", "public", "requirements", "requires", "rights".
0.300
amongarchitecturecentralclassifiedcommunitiesdevelopeddifferentgovernmentsgroupshistoricallyidentifyincreasedindividualsjusticeknowledgeleastlevelsneedsofficialorganization
SHARED TOKENS (33): "among", "architecture", "central", "classified", "communities", "developed", "different", "governments", "groups", "historically", "identify", "increased", "individuals", "justice", "knowledge", "least", "levels", "needs", "official", "organization"....
0.300
administrationbehavioralcentralclinicaldevelopeddevelopmentdifferenteducationalfamilyhealthheavilyhumanidahointegrationknowledgemedicalmentalmodelneedpractice
SHARED TOKENS (33): "administration", "behavioral", "central", "clinical", "developed", "development", "different", "educational", "family", "health", "heavily", "human", "idaho", "integration", "knowledge", "medical", "mental", "model", "need", "practice"....
0.300
actadministeradministrativeagainstageagencycannotclaimsdisabilityemployersemploymentestablishedfederalgovernmentidentityinformationnationalopportunitypracticerights
SHARED TOKENS (20): "act", "administer", "administrative", "against", "age", "agency", "cannot", "claims", "disability", "employers", "employment", "established", "federal", "government", "identity", "information", "national", "opportunity", "practice", "rights".
0.300
behavioralbuiltcommunitydevelopedestablishedfreegroupsinternationalmedicalmodelorganizationpatientspeopleprofessionalseekingsupporttherapytrainedtrainingweek
SHARED TOKENS (20): "behavioral", "built", "community", "developed", "established", "free", "groups", "international", "medical", "model", "organization", "patients", "people", "professional", "seeking", "support", "therapy", "trained", "training", "week".
0.300
addressassistancebuildingcarecausecounselingeducationevenfamilyformfoundingfreegovernmenthistoryjohnlaterlawleaderslimitedliving
SHARED TOKENS (37): "address", "assistance", "building", "care", "cause", "counseling", "education", "even", "family", "form", "founding", "free", "government", "history", "john", "later", "law", "leaders", "limited", "living"....
0.300
actadministeradministersadministrationadministrativeagencycarecenterscertificationchildrenclinicaldepartmentfacilitiesfederalfinancinggovgovernmentshealthhealthcarehome
SHARED TOKENS (31): "act", "administer", "administers", "administration", "administrative", "agency", "care", "centers", "certification", "children", "clinical", "department", "facilities", "federal", "financing", "gov", "governments", "health", "healthcare", "home"....
0.300
actadmissionsalreadyarticlebeyondcreatedeffectestablishedfederalgovernmentincorporatedmechanismofficersoperationsorganizedpeoplepopulationprocessregiontoward
SHARED TOKENS (20): "act", "admissions", "already", "article", "beyond", "created", "effect", "established", "federal", "government", "incorporated", "mechanism", "officers", "operations", "organized", "people", "population", "process", "region", "toward".
0.300
accessaddressesaffectboardcaredevelopedfinancinghealthhealthcareindividualsinformationinstitutionsknowledgelifemedicalorganizationorganizationalpatientspeoplepolicy
SHARED TOKENS (35): "access", "addresses", "affect", "board", "care", "developed", "financing", "health", "healthcare", "individuals", "information", "institutions", "knowledge", "life", "medical", "organization", "organizational", "patients", "people", "policy"....
0.300
administrationannouncedavailabilitybuildingdeathdepartmentdirectlydisabilityhealthhumanmentaloutsidereportssocietytreatment
SHARED TOKENS (15): "administration", "announced", "availability", "building", "death", "department", "directly", "disability", "health", "human", "mental", "outside", "reports", "society", "treatment".
0.300
actadministrationannouncedauthorizedavailabilitybuildcommunitycomprehensiveeducationfederalfundinghealthintendedlawmajormentalnetworksorganizationsprocessprograms
SHARED TOKENS (23): "act", "administration", "announced", "authorized", "availability", "build", "community", "comprehensive", "education", "federal", "funding", "health", "intended", "law", "major", "mental", "networks", "organizations", "process", "programs"....
0.300
businesscaredefinesdepartmentfacilityhealthhumaninsurancelicensedmedicalorganizationpaidprofessionalproviderproviderstreatment
SHARED TOKENS (16): "business", "care", "defines", "department", "facility", "health", "human", "insurance", "licensed", "medical", "organization", "paid", "professional", "provider", "providers", "treatment".
0.300
adoptedbeyondcommunitydefinitiondemonstratingdevelopeddevelopmentdifferenteffectsevenexplicitlyhealthindividualslifelivingmentalmodelpeoplepoliciesprocess
SHARED TOKENS (31): "adopted", "beyond", "community", "definition", "demonstrating", "developed", "development", "different", "effects", "even", "explicitly", "health", "individuals", "life", "living", "mental", "model", "people", "policies", "process"....
0.300
administrationaffectcauseconditionsdevelopeddifferentevenformgroupincreasedindividualslegalmedicalratherrolethem
SHARED TOKENS (16): "administration", "affect", "cause", "conditions", "developed", "different", "even", "form", "group", "increased", "individuals", "legal", "medical", "rather", "role", "them".
0.300
controldemandeffectsexpandingfederalfoodfundinghealthinvolvingknowledgelegalmedicalopportunitypeopleprivatepublicrelatedresearchtreatment
SHARED TOKENS (19): "control", "demand", "effects", "expanding", "federal", "food", "funding", "health", "involving", "knowledge", "legal", "medical", "opportunity", "people", "private", "public", "related", "research", "treatment".
0.300
accessbehavioralcarecenterconditionseasternfacilitiesfacilityhealthhealthcareinterventionsleastlimitedmentaloutsidepatientpeoplepopulationspracticeproblems
SHARED TOKENS (35): "access", "behavioral", "care", "center", "conditions", "eastern", "facilities", "facility", "health", "healthcare", "interventions", "least", "limited", "mental", "outside", "patient", "people", "populations", "practice", "problems"....
0.300
actadministrationagencyauthoritycontrolcurrentdepartmentdirectlyfederalfoodformerhealthhouseholdhumanmedicalprimarypublicregulatedregulationsrelated
SHARED TOKENS (25): "act", "administration", "agency", "authority", "control", "current", "department", "directly", "federal", "food", "former", "health", "household", "human", "medical", "primary", "public", "regulated", "regulations", "related"....
0.300
Support group ↗ Q3117735 KW CROSS HIGH
advocacycommunityestablishingformgroupinformationmembersnetworkspeopleprovidingpublicrelevantsocialsupportwork
SHARED TOKENS (15): "advocacy", "community", "establishing", "form", "group", "information", "members", "networks", "people", "providing", "public", "relevant", "social", "support", "work".
0.300
Data sharing ↗ Q5227350 KW CROSS HIGH
academicaccessagenciesalonearchivearchivedcodecommunicationcommunityconfidentialitydatadevelopmentestablishedfundinggoverninggovernmentshistoryidentifiedincreasinglyinformation
SHARED TOKENS (45): "academic", "access", "agencies", "alone", "archive", "archived", "code", "communication", "community", "confidentiality", "data", "development", "established", "funding", "governing", "governments", "history", "identified", "increasingly", "information"....
0.300
administeredaloneamonganotherchildcriminaldefinitiondifferenteducationindividualsintendedinvolvingjusticelegalmedicalprofessionalprogramprogramssystem
SHARED TOKENS (19): "administered", "alone", "among", "another", "child", "criminal", "definition", "different", "education", "individuals", "intended", "involving", "justice", "legal", "medical", "professional", "program", "programs", "system".
0.300
activeaddressedassistancecontinuouscontroldistinctdrinkingexperiencefreegoverninggrouphealthcareinstitutionslaterliteraturemeetingmembersmenneedopen
SHARED TOKENS (29): "active", "addressed", "assistance", "continuous", "control", "distinct", "drinking", "experience", "free", "governing", "group", "healthcare", "institutions", "later", "literature", "meeting", "members", "men", "need", "open"....
0.300
Faith healing ↗ Q1420463 KW CROSS HIGH
adultsamongbodycarechildrenclaimsclassifieddeathdisabilityevenevidencefaithhealthhistoryincreasedmedicalmultipleparentspercentpractice
SHARED TOKENS (25): "adults", "among", "body", "care", "children", "claims", "classified", "death", "disability", "even", "evidence", "faith", "health", "history", "increased", "medical", "multiple", "parents", "percent", "practice"....
0.300
acquireactivitiescommunicationcommunitiescommunitydesignededucationexpandingformgroupshealthindividualsinfluenceinformationinvolvingknowledgelifenationalopportunitiesopportunity
SHARED TOKENS (30): "acquire", "activities", "communication", "communities", "community", "designed", "education", "expanding", "form", "groups", "health", "individuals", "influence", "information", "involving", "knowledge", "life", "national", "opportunities", "opportunity"....
0.300
activitiesaddressesaddressingamongannualaprilaroundassociationbodiesbuiltcommunitiescommunityconsolidatedcorrespondingcountiesdeathdecemberdirectestablishedestablishing
SHARED TOKENS (35): "activities", "addresses", "addressing", "among", "annual", "april", "around", "association", "bodies", "built", "communities", "community", "consolidated", "corresponding", "counties", "death", "december", "direct", "established", "establishing"....
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
associationcaseclassificationclinicalcommunityconditionscontrolemploymenthealthhistoricalhistoryindustryinfluenceinstituteinternationalmattersmedicalmentalnationaloccupational
SHARED TOKENS (32): "association", "case", "classification", "clinical", "community", "conditions", "control", "employment", "health", "historical", "history", "industry", "influence", "institute", "international", "matters", "medical", "mental", "national", "occupational"....
🫐 BERRY48 edges
0.280
agenciesannouncedfoundedhousedinternationalleadershiplocalnationalnetworkofficeorganizationorganizationssocialuniversity
SHARED TOKENS (14): "agencies", "announced", "founded", "housed", "international", "leadership", "local", "national", "network", "office", "organization", "organizations", "social", "university".
0.280
administeredavailabilitycriminaldifferdifferentenforcementformintendedjusticelawoperationsprogramsystemsystems
SHARED TOKENS (14): "administered", "availability", "criminal", "differ", "different", "enforcement", "form", "intended", "justice", "law", "operations", "program", "system", "systems".
0.280
alonecategorygrouphomelessnessincreasedindividualsitselfmakingmentalneedspeopleprimaryproblemssingle
SHARED TOKENS (14): "alone", "category", "group", "homelessness", "increased", "individuals", "itself", "making", "mental", "needs", "people", "primary", "problems", "single".
0.280
Parole ↗ Q5357120 KW CROSS HIGH
behavioralcomplianceconditionsformofficersoutsidepaperpeopleplaceratherservingsupervisedsupervisionsystem
SHARED TOKENS (14): "behavioral", "compliance", "conditions", "form", "officers", "outside", "paper", "people", "place", "rather", "serving", "supervised", "supervision", "system".
0.280
conditionsenvironmentfacilitieshomeshousehouseshousinglivingpeopleprogramprogramssafesocietystructured
SHARED TOKENS (14): "conditions", "environment", "facilities", "homes", "house", "houses", "housing", "living", "people", "program", "programs", "safe", "society", "structured".
0.280
categoriescommunitiescountryestablishedexpandedhistoryidentifyidentitylatermajororganizationspeoplepracticespractitioners
SHARED TOKENS (14): "categories", "communities", "country", "established", "expanded", "history", "identify", "identity", "later", "major", "organizations", "people", "practices", "practitioners".
0.280
Missionary ↗ Q219477 KW CROSS HIGH
actcaredevelopmenteducationfaithgrouphealthjusticemembersmissionpeoplesocialsocietythem
SHARED TOKENS (14): "act", "care", "development", "education", "faith", "group", "health", "justice", "members", "mission", "people", "social", "society", "them".
0.260
activitycommunitieseasternfoundedhistoryindependentinstitutionsmembersnationalprimaryregionrolesmaller
SHARED TOKENS (13): "activity", "communities", "eastern", "founded", "history", "independent", "institutions", "members", "national", "primary", "region", "role", "smaller".
0.260
currenteasternmembers
SHARED TOKENS (3): "current", "eastern", "members". | EXACT TITLE in faith_religious: "Greek Orthodox Archdiocese of America".
0.260
Megachurch ↗ Q781549 KW CROSS HIGH
activeactivitiesarchitecturebuildingeducationalestablishedevenexpandedformerorganizationpeoplesocialweek
SHARED TOKENS (13): "active", "activities", "architecture", "building", "educational", "established", "even", "expanded", "former", "organization", "people", "social", "week".
0.260
crisisspecificstabilization
SHARED TOKENS (3): "crisis", "specific", "stabilization". | EXACT TITLE in substance_use_recovery: "Crisis intervention".
0.260
curriculumoperationsschool
SHARED TOKENS (3): "curriculum", "operations", "school". | EXACT TITLE in faith_religious: "Religious school".
0.260
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidaho
SHARED TOKENS (3): "approximately", "boise", "idaho". | EXACT TITLE in faith_religious: "Boise River".
0.240
aroundassociationbeyondconsolidationcontemporarycurrenteducationfaithgroupidentifyinternationalmembers
SHARED TOKENS (12): "around", "association", "beyond", "consolidation", "contemporary", "current", "education", "faith", "group", "identify", "international", "members".
0.240
Hydrocodone ↗ Q411441 KW CROSS HIGH
amongclassifieddevelopedeffectsformitselfmedicalrequireresultsoldsupplywork
SHARED TOKENS (12): "among", "classified", "developed", "effects", "form", "itself", "medical", "require", "result", "sold", "supply", "work".
0.240
associationcommunitiescontemporaryestablishedexpansionfoundedgovernedindependentlargestmedianetworksspecific
SHARED TOKENS (12): "association", "communities", "contemporary", "established", "expansion", "founded", "governed", "independent", "largest", "media", "networks", "specific".
0.240
carecoordinationhealthmedicalneedspatientpracticepractitionerprovidertrainedtrainingtreatment
SHARED TOKENS (12): "care", "coordination", "health", "medical", "needs", "patient", "practice", "practitioner", "provider", "trained", "training", "treatment".
0.240
applicationbecomecommunicationcoveragemediapeopleplatformsprofessionalrealsitessocialusers
SHARED TOKENS (12): "application", "become", "communication", "coverage", "media", "people", "platforms", "professional", "real", "sites", "social", "users".
0.220
aroundbecomecountryhomeindividualsintegrationlocaloutsidepeoplerefugeethem
SHARED TOKENS (11): "around", "become", "country", "home", "individuals", "integration", "local", "outside", "people", "refugee", "them".
0.220
idahoremains
SHARED TOKENS (2): "idaho", "remains". | EXACT TITLE in faith_religious: "Moses Alexander".
0.220
becomeexpansionhistoricalhistoryidentitymedianationalpurchaseregionsettlementspecifically
SHARED TOKENS (11): "become", "expansion", "historical", "history", "identity", "media", "national", "purchase", "region", "settlement", "specifically".
0.220
largestmembers
SHARED TOKENS (2): "largest", "members". | EXACT TITLE in faith_religious: "Church of the Nazarene".
0.220
Oxycodone ↗ Q407535 KW CROSS HIGH
amongeffecteffectsformhealthhourslaterorganizationroughlysoldtreatment
SHARED TOKENS (11): "among", "effect", "effects", "form", "health", "hours", "later", "organization", "roughly", "sold", "treatment".
0.200
term
EXACT TITLE in substance_use_recovery: "Rehabilitation".
0.200
Volunteering ↗ Q188844 KW CROSS HIGH
actcommunityeducationemergencygrouplaborresponsespecializedtrainingwork
SHARED TOKENS (10): "act", "community", "education", "emergency", "group", "labor", "response", "specialized", "training", "work".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahometropolitanpopulationschoolschools
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "house", "idaho", "metropolitan", "population", "school", "schools".
0.200
becomedesigneddistinctfamilyinfluenceinformationprimaryprocessreferralsubsequent
SHARED TOKENS (10): "become", "designed", "distinct", "family", "influence", "information", "primary", "process", "referral", "subsequent".
0.180
activeadultschildrengeneralmembersofficialpagerecordrecords
SHARED TOKENS (9): "active", "adults", "children", "general", "members", "official", "page", "record", "records".
0.180
Sales tax ↗ Q11055488 KW CROSS HIGH
bodyconsumerdirectlyeducationfoodgoverningpaidpurchaserelated
SHARED TOKENS (9): "body", "consumer", "directly", "education", "food", "governing", "paid", "purchase", "related".
0.180
Cemetery ↗ Q39614 KW CROSS HIGH
anotherdifferpeopleplacepracticesprincipalremainsspacespecifically
SHARED TOKENS (9): "another", "differ", "people", "place", "practices", "principal", "remains", "space", "specifically".
0.160
criminaljusticeplacereformrightsstatedsystemsystems
SHARED TOKENS (8): "criminal", "justice", "place", "reform", "rights", "stated", "system", "systems".
0.160
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.140
Cannabis ↗ Q79817 KW CROSS HIGH
familyhistorylevelsprincipalproducerecognizedsingle
SHARED TOKENS (7): "family", "history", "levels", "principal", "produce", "recognized", "single".
0.120
Kuna, Idaho ↗ KW CROSS HIGH
adaboiseidahometropolitanpercentpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "metropolitan", "percent", "population".
0.120
carecomprehensivehospitalpatientsrequireswhose
SHARED TOKENS (6): "care", "comprehensive", "hospital", "patients", "requires", "whose".
0.120
causeeffectspathwaysrapidreducedtherapy
SHARED TOKENS (6): "cause", "effects", "pathways", "rapid", "reduced", "therapy".
0.120
Recidivism ↗ Q1420643 KW CROSS HIGH
actcriminalformerfrequentlymodeltrained
SHARED TOKENS (6): "act", "criminal", "former", "frequently", "model", "trained".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
agedegreedisabilityearlieremploymentpattern
SHARED TOKENS (6): "age", "degree", "disability", "earlier", "employment", "pattern".
0.100
categorycontemporarymedianewsprograms
SHARED TOKENS (5): "category", "contemporary", "media", "news", "programs".
0.100
activityhistoryhumanidahosocial
SHARED TOKENS (5): "activity", "history", "human", "idaho", "social".
0.100
programprovidingrisksocialusers
SHARED TOKENS (5): "program", "providing", "risk", "social", "users".
0.100
applicabledistrictpermituseszoning
SHARED TOKENS (5): "applicable", "district", "permit", "uses", "zoning".
0.100
Drug overdose ↗ Q3505252 KW CROSS HIGH
applicationdeathhealthresultrisk
SHARED TOKENS (5): "application", "death", "health", "result", "risk".
0.100
activitybehavioralconsistentforminvolving
SHARED TOKENS (5): "activity", "behavioral", "consistent", "form", "involving".
0.100
controleffectinfluencemultipleoperating
SHARED TOKENS (5): "control", "effect", "influence", "multiple", "operating".
0.100
amongbuildingbuildingsbuiltdesigned
SHARED TOKENS (5): "among", "building", "buildings", "built", "designed".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseeagleidahopopulation
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
◈ Frequently Asked Questions
Faith Religious × Substance Use Recovery — Treasure Valley
HAIKU · HIGH GATE
Which Boise-area nonprofits integrate faith-based programming into substance use recovery services?
Multiple nonprofit organizations across Ada County operate recovery programs that incorporate religious counseling and faith community support alongside clinical treatment. Boise State University's School of Social Work documents partnerships between faith congregations in Nampa and Boise with substance abuse recovery agencies to serve the Treasure Valley's growing population.
How do religious organizations in the Treasure Valley support people in recovery from substance use?
Faith-based organizations in Ada County and across the Boise metropolitan area provide peer support groups, sponsor recovery housing, and connect individuals to social work services during and after treatment. These groups operate as nonprofits and receive both private and public funding to expand accessibility across Boise and Nampa communities.
What role do telehealth services play in connecting faith communities to substance use recovery resources in the Treasure Valley?
Telehealth platforms developed by Boise-area nonprofits enable rural and underserved Treasure Valley residents to access religious counseling and recovery support from licensed social workers without traveling to Boise or Nampa. Ada County social service agencies increasingly use telehealth to link faith organizations with evidence-based substance use treatment providers across the metropolitan region.
How does affordable housing connect to faith-based substance use recovery programs in the Boise area?
Religious nonprofits operating in Ada County and the greater Boise metropolitan area partner with affordable housing developers to provide stable residential environments essential to recovery stability. Social work professionals and faith leaders in Nampa and Boise recognize that housing insecurity directly undermines substance use recovery success rates across the local population.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Faith Religious × Substance Use Recovery 18 QID bridges 260 edges 7,157 ext links 2026-07-17 20:50:26 UTC 1c883085731a7a66
Faith Religious corridor ↗ Substance Use Recovery corridor ↗ Substance Use Recovery × Faith Religious ↗ boisestandard.org/standard ↗
Parent Corridors
Faith Religious × All Other Verticals