—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Employment Workforce ↔ relates to ↔ Data Center

11 Wikipedia bridge articles confirmed in both vertical ledgers. 195 deterministic cross-vertical edges. 5,361 external source links harvested. Every edge provenance-stamped. Every claim auditable.

11 QID Bridge Articles
195 Cross Edges
5,361 External Sources
228 Wikipedia Articles
9 🌲 Evergreen
127 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Employment Workforce
× Data Center
QID Bridge Articles
11
confirmed Wikipedia overlap
Total Cross Edges
195
External Sources Harvested
5,361
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Treasure Valley
score: 0.9600  ·  type: exact_title_cross  ·  13 shared tokens
QID Bridge Titles (11)
Treasure ValleyMicron TechnologyIdaho PowerNampa, IdahoComputer securityBoise, IdahoGarden City, IdahoAda County, IdahoKuna, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboiseadanametechnologycapitallocaltreasurevalleywesterndatamajormicronpowernampalargestagriculturalcommercehistoricallyland
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:32:58 UTC
Content Hash
3c0aacd27bc7dda3
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
11 BRIDGES
Treasure Valley
Q7836726 EXACT TITLE 0.960
QID OVERLAP: Q7836726 in employment_workforce (tier:evergreen) and data_center (tier:evergreen). | SHARED TOKENS (13): "agricultural", "boise", "commerce", "historically", "idaho", "land", "local", "name", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in employment_workforce: "Treasure Valley". | EXACT TITLE in data_center: "Treasure Valley".
agriculturalboisecommercehistoricallyidaholandlocalnameregionresourcestreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Micron Technology
Q1197548 EXACT TITLE 0.920
QID OVERLAP: Q1197548 in employment_workforce (tier:evergreen) and data_center (tier:branch). | SHARED TOKENS (11): "boise", "data", "demand", "idaho", "major", "manufacturers", "market", "micron", "semiconductor", "technologies", "technology". | EXACT TITLE in employment_workforce: "Micron Technology".
boisedatademandidahomajormanufacturersmarketmicronsemiconductortechnologiestechnology
actures computer memory and computer data storage products, including dynamic random-access memory (DRAM), flash memory, High Bandwidth Memory (HBM), and solid-state drives (SSDs). Founded in 1978 in Boise, Idaho, Micron is the only major American computer memory manufacturer. It is one of the "Big Three" computer memory manufacturers, along with the South Korean companies Samsung Electronics and SK Hynix. Micron marketed its consumer products under the brand Crucial, with the sub-brand Ballistix being used to denote products targeting gaming computers, until its disestablishment on 2026. Micron and Intel together created IM Flash Technologies, which produced NAND flash memory. It owned Lexar between 2006 and 2017. Sanjay Mehrotra has served as president and CEO of Micron since 2017. On May 26, 2026, Micron became the latest U.S.
n since 2017. On May 26, 2026, Micron became the latest U.S. company to reach a US$1 trillion market capitalization, amid surging demand for its HBM chips. History 1978–1999 Micron was founded in Boise, Idaho, in 1978 by Ward Parkinson, Joe Parkinson, Dennis Wilson, and Doug Pitman as a semiconductor design consulting company. Startup funding was provided by local Idaho businessmen Tom Nicholson, Allen Noble, Rudolph Nelson, and Ron Yanke. Later it received funding from Idaho billionaire J. R. Simplot, whose fortune was made in the potato business. In 1981, the company moved from consulting to manufacturing with the completion of its first wafer fabrication unit ("Fab 1"), producing 64K DRAM chips. In 1984, the company had its initial public offering. Micron sought to enter the market for RISC processors in 1991 with a product known as FRISC, targeting embedded control and signal processing applications. Running at 80 MHz and described as "a 64-bit processor with fast context-switching time and high floating-point performance", the design supported various features for timely interrupt handling and featured an arithmetic unit capable of handling both integer and floating-point calculations with a claimed throughput of 80 MFLOPS for double-precision arithmetic. Micron aimed to provide a "board-level demonstration supercomputer" in configurations with 256 MB or 1 GB of RAM. Having set up a subsidiary and with the product being designed into graphics cards and accelerators, Micron concluded in 1992 that the effort would not deliver the "best bang for the buck", reassigning engineers to other projects and discontinuing the endeavour. In 1994, founder Joe Parkinson retired as CEO and Steve Appleton took over as Chairman, President, and CEO. A 1996 3-way merger among ZEOS International, Micron Computer, and Micron Custom Manufacturing Services (MCMS) increased the size and scope of the company; this was followed rapidly with the 1997 acquisition of NetFrame Systems, in a bid to enter the mid-range server industry.
Since 2000 In 2000, Gurtej Singh Sandhu and Trung T. Doan at Micron initiated the development of atomic layer deposition high-k films for DRAM memory devices. This helped drive cost-effective implementation of semiconductor memory, starting with 90 nm node DRAM. Pitch double-patterning was also pioneered by Gurtej Singh Sandhu at Micron during the 2000s, leading to the development of 30-nm class NAND flash memory, and it has since been widely adopted by NAND flash and RAM manufacturers worldwide. In 2002, Micron spun off its personal computer business as MPC Corporation and put it up for sale. The company found the business difficult as the number 12 American computer maker with only 1.3 percent of the market. Micron and Intel created a joint venture in 2005, based in IM Flash Technologies in Lehi, Utah. The two companies formed another joint venture in 2011, IM Flash Singapore, in Singapore. In 2012 Micron became sole owner of this second joint venture. In 2006 Micron acquired Lexar, an American manufacturer of digital media products. The company changed leadership again in June 2007 with COO Mark Durcan becoming president. In 2008, Micron converted the Avezzano chip fab, formerly a Texas Instruments DRAM fab, into a production facility for CMOS image sensors sold by Aptina Imaging. In 2008, Micron spun off Aptina Imaging, which was acquired by ON Semiconductor in 2014. Micron retained a stake in the spinoff. However, the core company suffered setbacks and had to lay off 15 percent of its workforce in October 2008, during which period the company also announced the purchase of Qimonda's 35.6 percent stake in Inotera Memories for $400 million. The trend of layoffs and acquisitions continued in 2009 with the termination of an additional 2,000 employees, and the acquisition of the FLCOS microdisplay company Displaytech. Micron agreed to buy flash-chip maker Numonyx for $1.27 billion in stock in February 2010. On February 3, 2012, CEO Appleton died in a plane crash shortly after takeoff from the Boise Airport. He was the pilot and sole occupant of the Lancair IV aircraft. Mark Durcan replaced Appleton as the CEO shortly thereafter, eliminating his former title of president. In 2013, the Avezzano chip fab was sold to LFoundry. In the 2012 to 2014 period, Micron again went through an acquisition-layoff cycle, becoming the majority shareholder of Inotera Memories, purchasing Elpida Memory for $2 billion and the remaining shares in Rexchip, a PC memory chip manufacturing venture between Powerchip and Elpida Memory for $334 million, while announcing plans to lay off approximately 3,000 workers. Through the Elpida acquisition, Micron became a major supplier to Apple Inc. for the iPhone and iPad. In December 2016 Micron finished acquiring the remaining 67 percent of Inotera, making it a 100 percent subsidiary of Micron. In April 2017, Micron announced Sanjay Mehrotra as the new president and CEO to replace Mark Durcan. In June 2017 Micron announced it was discontinuing the Lexar retail removable media storage business and putting some or all of it up for sale. In August of that year the Lexar brand was acquired by Longsys, a flash memory company based in Shenzhen, China. In May 2018, Micron Technology and Intel launched QLC NAND memory to increase storage density. The company ranked 150th on the Fortune 500 list of largest United States corporations by revenue. In February 2019, the first microSD card with a storage capacity of 1 terabyte (TB) was announced by Micron. As of March 2020 3.84TB Micron 5210 Ion is the cheapest large-capacity SSD in the world. In September 2020 the company introduced the world's fastest discrete graphics memory solution. Working with computing technology leader Nvidia, Micron debuted GDDR6X in the Nvidia GeForce RTX 3090 and GeForce RTX 3080 graphics processing units (GPUs). In November 2020, the company unveiled a new 176-layer 3D NAND module. It offers improved read and write latency and is slated to be used in the production of a new generation of solid-state drives. On October 22, 2021, Micron closed the sale of IM Flash's Lehi, Utah fab to Texas Instruments for a sale price of US$900 million. In February 2022, Micron announced that it would discontinue its Ballistix gaming brand. With the passage of the CHIPS and Science Act, Micron announced its pledge to invest billions in new manufacturing within the United States. In September 2022, Micron announced it would invest $15 billion in a new facility in Boise, Idaho. In October 2022, Micron announced a $100 billion expansion in Clay, New York. Micron Technology owed Netlist, Inc. $445 million in damages for infringing Netlist's patents related to memory-module technology for high-performance computing. The jury found that Micron's semiconductor-memory products violated two of Netlist's patents willfully, potentially allowing the judge to triple the damages. Netlist had sued Micron in 2022, accusing three of its memory-module lines of patent infringement, which Micron denied, also arguing the patents' invalidity. The U.S.
I
Q3147780 EXACT TITLE 0.840
QID OVERLAP: Q3147780 in employment_workforce (tier:evergreen) and data_center (tier:evergreen). | SHARED TOKENS (7): "around", "business", "electrical", "idaho", "power", "purchased", "regulated". | EXACT TITLE in employment_workforce: "Idaho Power". | EXACT TITLE in data_center: "Idaho Power".
aroundbusinesselectricalidahopowerpurchasedregulated
mission and distribution of electricity in eastern Oregon and southern Idaho. It is a subsidiary of IDACORP, Inc. The company's 24,000-square-mile (62,000 km2) service area generally follows the area around the Snake River and its tributaries. Idaho Power owns and operates 17 hydroelectric dams and three natural gas power plants.
ricity sold by IPC was 36.8% hydroelectric, 15.4% natural gas, 13.0% coal, 9.8% wind, 5.4% solar, and, 2.3% geothermal, biomass & other, and 17.3% purchased from other generation companies. History Idaho Power Company originally filed for incorporation in Maine on May 6, 1915. It was reincorporated in Idaho as a subsidiary of IDACORP, Inc on October 1, 1998. This was followed by the purchase of the assets of five small southern Idaho power companies: Idaho-Oregon Light & Power; Great Shoshone and Twin Falls Water Power; Idaho Railway, Light & Power; Idaho Power & Light; and Southern Idaho Water Power Company. In 2018 Idaho Power sponsored the annual "Drive Electric Week" car show event at the state capitol. At the show people can learn about electric vehicles. Interest in electric vehicles has increased because of changing gas prices, improvements in battery technology, concerns for the environment and federal tax incentives for buying electric vehicles. To respond to customer interest, Idaho Power added tools to its website to guide customers investigating purchasing an electric vehicle. In 2019, Idaho Power set a goal to provide 100-percent clean energy by 2045. In addition to its hydropower facilities, which typically meet almost half its customers’ energy demands, Idaho Power plans additional investments in wind, solar and other clean sources. Clean energy resources are becoming more affordable, which could help Idaho Power accomplish its goal while keeping prices fair. Grid upgrades and battery-storage technology should help maintain Idaho Power's impressive reliability while moving the company closer to its goal. Continued energy efficiency efforts will help. Clean energy initiatives are not new to Idaho Power. In 2009, the company adopted a resolution to reduce carbon emissions. Idaho Power has reduced its carbon emissions intensity — measured in pounds of carbon dioxide (CO2) per megawatt-hour — by almost 50 percent since 2005.
3% geothermal, biomass & other, and 17.3% purchased from other generation companies. History Idaho Power Company originally filed for incorporation in Maine on May 6, 1915. It was reincorporated in Idaho as a subsidiary of IDACORP, Inc on October 1, 1998. This was followed by the purchase of the assets of five small southern Idaho power companies: Idaho-Oregon Light & Power; Great Shoshone and Twin Falls Water Power; Idaho Railway, Light & Power; Idaho Power & Light; and Southern Idaho Water Power Company. In 2018 Idaho Power sponsored the annual "Drive Electric Week" car show event at the state capitol. At the show people can learn about electric vehicles. Interest in electric vehicles has increased because of changing gas prices, improvements in battery technology, concerns for the environment and federal tax incentives for buying electric vehicles. To respond to customer interest, Idaho Power added tools to its website to guide customers investigating purchasing an electric vehicle. In 2019, Idaho Power set a goal to provide 100-percent clean energy by 2045. In addition to its hydropower facilities, which typically meet almost half its customers’ energy demands, Idaho Power plans additional investments in wind, solar and other clean sources. Clean energy resources are becoming more affordable, which could help Idaho Power accomplish its goal while keeping prices fair. Grid upgrades and battery-storage technology should help maintain Idaho Power's impressive reliability while moving the company closer to its goal. Continued energy efficiency efforts will help. Clean energy initiatives are not new to Idaho Power. In 2009, the company adopted a resolution to reduce carbon emissions. Idaho Power has reduced its carbon emissions intensity — measured in pounds of carbon dioxide (CO2) per megawatt-hour — by almost 50 percent since 2005.
Nampa, Idaho
Q622633 QID OVERLAP 0.810
QID OVERLAP: Q622633 in employment_workforce (tier:evergreen) and data_center (tier:branch). | SHARED TOKENS (8): "according", "boise", "idaho", "meaning", "name", "nampa", "west", "western". | URL->A (1): http://www.nampa.com/.
accordingboiseidahomeaningnamenampawestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Computer security
Q3510521 QID OVERLAP 0.800
QID OVERLAP: Q3510521 in employment_workforce (tier:branch) and data_center (tier:branch). | SHARED TOKENS (17): "becomes", "cybersecurity", "data", "digital", "expanded", "finance", "information", "infrastructure", "network", "networks", "physical", "power", "provide", "software", "systems", "technology", "therefore".
becomescybersecuritydatadigitalexpandedfinanceinformationinfrastructurenetworknetworksphysicalpowerprovidesoftwaresystemstechnologytherefore
work standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
Computer security (also cybersecurity, digital security, or information technology (IT) security) is a subdiscipline within the field of information security. It focuses on protecting computer software, systems, and networks from threats that can lead to unauthorized information disclosure, theft, or damage to hardware, software, or data, as well as to the disruption or misdirection of the services they provide. The growing significance of computer security reflects the increasing dependence on computer systems, the Internet, and evolving wireless network standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
IP address spoofing is where the attacker hijacks routing protocols to reroute the targets traffic to a vulnerable network node for traffic interception or injection. Message spoofing (via email, SMS or OTT messaging) is where the attacker spoofs the identity or carrier service while the target is using messaging protocols like email, SMS or OTT (IP-based) messaging apps. The attacker can then monitor conversations, launch social attacks or trigger zero-day-vulnerabilities to allow for further attacks. WiFi SSID spoofing is where the attacker simulates a Wi-Fi base station SSID to capture and modify internet traffic and transactions. The attacker can also use local network addressing and reduced network defenses to penetrate the target's firewall by breaching known vulnerabilities. Sometimes known as a Pineapple attack thanks to a popular device. See also Malicious association. DNS spoofing is where attackers hijack domain name assignments to redirect traffic to systems under the attackers' control, in order to surveil traffic or launch other attacks. SSL hijacking, typically coupled with another media-level MITM attack, is where the attacker spoofs the SSL authentication and encryption protocol by way of Certificate Authority injection in order to decrypt, surveil and modify traffic. See also TLS interception Multi-vector, polymorphic attacks Surfacing in 2017, a new class of multi-vector, polymorphic cyber threats combine several types of attacks and change form to avoid cybersecurity controls as they spread. Multi-vector polymorphic attacks, as the name describes, are both multi-vectored and polymorphic. Firstly, they are a singular attack that involves multiple methods of attack. In this sense, they are "multi-vectored" (i.e. the attack can use multiple means of propagation such as via the Web, email and applications).
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in employment_workforce (tier:branch) and data_center (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "capital", "downtown", "idaho", "major", "manufacturing", "micron", "technology", "treasure", "valley".
adaannualboisecapitaldowntownidahomajormanufacturingmicrontechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Garden City, Idaho
Q1516892 QID OVERLAP 0.680
QID OVERLAP: Q1516892 in employment_workforce (tier:evergreen) and data_center (tier:branch). | SHARED TOKENS (9): "ada", "boise", "government", "idaho", "main", "municipal", "name", "separate", "street".
adaboisegovernmentidahomainmunicipalnameseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Ada County, Idaho
Q109820 QID OVERLAP 0.640
QID OVERLAP: Q109820 in employment_workforce (tier:branch) and data_center (tier:evergreen). | SHARED TOKENS (7): "ada", "boise", "capital", "idaho", "largest", "local", "private".
adaboisecapitalidaholargestlocalprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Kuna, Idaho
QID OVERLAP 0.620
QID OVERLAP: Q1515177 in employment_workforce (tier:branch) and data_center (tier:branch). | SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "kuna", "percent".
adaadditionalboiseidahokunapercent
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.580
QID OVERLAP: Q486078 in employment_workforce (tier:branch) and data_center (tier:branch). | SHARED TOKENS (4): "boise", "idaho", "largest", "nampa".
boiseidaholargestnampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.580
QID OVERLAP: Q1085274 in employment_workforce (tier:branch) and data_center (tier:branch). | SHARED TOKENS (4): "ada", "boise", "capital", "idaho".
adaboisecapitalidaho
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
184 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP184 edges
🌿 BRANCH125 edges
0.570
activityboisebusinesseducationidahomillionprogramprogramspublicschoolwest
SHARED TOKENS (11): "activity", "boise", "business", "education", "idaho", "million", "program", "programs", "public", "school", "west". | URL->A (1): https://boisestate.edu/. | EXACT TITLE in employment_workforce: "Boise State University".
0.530
commercecommissiondecisionsestablishedidahoindustrialinsurancelaborsystem
SHARED TOKENS (9): "commerce", "commission", "decisions", "established", "idaho", "industrial", "insurance", "labor", "system". | URL->A (1): https://iic.idaho.gov/. | EXACT TITLE in employment_workforce: "Idaho Industrial Commission".
0.510
benefitsdevelopmenteconomicidahoinsurancelabortechnologyworkforce
SHARED TOKENS (8): "benefits", "development", "economic", "idaho", "insurance", "labor", "technology", "workforce". | URL->A (1): https://www.labor.idaho.gov/. | EXACT TITLE in employment_workforce: "Idaho Department of Labor".
0.500
Meta Platforms ↗ Q380 EXACT TITLE
businessdescribeddevelopmentdigitalestablishedgloballargestmarketnetworkpercentpublicshiftsocialtechnologiestechnologytoward
SHARED TOKENS (16): "business", "described", "development", "digital", "established", "global", "largest", "market", "network", "percent", "public", "shift", "social", "technologies", "technology", "toward". | EXACT TITLE in data_center: "Meta Platforms".
0.500
aroundassetassociatedbenefitsbuildingbuiltconstructiondesigndevelopmenteconomicendfacilitiesglobalindustrialindustriesindustryinfrastructurepercentplanningwork
SHARED TOKENS (20): "around", "asset", "associated", "benefits", "building", "built", "construction", "design", "development", "economic", "end", "facilities", "global", "industrial", "industries", "industry", "infrastructure", "percent", "planning", "work". | EXACT TITLE in employment_workforce: "Construction". | EXACT TITLE in data_center: "Construction".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalapproximatelyaroundassociatedboisecapitaldistinctidahoindustriesisolatedlandlargestmanufacturingmillionnationalorganizedseparatetechnologywestwestern
SHARED TOKENS (20): "agricultural", "approximately", "around", "associated", "boise", "capital", "distinct", "idaho", "industries", "isolated", "land", "largest", "manufacturing", "million", "national", "organized", "separate", "technology", "west", "western". | EXACT TITLE in employment_workforce: "Idaho". | EXACT TITLE in data_center: "Idaho".
0.500
AFL-CIO ↗ Q464271 EXACT TITLE
activeapproximatelycentercentralchangecommercialindustriallaborlargelargestlocalmillionmunicipalnationalorganizationspoliciesrepresentedsupportwork
SHARED TOKENS (19): "active", "approximately", "center", "central", "change", "commercial", "industrial", "labor", "large", "largest", "local", "million", "municipal", "national", "organizations", "policies", "represented", "support", "work". | EXACT TITLE in employment_workforce: "AFL-CIO".
0.500
accountinganotherbenefitscasecontractsdevelopmentdifferentemploymentfirmglobalincreasinglyindividualinsurancejobslaborlimitedmarketneedneedsorganizations
SHARED TOKENS (29): "accounting", "another", "benefits", "case", "contracts", "development", "different", "employment", "firm", "global", "increasingly", "individual", "insurance", "jobs", "labor", "limited", "market", "need", "needs", "organizations".... | EXACT TITLE in employment_workforce: "Temporary work".
0.500
analysisapplicationbroaderbusinessesdescribedeconomicexperiencegovernmentinstitutionsorganizationspoliciespolicyprivateproblemsprocurementproduceprogramsprovidepublicrelationships
SHARED TOKENS (25): "analysis", "application", "broader", "businesses", "described", "economic", "experience", "government", "institutions", "organizations", "policies", "policy", "private", "problems", "procurement", "produce", "programs", "provide", "public", "relationships".... | EXACT TITLE in employment_workforce: "Public administration".
0.500
Commuting ↗ Q48442 EXACT TITLE
airallowingaroundcontinuedifferentenvironmentalevenincreasinglyinfrastructurelargemunicipalnationalphysicalratherremainremotesmallertechnologythemtransit
SHARED TOKENS (23): "air", "allowing", "around", "continue", "different", "environmental", "even", "increasingly", "infrastructure", "large", "municipal", "national", "physical", "rather", "remain", "remote", "smaller", "technology", "them", "transit".... | EXACT TITLE in employment_workforce: "Commuting".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingcasedevelopmentdifferentgovernmentgovernmentsgrowthindustriallandland-uselocalplanningpolicyregulatoryscaleshapesinglesystemszoning
SHARED TOKENS (20): "allowing", "building", "case", "development", "different", "government", "governments", "growth", "industrial", "land", "land-use", "local", "planning", "policy", "regulatory", "scale", "shape", "single", "systems", "zoning". | EXACT TITLE in employment_workforce: "Zoning". | EXACT TITLE in data_center: "Zoning".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
accessalreadyapproximatelyaroundbecomebeyondbusinesscapitalconnectionscreatedesigndevelopmentexpandedfirmshandlinginformationlargestlistingsmillionnetwork
SHARED TOKENS (29): "access", "already", "approximately", "around", "become", "beyond", "business", "capital", "connections", "create", "design", "development", "expanded", "firms", "handling", "information", "largest", "listings", "million", "network".... | EXACT TITLE in employment_workforce: "LinkedIn".
0.500
beyonddevelopmenteducationendgoalhelpinstitutionsknowledgelargemultipleneedsorganizationsorganizedrelatedreporttechnologytraditionaltrainingwork
SHARED TOKENS (19): "beyond", "development", "education", "end", "goal", "help", "institutions", "knowledge", "large", "multiple", "needs", "organizations", "organized", "related", "report", "technology", "traditional", "training", "work". | EXACT TITLE in employment_workforce: "Adult education".
0.500
airalreadybecomebenefitscapacitychangecompetitivecurrentenergyenvironmentalevenexpansionfinancialglobalincreaselandlargelocalmainmajor
SHARED TOKENS (37): "air", "already", "become", "benefits", "capacity", "change", "competitive", "current", "energy", "environmental", "even", "expansion", "financial", "global", "increase", "land", "large", "local", "main", "major".... | EXACT TITLE in data_center: "Renewable energy".
0.500
Yelp ↗ Q2299611 EXACT TITLE
annualapproximatelybecomebusinessbusinessescomdirectoryexpandedinformationlatermarchmilliononlinepublicsitesourcessystem
SHARED TOKENS (17): "annual", "approximately", "become", "business", "businesses", "com", "directory", "expanded", "information", "later", "march", "million", "online", "public", "site", "sources", "system". | EXACT TITLE in employment_workforce: "Yelp".
0.500
agreementbenefitsbusinesseschangesconditionsemploymenthigherhoursrepresentedreturnrightssingletrainingworkworking
SHARED TOKENS (15): "agreement", "benefits", "businesses", "changes", "conditions", "employment", "higher", "hours", "represented", "return", "rights", "single", "training", "work", "working". | EXACT TITLE in employment_workforce: "Collective bargaining".
0.500
activediversityeducationhelphigherindustrynationalneedneedsparticipationplanningpoliciespolicyprofessionalprogramsprovidesecuresystemswork
SHARED TOKENS (19): "active", "diversity", "education", "help", "higher", "industry", "national", "need", "needs", "participation", "planning", "policies", "policy", "professional", "programs", "provide", "secure", "systems", "work". | EXACT TITLE in employment_workforce: "Work-based learning".
0.500
accordingairbecomeschangechangescompetitiveeffectsgrowthhistoryincreasesknowledgelimitedmeaningregionriskthereforewater
SHARED TOKENS (17): "according", "air", "becomes", "change", "changes", "competitive", "effects", "growth", "history", "increases", "knowledge", "limited", "meaning", "region", "risk", "therefore", "water". | EXACT TITLE in data_center: "Critical load".
0.500
applicationbusinesscreatedataestablishedindustriesinformationlimitednamenetworksoperatedplanningprogramsprojectprojectsrequirerolesinglesoftwaresupporting
SHARED TOKENS (24): "application", "business", "create", "data", "established", "industries", "information", "limited", "name", "networks", "operated", "planning", "programs", "project", "projects", "require", "role", "single", "software", "supporting".... | EXACT TITLE in employment_workforce: "Information technology".
0.500
accessalreadybusinessescapacitychangesdevelopmentearliereconomiceducationgovernmenthistoricallyhistoryincreaseindustryjobsmatchingneedneedsnetworkproblems
SHARED TOKENS (34): "access", "already", "businesses", "capacity", "changes", "development", "earlier", "economic", "education", "government", "historically", "history", "increase", "industry", "jobs", "matching", "need", "needs", "network", "problems".... | EXACT TITLE in employment_workforce: "Workforce development".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralchangecommercialconnecteddifferentelectricelectricalenergyindustrialinfrastructurelargelowoperatedpowerreceivingremotesmallersupplysystem
SHARED TOKENS (20): "approximately", "central", "change", "commercial", "connected", "different", "electric", "electrical", "energy", "industrial", "infrastructure", "large", "low", "operated", "power", "receiving", "remote", "smaller", "supply", "system". | EXACT TITLE in data_center: "Substation".
0.500
accordingdescribesdevelopmenteconomicgrowthhistoricallyincreasesincreasinglyindividualinfrastructurelocalmarketpoliciespolicyregionsocialwest
SHARED TOKENS (17): "according", "describes", "development", "economic", "growth", "historically", "increases", "increasingly", "individual", "infrastructure", "local", "market", "policies", "policy", "region", "social", "west". | EXACT TITLE in data_center: "Economic development".
0.500
Wells Fargo ↗ Q744149 EXACT TITLE
accordingadditionalapprovedassetbasebusinessexistingfinancialinternalinvestmentlargestmainmajormarchmarketmillionnamenationalofficeoffices
SHARED TOKENS (24): "according", "additional", "approved", "asset", "base", "business", "existing", "financial", "internal", "investment", "largest", "main", "major", "march", "market", "million", "name", "national", "office", "offices".... | EXACT TITLE in employment_workforce: "Wells Fargo".
0.500
buildbusinessconstructioneducationfinancegovernmentlawlogisticsmanufacturingprogramssoftwaretechnicaltechnologytoolsworkforce
SHARED TOKENS (15): "build", "business", "construction", "education", "finance", "government", "law", "logistics", "manufacturing", "programs", "software", "technical", "technology", "tools", "workforce". | EXACT TITLE in employment_workforce: "Career and technical education".
0.500
beyonddevelopmentdifferenteconomiceducationgovernmentintegratedintendedonlineprofessionalprogramsratherschoolseparateshapesupporttraditionaltrainingtypeworkforce
SHARED TOKENS (20): "beyond", "development", "different", "economic", "education", "government", "integrated", "intended", "online", "professional", "programs", "rather", "school", "separate", "shape", "support", "traditional", "training", "type", "workforce". | EXACT TITLE in employment_workforce: "Continuing education".
0.500
businessesconditionscoordinationcurrentdataeconomicgovernmentgovernmentslaborlocalmaintainmajorneedofficepublicrelevancesocialsystem
SHARED TOKENS (18): "businesses", "conditions", "coordination", "current", "data", "economic", "government", "governments", "labor", "local", "maintain", "major", "need", "office", "public", "relevance", "social", "system". | EXACT TITLE in employment_workforce: "Bureau of Labor Statistics".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherfacilityinformationlogisticsmodelneedsoperationalphysicalplanningpointproblemsprofessionalprovidepublicrelatedresourcessoftwaresupplytransportation
SHARED TOKENS (22): "according", "another", "facility", "information", "logistics", "model", "needs", "operational", "physical", "planning", "point", "problems", "professional", "provide", "public", "related", "resources", "software", "supply", "transportation".... | EXACT TITLE in employment_workforce: "Logistics". | EXACT TITLE in data_center: "Logistics".
0.500
accessadvantagesanotheraroundassociatedcontrolsdowntownenvironmentalevenlargelivenetworkofficeofficesratherremotescaleshiftsocialsoftware
SHARED TOKENS (26): "access", "advantages", "another", "around", "associated", "controls", "downtown", "environmental", "even", "large", "live", "network", "office", "offices", "rather", "remote", "scale", "shift", "social", "software".... | EXACT TITLE in employment_workforce: "Remote work".
0.500
advancedanalysisarchitectureartificialassociatedbecomecreatecreationeffectsgrowthhistoryintelligenceknowledgelong-termmultiplenetworksoperationsplanningsoftwarespace
SHARED TOKENS (23): "advanced", "analysis", "architecture", "artificial", "associated", "become", "create", "creation", "effects", "growth", "history", "intelligence", "knowledge", "long-term", "multiple", "networks", "operations", "planning", "software", "space".... | EXACT TITLE in employment_workforce: "Artificial intelligence". | EXACT TITLE in data_center: "Artificial intelligence".
0.500
Child care ↗ Q1455871 EXACT TITLE
accessadvancedanotherbenefitscentersdevelopmenteconomiceducationfacilityhousinginstitutionslaborlong-termoptionsorganizationsprofessionalprogramprovideproviderproviders
SHARED TOKENS (26): "access", "advanced", "another", "benefits", "centers", "development", "economic", "education", "facility", "housing", "institutions", "labor", "long-term", "options", "organizations", "professional", "program", "provide", "provider", "providers".... | EXACT TITLE in employment_workforce: "Child care".
0.500
accessairallowingcompetitivecontractingcoordinationcorridorsdevelopmenteconomicestatefinancialglobalgovernmenthigherindustryinfrastructureintegratedintendedinvestmentlocal
SHARED TOKENS (43): "access", "air", "allowing", "competitive", "contracting", "coordination", "corridors", "development", "economic", "estate", "financial", "global", "government", "higher", "industry", "infrastructure", "integrated", "intended", "investment", "local".... | EXACT TITLE in employment_workforce: "Public transport".
0.500
agriculturalbroaderbusinessbusinessescapitalcasecreationeconomicgoalgrowthindustrylaborlandlimitedmarketneedsoperateoperationsprimaryrelated
SHARED TOKENS (24): "agricultural", "broader", "business", "businesses", "capital", "case", "creation", "economic", "goal", "growth", "industry", "labor", "land", "limited", "market", "needs", "operate", "operations", "primary", "related".... | EXACT TITLE in employment_workforce: "Agribusiness".
0.500
Internship ↗ Q6500754 EXACT TITLE
allowingalreadybuildbusinessescurrentemploymenteventexperiencegovernmentindustryinterpretationinvestmentlargelimitednetworkorganizationsprofessionalprogramsproviderelevant
SHARED TOKENS (27): "allowing", "already", "build", "businesses", "current", "employment", "event", "experience", "government", "industry", "interpretation", "investment", "large", "limited", "network", "organizations", "professional", "programs", "provide", "relevant".... | EXACT TITLE in employment_workforce: "Internship".
0.500
LEED ↗ Q1521623 EXACT TITLE
anotherbuildingcenterscertificationchangeconstructiondescribeddesignenergyenvironmentalexpandingfinalframeworkgovernmentshealthcarehelphigherincentivesindustrylocal
SHARED TOKENS (38): "another", "building", "centers", "certification", "change", "construction", "described", "design", "energy", "environmental", "expanding", "final", "framework", "governments", "healthcare", "help", "higher", "incentives", "industry", "local".... | EXACT TITLE in data_center: "LEED".
0.500
becomecompletioncreatesexistingexpectedexperiencegrowthindividualknowledgepracticalratherrequireretainroletoolstrainingworking
SHARED TOKENS (17): "become", "completion", "creates", "existing", "expected", "experience", "growth", "individual", "knowledge", "practical", "rather", "require", "retain", "role", "tools", "training", "working". | EXACT TITLE in employment_workforce: "On-the-job training".
0.500
Nursing ↗ Q121176 EXACT TITLE
advancedcertificationdemandeducationhealthcarehelplargestplanpresenceproblemsprovidersprovidingpublicspecializedsupplysupporttraditionalworking
SHARED TOKENS (18): "advanced", "certification", "demand", "education", "healthcare", "help", "largest", "plan", "presence", "problems", "providers", "providing", "public", "specialized", "supply", "support", "traditional", "working". | EXACT TITLE in employment_workforce: "Nursing".
0.500
Franchising ↗ Q171947 EXACT TITLE
advantagesagreementanotherbusinesscapitalconditionscorporateeconomicexpansionexplicitlyfinancialgrowthindividualinvestmentlargemarketmeansmodelreturnrights
SHARED TOKENS (23): "advantages", "agreement", "another", "business", "capital", "conditions", "corporate", "economic", "expansion", "explicitly", "financial", "growth", "individual", "investment", "large", "market", "means", "model", "return", "rights".... | EXACT TITLE in employment_workforce: "Franchising".
0.500
additionaladvancedbusinessescasecertificationsemergencyfacilitiesfirehistoricallyhospitalmodeloperatepointprimaryprovideprovidingpublicremainsresourcesretain
SHARED TOKENS (27): "additional", "advanced", "businesses", "case", "certifications", "emergency", "facilities", "fire", "historically", "hospital", "model", "operate", "point", "primary", "provide", "providing", "public", "remains", "resources", "retain".... | EXACT TITLE in employment_workforce: "Emergency medical services".
0.500
adaboisedevelopmenteducationidaholargenampaprimaryprogramspublicsouthwesttechnicaltreasurevalleywesternworkforce
SHARED TOKENS (16): "ada", "boise", "development", "education", "idaho", "large", "nampa", "primary", "programs", "public", "southwest", "technical", "treasure", "valley", "western", "workforce". | EXACT TITLE in employment_workforce: "College of Western Idaho".
0.500
aroundcapitalcaseconnectiondesignedelectricelectricalemergencyenergyevenlowpowerprovidesupplysupport
SHARED TOKENS (15): "around", "capital", "case", "connection", "designed", "electric", "electrical", "emergency", "energy", "even", "low", "power", "provide", "supply", "support". | EXACT TITLE in data_center: "Diesel generator".
0.500
becomecasecentercreatesdatadesignedelectricalgoalhigherincreaseindustrymeanspowerrisksystemsystems
SHARED TOKENS (16): "become", "case", "center", "creates", "data", "designed", "electrical", "goal", "higher", "increase", "industry", "means", "power", "risk", "system", "systems". | EXACT TITLE in data_center: "Redundancy (engineering)".
0.500
Data center ↗ Q671224 EXACT TITLE
accordingalonearoundartificialassociatedbuildingcentercentersconditionsconnectiondatademanddifferentdigitaledgeelectricalendenergyenvironmentalfacilities
SHARED TOKENS (52): "according", "alone", "around", "artificial", "associated", "building", "center", "centers", "conditions", "connection", "data", "demand", "different", "digital", "edge", "electrical", "end", "energy", "environmental", "facilities".... | EXACT TITLE in data_center: "Data center".
0.500
Welding ↗ Q131172 EXACT TITLE
advancedairbasecontinuedemanddifferentdistinctelectricelectricalendenergyindustrialpressurerequiresourcesspacetechnologythem
SHARED TOKENS (18): "advanced", "air", "base", "continue", "demand", "different", "distinct", "electric", "electrical", "end", "energy", "industrial", "pressure", "require", "sources", "space", "technology", "them". | EXACT TITLE in employment_workforce: "Welding".
0.480
agreementaroundcannothealthcaremodelplansproviderproviderssmallersupporttrainingtreatmenttypework
SHARED TOKENS (14): "agreement", "around", "cannot", "healthcare", "model", "plans", "provider", "providers", "smaller", "support", "training", "treatment", "type", "work". | EXACT TITLE in employment_workforce: "Physician assistant".
0.480
Site selection ↗ EXACT TITLE
businesscorporatedataexpandedfacilitygovernmentgovernmentsnationalneedsoperationsprojectscalesitetraffic
SHARED TOKENS (14): "business", "corporate", "data", "expanded", "facility", "government", "governments", "national", "needs", "operations", "project", "scale", "site", "traffic". | EXACT TITLE in data_center: "Site selection".
0.480
Indeed ↗ Q1045367 EXACT TITLE
additionalallowingaroundbecomecentralcomemploymentfirmsjobslistinglistingsofficessinglesite
SHARED TOKENS (14): "additional", "allowing", "around", "become", "central", "com", "employment", "firms", "jobs", "listing", "listings", "offices", "single", "site". | EXACT TITLE in employment_workforce: "Indeed".
0.460
conditionseducationeffectsemploymentestablishedfirmlaborlawprovidingreduceregulatorytrainingworking
SHARED TOKENS (13): "conditions", "education", "effects", "employment", "established", "firm", "labor", "law", "providing", "reduce", "regulatory", "training", "working". | EXACT TITLE in employment_workforce: "Occupational Safety and Health Administration".
0.440
businessbusinessescommercedifferentfirmsgoalindustriesindustrylocalnetworkpolicyrather
SHARED TOKENS (12): "business", "businesses", "commerce", "different", "firms", "goal", "industries", "industry", "local", "network", "policy", "rather". | EXACT TITLE in employment_workforce: "Chamber of commerce".
0.440
associateddemandeconomicemergencygovernmenthousingincreaseslocalmarketsnationalsocialsupply
SHARED TOKENS (12): "associated", "demand", "economic", "emergency", "government", "housing", "increases", "local", "markets", "national", "social", "supply". | EXACT TITLE in employment_workforce: "Affordable housing".
0.420
approximatelyboiseestablishedidaholatermainofficesprofessionalpublicrepresentedschools
SHARED TOKENS (11): "approximately", "boise", "established", "idaho", "later", "main", "offices", "professional", "public", "represented", "schools". | EXACT TITLE in employment_workforce: "University of Idaho".
0.400
advancedconnectsgoalindustrylabormeetneedsorganizationsprogramprovide
SHARED TOKENS (10): "advanced", "connects", "goal", "industry", "labor", "meet", "needs", "organizations", "program", "provide". | EXACT TITLE in employment_workforce: "Registered apprenticeship".
0.400
adaboiseidaholargestmainmetronampapercenttreasurevalley
SHARED TOKENS (10): "ada", "boise", "idaho", "largest", "main", "metro", "nampa", "percent", "treasure", "valley". | EXACT TITLE in employment_workforce: "Boise metropolitan area".
0.400
airanothercasedesignexpandingexpectedincreaseslawmovethem
SHARED TOKENS (10): "air", "another", "case", "design", "expanding", "expected", "increases", "law", "move", "them". | EXACT TITLE in data_center: "Air cooling".
0.380
conditionsgoalgovernmentlaborlawmainnationalprivateprovide
SHARED TOKENS (9): "conditions", "goal", "government", "labor", "law", "main", "national", "private", "provide". | EXACT TITLE in employment_workforce: "Occupational Safety and Health Act (United States)".
0.380
designelectricalintendedmanufacturingnameproducesystemstechnicaltechnology
SHARED TOKENS (9): "design", "electrical", "intended", "manufacturing", "name", "produce", "systems", "technical", "technology". | EXACT TITLE in employment_workforce: "Mechatronics".
0.380
accordingagriculturalchangesdifferentenvironmentalindustrialneedsphysicalprimary
SHARED TOKENS (9): "according", "agricultural", "changes", "different", "environmental", "industrial", "needs", "physical", "primary". | EXACT TITLE in employment_workforce: "Food processing".
0.380
coordinationdevelopmentinvestmentlawprimaryprogramspublicrelatedworkforce
SHARED TOKENS (9): "coordination", "development", "investment", "law", "primary", "programs", "public", "related", "workforce". | EXACT TITLE in employment_workforce: "Workforce Innovation and Opportunity Act".
0.380
boisecapitaleducationidahomatterspublicschoolschoolssystem
SHARED TOKENS (9): "boise", "capital", "education", "idaho", "matters", "public", "school", "schools", "system". | EXACT TITLE in employment_workforce: "Idaho State Department of Education".
0.360
Colocation ↗ EXACT TITLE
businesscenterdataofficesinglespacestructuresystem
SHARED TOKENS (8): "business", "center", "data", "office", "single", "space", "structure", "system". | EXACT TITLE in data_center: "Colocation".
0.360
aireducationidahoprofessionalprogramspublicsupportswater
SHARED TOKENS (8): "air", "education", "idaho", "professional", "programs", "public", "supports", "water". | EXACT TITLE in data_center: "Idaho Conservation League".
0.360
accesschangeeconomicemploymentintendedorganizationsworkworking
SHARED TOKENS (8): "access", "change", "economic", "employment", "intended", "organizations", "work", "working". | EXACT TITLE in employment_workforce: "Refugee employment".
0.360
Workforce ↗ Q13440398 EXACT TITLE
cannotemploymentendparticipationrateworkworkforceworking
SHARED TOKENS (8): "cannot", "employment", "end", "participation", "rate", "work", "workforce", "working". | EXACT TITLE in employment_workforce: "Workforce". | EXACT TITLE in data_center: "Workforce".
0.360
agreementboisecenterscomidaholargestlowoperated
SHARED TOKENS (8): "agreement", "boise", "centers", "com", "idaho", "largest", "low", "operated". | EXACT TITLE in employment_workforce: "WinCo Foods".
0.360
certificationlaborpermanentprofessionalregulatedsystemtrainingworking
SHARED TOKENS (8): "certification", "labor", "permanent", "professional", "regulated", "system", "training", "working". | EXACT TITLE in employment_workforce: "Apprenticeship".
0.360
commissionidahooperatedpowerprovidepublicutilitieswater
SHARED TOKENS (8): "commission", "idaho", "operated", "power", "provide", "public", "utilities", "water". | EXACT TITLE in data_center: "Idaho Public Utilities Commission".
0.360
centersdataindividualinfrastructurephysicalpointsprovidesystems
SHARED TOKENS (8): "centers", "data", "individual", "infrastructure", "physical", "points", "provide", "systems". | EXACT TITLE in data_center: "Internet infrastructure".
0.340
educationidahomajorpeakprivateprofessionalprograms
SHARED TOKENS (7): "education", "idaho", "major", "peak", "private", "professional", "programs". | EXACT TITLE in employment_workforce: "College of Idaho".
0.340
Recruitment ↗ Q899277 EXACT TITLE
artificialcasecommercialemploymentintelligencejobspermanent
SHARED TOKENS (7): "artificial", "case", "commercial", "employment", "intelligence", "jobs", "permanent". | EXACT TITLE in employment_workforce: "Recruitment".
0.320
Lactalis ↗ Q1799825 EXACT TITLE
approximatelyaroundbusinesslargestmarketsname
SHARED TOKENS (6): "approximately", "around", "business", "largest", "markets", "name". | EXACT TITLE in employment_workforce: "Lactalis".
0.320
comparisonexistingexplicitlyhousingmarkettreatment
SHARED TOKENS (6): "comparison", "existing", "explicitly", "housing", "market", "treatment". | EXACT TITLE in employment_workforce: "Housing discrimination".
0.320
activityidahomainpercentprogramspublic
SHARED TOKENS (6): "activity", "idaho", "main", "percent", "programs", "public". | EXACT TITLE in employment_workforce: "Idaho State University".
0.320
differentirrigationlawphysicalsystemswater
SHARED TOKENS (6): "different", "irrigation", "law", "physical", "systems", "water". | EXACT TITLE in data_center: "Water right".
0.320
businesscapitalindustryknowledgeresourcesworkforce
SHARED TOKENS (6): "business", "capital", "industry", "knowledge", "resources", "workforce". | EXACT TITLE in employment_workforce: "Human resources".
0.320
Disaster recovery ↗ EXACT TITLE
emergencyinformationinfrastructureplanprofessionaltechnology
SHARED TOKENS (6): "emergency", "information", "infrastructure", "plan", "professional", "technology". | EXACT TITLE in data_center: "Disaster recovery".
0.300
architectureassociatedbuildcentersdatademanddigitalinfrastructurelargemapnodenodesoperatingprovideprovidersreducerequireresourcesscalesystem
SHARED TOKENS (20): "architecture", "associated", "build", "centers", "data", "demand", "digital", "infrastructure", "large", "map", "node", "nodes", "operating", "provide", "providers", "reduce", "require", "resources", "scale", "system".
0.300
accordingannualdesigndevelopmentexpectedgrowthindustryintegratedlawmarketmultiplenetworkspowerproducingprojectedsemiconductorsemiconductorssingletechnology
SHARED TOKENS (19): "according", "annual", "design", "development", "expected", "growth", "industry", "integrated", "law", "market", "multiple", "networks", "power", "producing", "projected", "semiconductor", "semiconductors", "single", "technology".
0.300
becomeemploymentfinancialretentionsupport
SHARED TOKENS (5): "become", "employment", "financial", "retention", "support". | EXACT TITLE in employment_workforce: "Vocational rehabilitation".
0.300
Idacorp ↗ Q5987232 EXACT TITLE
boiseenergyfinancialidahopower
SHARED TOKENS (5): "boise", "energy", "financial", "idaho", "power". | EXACT TITLE in employment_workforce: "Idacorp".
0.300
edgepublictreasurevalleywestern
SHARED TOKENS (5): "edge", "public", "treasure", "valley", "western". | EXACT TITLE in employment_workforce: "Treasure Valley Community College".
0.300
capacitydemandelectricenergyexpectedgoalgrowthintegratedlawlong-termmeansmeetplanningpowerpublicsupplyutilities
SHARED TOKENS (17): "capacity", "demand", "electric", "energy", "expected", "goal", "growth", "integrated", "law", "long-term", "means", "meet", "planning", "power", "public", "supply", "utilities".
0.300
allowingannouncedearliereducationenergyestablishedgovernmentlaterlawmarchnameofficeoperatingpercentworkforce
SHARED TOKENS (15): "allowing", "announced", "earlier", "education", "energy", "established", "government", "later", "law", "march", "name", "office", "operating", "percent", "workforce".
0.300
Firefighter ↗ Q107711 KW CROSS HIGH
additionalaroundbecomecertificationsemergencyfirelawlocalmainoperationsprovidepublicregionalroadroletraffictrainingwork
SHARED TOKENS (18): "additional", "around", "become", "certifications", "emergency", "fire", "law", "local", "main", "operations", "provide", "public", "regional", "road", "role", "traffic", "training", "work".
0.300
buildbusinessbusinessescommercecurrentdatadecisionseconomicfiregovernmenthelphospitalsinformationinfrastructurelocalmaintainplanprimaryproducingprograms
SHARED TOKENS (23): "build", "business", "businesses", "commerce", "current", "data", "decisions", "economic", "fire", "government", "help", "hospitals", "information", "infrastructure", "local", "maintain", "plan", "primary", "producing", "programs"....
0.300
additionalapplicationaroundavailabilitycontinuousdeliverydevelopmentincreasesinfrastructuremainmodeloperatingphysicalplatformproviderprovidingresourcesscalesoftwaresystems
SHARED TOKENS (21): "additional", "application", "around", "availability", "continuous", "delivery", "development", "increases", "infrastructure", "main", "model", "operating", "physical", "platform", "provider", "providing", "resources", "scale", "software", "systems"....
0.300
Trade union ↗ Q178790 KW CROSS HIGH
benefitsconditionscontractsemploymentgovernmentindividualindustrialindustryinternallabormaintainnegotiatedofficepowerprimaryratherthemworkforceworking
SHARED TOKENS (19): "benefits", "conditions", "contracts", "employment", "government", "individual", "industrial", "industry", "internal", "labor", "maintain", "negotiated", "office", "power", "primary", "rather", "them", "workforce", "working".
0.300
allowingaveragecentersconnectionsdatadeliverydistinctinfrastructurelargemultiplenetworknetworksoperatephysicalpointpointsprimaryprivateprovidersreduce
SHARED TOKENS (22): "allowing", "average", "centers", "connections", "data", "delivery", "distinct", "infrastructure", "large", "multiple", "network", "networks", "operate", "physical", "point", "points", "primary", "private", "providers", "reduce"....
0.300
analyticsapplicationavailabilitycentersdatadeliverydifferentendindustriesintelligencelargelayerlivenetworkoperatorsprovideproviderssocialsoftwaretechnologies
SHARED TOKENS (20): "analytics", "application", "availability", "centers", "data", "delivery", "different", "end", "industries", "intelligence", "large", "layer", "live", "network", "operators", "provide", "providers", "social", "software", "technologies".
0.300
Peak demand ↗ Q3393666 KW CROSS HIGH
annualaveragecapacitycommercialdemandelectricelectricalenergyevenexpectedhigherindividualindustrialoperatingpeakpointpowersinglesupplyutilities
SHARED TOKENS (20): "annual", "average", "capacity", "commercial", "demand", "electric", "electrical", "energy", "even", "expected", "higher", "individual", "industrial", "operating", "peak", "point", "power", "single", "supply", "utilities".
0.300
agriculturalcasecentralcontractorscorrectestablishedfoundationalgovernmentlaborlawnationalpowerprivaterepresentedseries
SHARED TOKENS (15): "agricultural", "case", "central", "contractors", "correct", "established", "foundational", "government", "labor", "law", "national", "power", "private", "represented", "series".
0.300
agreementaloneapproximatelybecomesbenefitsbusinessescompliancedevelopmentfirmindustryinsurancemillionoperatingprofessionalprovidingregulatoryrisktaxtechnologytraining
SHARED TOKENS (22): "agreement", "alone", "approximately", "becomes", "benefits", "businesses", "compliance", "development", "firm", "industry", "insurance", "million", "operating", "professional", "providing", "regulatory", "risk", "tax", "technology", "training"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
accessaccordingadditionalaroundbaseconditionsdecisionsdevelopmenteconomicestablishedfacilitiesfinancialhealthcarehistoryinformationinsurancelowmeansmeetneeds
SHARED TOKENS (36): "access", "according", "additional", "around", "base", "conditions", "decisions", "development", "economic", "established", "facilities", "financial", "healthcare", "history", "information", "insurance", "low", "means", "meet", "needs"....
0.300
approximatelyaveragedataeconomicemploymentestablishedexpectedincreaseindustrialindustrieslaborlaterlawlocalmarchmillionnationalofficepowerreduce
SHARED TOKENS (23): "approximately", "average", "data", "economic", "employment", "established", "expected", "increase", "industrial", "industries", "labor", "later", "law", "local", "march", "million", "national", "office", "power", "reduce"....
0.300
designedeconomiceducationformerlyhigherindividualknowledgeproviderelatedschoolschoolssocialspecializedtechnicaltechnologytrainingtype
SHARED TOKENS (17): "designed", "economic", "education", "formerly", "higher", "individual", "knowledge", "provide", "related", "school", "schools", "social", "specialized", "technical", "technology", "training", "type".
0.300
appliedcentralchangechangesconditionsdependsdesigndevelopmenteconomicendenvironmentalfacilitiesgoalgovernmentslandland-usemeansneedsoptionsphysical
SHARED TOKENS (28): "applied", "central", "change", "changes", "conditions", "depends", "design", "development", "economic", "end", "environmental", "facilities", "goal", "governments", "land", "land-use", "means", "needs", "options", "physical"....
0.300
accordingairattentioncasecentraldesigneddevelopmentintegratedinternaloperatingpermanentpowerreducesinglesystemsystems
SHARED TOKENS (16): "according", "air", "attention", "case", "central", "designed", "development", "integrated", "internal", "operating", "permanent", "power", "reduce", "single", "system", "systems".
0.300
accessbecomebuiltcloseconnectedcurrentdeliveryelectricelectricalenergyincreaseslargemarketsmeaningmillionneedneedednetworkoperatepower
SHARED TOKENS (24): "access", "become", "built", "close", "connected", "current", "delivery", "electric", "electrical", "energy", "increases", "large", "markets", "meaning", "million", "need", "needed", "network", "operate", "power"....
0.300
activeemergencyfirelabororganizations
SHARED TOKENS (5): "active", "emergency", "fire", "labor", "organizations". | EXACT TITLE in employment_workforce: "International Association of Fire Fighters".
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
accordingadditionalannouncedapplicationaroundbusinessesconditionsdataendgloballocalmapmarchorganizationsplanningplatformprogrampublicreportshow
SHARED TOKENS (25): "according", "additional", "announced", "application", "around", "businesses", "conditions", "data", "end", "global", "local", "map", "march", "organizations", "planning", "platform", "program", "public", "report", "show"....
0.300
activityanotherbusinesscapitalcentralcommissioncompetitivecorporatecreatedescribedeffectsgovernmentlawmarketoperatingoperationsprovidingregulatoryrequiresingle
SHARED TOKENS (20): "activity", "another", "business", "capital", "central", "commission", "competitive", "corporate", "create", "described", "effects", "government", "law", "market", "operating", "operations", "providing", "regulatory", "require", "single".
0.300
additionalcommissioncontrolsdataestablishedfinancialframeworkinformationintegratedintendedinternalnameoperatingorganizationsprovidepublicrelevantreportreportingsystem
SHARED TOKENS (22): "additional", "commission", "controls", "data", "established", "financial", "framework", "information", "integrated", "intended", "internal", "name", "operating", "organizations", "provide", "public", "relevant", "report", "reporting", "system"....
0.300
accessbusinessbusinessescenterschangesdataformerlyinformationlocalmarchnetworknetworksprivateprovidersprovidingpublicservingtechnologiestechnology
SHARED TOKENS (19): "access", "business", "businesses", "centers", "changes", "data", "formerly", "information", "local", "march", "network", "networks", "private", "providers", "providing", "public", "serving", "technologies", "technology".
0.300
accessaccountingbusinesscapacitycommercialconnectionscorporatedatadatabasedevelopmentexistingfinanceglobalincreasinglyinformationintegratedlargemainmanufacturingmarket
SHARED TOKENS (35): "access", "accounting", "business", "capacity", "commercial", "connections", "corporate", "data", "database", "development", "existing", "finance", "global", "increasingly", "information", "integrated", "large", "main", "manufacturing", "market"....
0.300
Prisoner reentry ↗ KW CROSS HIGH
approximatelyattentionconditionsendformerlygoalgovernmentmeansmillionpolicyprogramspublicreceivingrequireresourcesreturnscalesupportsystemsystems
SHARED TOKENS (21): "approximately", "attention", "conditions", "end", "formerly", "goal", "government", "means", "million", "policy", "programs", "public", "receiving", "require", "resources", "return", "scale", "support", "system", "systems"....
0.300
Tax holiday ↗ Q3504234 KW CROSS HIGH
averagebusinessbusinessescorporatecreateexistinggovernmentsgrowthincentivesincreaseindustriesinvestmentlawlocalnationalprivatereduceresourcesretentionsmaller
SHARED TOKENS (21): "average", "business", "businesses", "corporate", "create", "existing", "governments", "growth", "incentives", "increase", "industries", "investment", "law", "local", "national", "private", "reduce", "resources", "retention", "smaller"....
0.300
accessdevelopmentformerlyglobalgovernmentsinfrastructurelatermarchmultiplenameplatformprofessionalprojectsoftwaresupportssystemstools
SHARED TOKENS (17): "access", "development", "formerly", "global", "governments", "infrastructure", "later", "march", "multiple", "name", "platform", "professional", "project", "software", "supports", "systems", "tools".
0.300
casecontractsemploymentgovernmentindividuallaborlawlocalpoliciesprivateprovidepublicratherrequirework
SHARED TOKENS (15): "case", "contracts", "employment", "government", "individual", "labor", "law", "local", "policies", "private", "provide", "public", "rather", "require", "work".
0.300
accordingbecomebenefitsclaimeconomicgovernmentsinsuranceinternallargeoverviewprogramprogramsreceivingreplacesocial
SHARED TOKENS (15): "according", "become", "benefits", "claim", "economic", "governments", "insurance", "internal", "large", "overview", "program", "programs", "receiving", "replace", "social".
0.300
benefitscasecenterseducationemergencyestablishedexpandedfacilitiesgovernmenthealthcareinsurancelong-termnationalofficesprogramproviding
SHARED TOKENS (16): "benefits", "case", "centers", "education", "emergency", "established", "expanded", "facilities", "government", "healthcare", "insurance", "long-term", "national", "offices", "program", "providing".
0.300
G.I. Bill ↗ Q1484269 KW CROSS HIGH
activebenefitsbusinessdesignededucationfinancialimmediateinsurancelawnamepolicyprovidingpublicschoolseparate
SHARED TOKENS (15): "active", "benefits", "business", "designed", "education", "financial", "immediate", "insurance", "law", "name", "policy", "providing", "public", "school", "separate".
0.300
activeavailabilitybuildingcentercenterscommercialdataevenfacilitiesfacilityframeworkhigherindustriesinfrastructurelargemultipleoperationalphysicalpowerproviders
SHARED TOKENS (27): "active", "availability", "building", "center", "centers", "commercial", "data", "even", "facilities", "facility", "framework", "higher", "industries", "infrastructure", "large", "multiple", "operational", "physical", "power", "providers"....
0.300
broaderchangedevelopmenteconomiceducationemploymenthistoricallyincreasinglyindividualinformationinstitutionsmarketsmatchingparticipationplanningprofessionalrelatedrelationshipsshapedsocial
SHARED TOKENS (26): "broader", "change", "development", "economic", "education", "employment", "historically", "increasingly", "individual", "information", "institutions", "markets", "matching", "participation", "planning", "professional", "related", "relationships", "shaped", "social"....
0.300
airattentioncannotchangedemanddevelopmenteducationenergyenvironmentalexpandedglobalgovernmentshigherindividualindustrialindustryinstitutionslandlargelive
SHARED TOKENS (36): "air", "attention", "cannot", "change", "demand", "development", "education", "energy", "environmental", "expanded", "global", "governments", "higher", "individual", "industrial", "industry", "institutions", "land", "large", "live"....
0.300
allowingclaimcompliancedifferentenergylimitedmarketpercentpolicyprivateproduceprogramsregulatoryresourcessourcessupplysupportingutilities
SHARED TOKENS (18): "allowing", "claim", "compliance", "different", "energy", "limited", "market", "percent", "policy", "private", "produce", "programs", "regulatory", "resources", "sources", "supply", "supporting", "utilities".
0.300
Hewlett-Packard ↗ Q80978 KW CROSS HIGH
aroundbecomebusinessbusinesseschangecomdatagovernmenthistoryindustryinformationlargelatermajormanufacturingnameonlinepeakproviderelated
SHARED TOKENS (27): "around", "become", "business", "businesses", "change", "com", "data", "government", "history", "industry", "information", "large", "later", "major", "manufacturing", "name", "online", "peak", "provide", "related"....
0.300
accordingapplicationassociatedbusinesscentralinformationinfrastructureintegratedneedoperatingoperationalorganizationsorganizedrelevanceresourcesrolesecuresupportsupportstechnical
SHARED TOKENS (23): "according", "application", "associated", "business", "central", "information", "infrastructure", "integrated", "need", "operating", "operational", "organizations", "organized", "relevance", "resources", "role", "secure", "support", "supports", "technical"....
0.300
accessallowingdatadevelopmentdigitalelectricelectricalglobalindividualinformationmeansnetworksphysicalpowersignalssingletechnologiestechnology
SHARED TOKENS (18): "access", "allowing", "data", "development", "digital", "electric", "electrical", "global", "individual", "information", "means", "networks", "physical", "power", "signals", "single", "technologies", "technology".
0.300
Solar power ↗ Q1483757 KW CROSS HIGH
builtcapacitychangecommercialconcentratedcurrentelectricenergygloballargeneededpolicypowerprimaryremotesinglesystemsystems
SHARED TOKENS (18): "built", "capacity", "change", "commercial", "concentrated", "current", "electric", "energy", "global", "large", "needed", "policy", "power", "primary", "remote", "single", "system", "systems".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalchangesdescribeddevelopmentexpansionfinancefinancialfirmfirmsinvestmentlimitedlong-termoperationalprivateprovidepublicratherrole
SHARED TOKENS (22): "active", "business", "capital", "changes", "described", "development", "expansion", "finance", "financial", "firm", "firms", "investment", "limited", "long-term", "operational", "private", "provide", "public", "rather", "role"....
0.300
agreementassetbuildingbuiltbusinessbusinessescasecommercialcontractsdesignedenergyfirmsgovernmentgovernmentslong-termmarketpowerratherroleschools
SHARED TOKENS (21): "agreement", "asset", "building", "built", "business", "businesses", "case", "commercial", "contracts", "designed", "energy", "firms", "government", "governments", "long-term", "market", "power", "rather", "role", "schools"....
0.300
activityaroundassociatedaveragebeyondbusinessesdifferentdistincteconomiceducationemploymentexperienceglobalhoursjobslaborlowmeetmoveneeds
SHARED TOKENS (34): "activity", "around", "associated", "average", "beyond", "businesses", "different", "distinct", "economic", "education", "employment", "experience", "global", "hours", "jobs", "labor", "low", "meet", "move", "needs"....
0.300
accordingapplicationavailabilitybuildbuildingcapacitycenterscentralcompliancedatafoundationalglobalgovernmentgovernmentsinfrastructurelocalmarketmarketsmodelnetwork
SHARED TOKENS (36): "according", "application", "availability", "build", "building", "capacity", "centers", "central", "compliance", "data", "foundational", "global", "government", "governments", "infrastructure", "local", "market", "markets", "model", "network"....
0.300
HITRUST ↗ Q5629803 EXACT TITLE
certificationscomplianceformerlyinformationrisk
SHARED TOKENS (5): "certifications", "compliance", "formerly", "information", "risk". | EXACT TITLE in data_center: "HITRUST".
0.300
aroundbusinesscentersdatadesignedelectricalemergencyenergylargepowerprovideserioussinglesourcessupplysystemtype
SHARED TOKENS (17): "around", "business", "centers", "data", "designed", "electrical", "emergency", "energy", "large", "power", "provide", "serious", "single", "sources", "supply", "system", "type".
0.300
announcedannualaroundcertificationclosedifferenteffectsenergyexistingexpectedframeworkglobalgovernmentinvestmentlargestlowmainmeaningnationalneed
SHARED TOKENS (23): "announced", "annual", "around", "certification", "close", "different", "effects", "energy", "existing", "expected", "framework", "global", "government", "investment", "largest", "low", "main", "meaning", "national", "need"....
0.300
accessavailabilitybusinessdatadigitalgovernmentincreasinglyindustryinformationinfrastructureintendedinternalknowledgemajornetworksoperationsphysicalplanningpoliciespolicy
SHARED TOKENS (30): "access", "availability", "business", "data", "digital", "government", "increasingly", "industry", "information", "infrastructure", "intended", "internal", "knowledge", "major", "networks", "operations", "physical", "planning", "policies", "policy"....
🫐 BERRY59 edges
0.280
Machine learning ↗ Q2539 KW CROSS HIGH
analysisapproximatelyartificialcorrectdatadescribeddevelopmentexplicitlyframeworkintelligencenetworksrelatedrisktraditional
SHARED TOKENS (14): "analysis", "approximately", "artificial", "correct", "data", "described", "development", "explicitly", "framework", "intelligence", "networks", "related", "risk", "traditional".
0.280
distincteducationexperienceintendedjobslargestpracticalprogramprogramsschooltraditionaltypeworkworkforce
SHARED TOKENS (14): "distinct", "education", "experience", "intended", "jobs", "largest", "practical", "program", "programs", "school", "traditional", "type", "work", "workforce".
0.280
applicationcommercedifferentemploymentfinalhistorylaborlaterlawnationalpowerpublicrightsschools
SHARED TOKENS (14): "application", "commerce", "different", "employment", "final", "history", "labor", "later", "law", "national", "power", "public", "rights", "schools".
0.280
accordinganalyticsannouncedannouncementapplicationcentersdatainfrastructuremultiplenameplatformpublicseriestools
SHARED TOKENS (14): "according", "analytics", "announced", "announcement", "application", "centers", "data", "infrastructure", "multiple", "name", "platform", "public", "series", "tools".
0.280
benefitscapitalchangedecisionsdemanddifferenteconomiceducationfirmslabormarketspoliciespublicsupply
SHARED TOKENS (14): "benefits", "capital", "change", "decisions", "demand", "different", "economic", "education", "firms", "labor", "markets", "policies", "public", "supply".
0.280
Unemployment ↗ Q41171 EXACT TITLE
employmentrateratherwork
SHARED TOKENS (4): "employment", "rate", "rather", "work". | EXACT TITLE in employment_workforce: "Unemployment".
0.280
Digital divide ↗ Q244752 KW CROSS HIGH
accessaccordinganotherdatadigitalhousinginformationjobslimitedmillionresourcessocialtechnologiestechnology
SHARED TOKENS (14): "access", "according", "another", "data", "digital", "housing", "information", "jobs", "limited", "million", "resources", "social", "technologies", "technology".
0.280
airbuildingdesigndesignedelectricalenergyenvironmentalhvacoperatingprojectsprovidesystemstechnologywater
SHARED TOKENS (14): "air", "building", "design", "designed", "electrical", "energy", "environmental", "hvac", "operating", "projects", "provide", "systems", "technology", "water".
0.280
Shortage ↗ Q2184645 EXACT TITLE
demandeconomicmarketsupply
SHARED TOKENS (4): "demand", "economic", "market", "supply". | EXACT TITLE in employment_workforce: "Shortage".
0.260
meanstechnologieswater
SHARED TOKENS (3): "means", "technologies", "water". | EXACT TITLE in data_center: "Liquid cooling".
0.260
commercecontrolscybersecuritygovernmenthelpinformationintendednationalprogramsproviderelatedsystemstechnology
SHARED TOKENS (13): "commerce", "controls", "cybersecurity", "government", "help", "information", "intended", "national", "programs", "provide", "related", "systems", "technology".
0.260
Veteran ↗ Q193891 EXACT TITLE
problemsrealserving
SHARED TOKENS (3): "problems", "real", "serving". | EXACT TITLE in employment_workforce: "Veteran".
0.260
employmentofficesonline
SHARED TOKENS (3): "employment", "offices", "online". | EXACT TITLE in employment_workforce: "ZipRecruiter".
0.260
businesschangesconditionscontinuedeliveryenvironmentalgoalintendedoperationsorganizationsplanningsystemsworking
SHARED TOKENS (13): "business", "changes", "conditions", "continue", "delivery", "environmental", "goal", "intended", "operations", "organizations", "planning", "systems", "working".
0.260
applicationcenterconnecteddatadeliverydesignedgeexpandedmodelnetworksreducesourcessystems
SHARED TOKENS (13): "application", "center", "connected", "data", "delivery", "design", "edge", "expanded", "model", "networks", "reduce", "sources", "systems".
0.260
applicationdigitalestablishedfinancefinancialfirmsindustryonlinereplacesystemstechnologiestechnologytraditional
SHARED TOKENS (13): "application", "digital", "established", "finance", "financial", "firms", "industry", "online", "replace", "systems", "technologies", "technology", "traditional".
0.260
regionwestwestern
SHARED TOKENS (3): "region", "west", "western". | EXACT TITLE in data_center: "Intermountain West".
0.260
appliedcentersdeliveryinformationprovideprovidersreportsecureseriessupportssystemsystemstechnology
SHARED TOKENS (13): "applied", "centers", "delivery", "information", "provide", "providers", "report", "secure", "series", "supports", "system", "systems", "technology".
0.240
activitydesignededucationknowledgemajorpoliciesprofessionalprogramsrequireroleschooltraining
SHARED TOKENS (12): "activity", "designed", "education", "knowledge", "major", "policies", "professional", "programs", "require", "role", "school", "training".
0.240
Dark fibre ↗ Q1878571 KW CROSS HIGH
additionalcapacitydatademandinfrastructurelaterlowmarketnetworkprivateprovidertraditional
SHARED TOKENS (12): "additional", "capacity", "data", "demand", "infrastructure", "later", "low", "market", "network", "private", "provider", "traditional".
0.240
benefitsbuildingconditionseconomicemploymentgovernmenthistorylabormillionrightsthemworking
SHARED TOKENS (12): "benefits", "building", "conditions", "economic", "employment", "government", "history", "labor", "million", "rights", "them", "working".
0.240
Law enforcement ↗ Q44554 KW CROSS HIGH
activityassociatedgovernmentinstitutionslawoperateorganizationsorganizedpowerpublicsocialsystem
SHARED TOKENS (12): "activity", "associated", "government", "institutions", "law", "operate", "organizations", "organized", "power", "public", "social", "system".
0.240
buildingcapacityconnectedconnectionsconnectsdifferentinformationlargeneedsnetworknetworksproviding
SHARED TOKENS (12): "building", "capacity", "connected", "connections", "connects", "different", "information", "large", "needs", "network", "networks", "providing".
0.230
approximatelyboiseidahowest
SHARED TOKENS (4): "approximately", "boise", "idaho", "west". | URL->A (1): http://caldwellchamber.org/.
0.220
buildconnectionsdatadesignedelectricalhistoricallynetworksignalsspecializedstructuretraditional
SHARED TOKENS (11): "build", "connections", "data", "designed", "electrical", "historically", "network", "signals", "specialized", "structure", "traditional".
0.220
agriculturalairapproximatelychangeindustrialirrigationmultipleresourcessourcessupplywater
SHARED TOKENS (11): "agricultural", "air", "approximately", "change", "industrial", "irrigation", "multiple", "resources", "sources", "supply", "water".
0.220
Simplot ↗ Q3484788 EXACT TITLE
boiseidaho
SHARED TOKENS (2): "boise", "idaho". | EXACT TITLE in employment_workforce: "Simplot".
0.220
Managed services ↗ KW CROSS HIGH
continuousdemandinformationinfrastructurelong-termmodelprovidersystemstechnicaltechnologytraditional
SHARED TOKENS (11): "continuous", "demand", "information", "infrastructure", "long-term", "model", "provider", "systems", "technical", "technology", "traditional".
0.220
benefitscaseeconomicemploymentinsurancelimitedplansproblemsprovidingsolvedsystem
SHARED TOKENS (11): "benefits", "case", "economic", "employment", "insurance", "limited", "plans", "problems", "providing", "solved", "system".
0.220
Plumber ↗ Q252924 EXACT TITLE
systemswater
SHARED TOKENS (2): "systems", "water". | EXACT TITLE in employment_workforce: "Plumber".
0.220
alreadycentralcreatedatahistorylargelargestmultipleoperatepowertraditional
SHARED TOKENS (11): "already", "central", "create", "data", "history", "large", "largest", "multiple", "operate", "power", "traditional".
0.220
adaboisecentercentralconnectedidahonamenationalseriesvalleywestern
SHARED TOKENS (11): "ada", "boise", "center", "central", "connected", "idaho", "name", "national", "series", "valley", "western".
0.220
commerceconditionsjobslaborlawprogramrateresourcessystemworkworking
SHARED TOKENS (11): "commerce", "conditions", "jobs", "labor", "law", "program", "rate", "resources", "system", "work", "working".
0.200
annualcenterdataenergyhourson-siteproducingsimplesitewater
SHARED TOKENS (10): "annual", "center", "data", "energy", "hours", "on-site", "producing", "simple", "site", "water".
0.200
additionalhourslaborlawmajorprovideprovidingpublicseriouswork
SHARED TOKENS (10): "additional", "hours", "labor", "law", "major", "provide", "providing", "public", "serious", "work".
0.200
employmentintendedlaborlawlocalmarketplannedprogramsprovidetraining
SHARED TOKENS (10): "employment", "intended", "labor", "law", "local", "market", "planned", "programs", "provide", "training".
0.200
centercentersdatadescribesenergyfacilityglobalinfrastructurepowersupports
SHARED TOKENS (10): "center", "centers", "data", "describes", "energy", "facility", "global", "infrastructure", "power", "supports".
0.200
benefitsconditionsemploymentexplicitlyinformationlaborlawneedspublicrights
SHARED TOKENS (10): "benefits", "conditions", "employment", "explicitly", "information", "labor", "law", "needs", "public", "rights".
0.200
contractorscoordinationeducationemploymentfinancialgovernmentlawprogramsreceivingtraining
SHARED TOKENS (10): "contractors", "coordination", "education", "employment", "financial", "government", "law", "programs", "receiving", "training".
0.200
adabusinesschangesfinallaterlawnationalprovidepublicrights
SHARED TOKENS (10): "ada", "business", "changes", "final", "later", "law", "national", "provide", "public", "rights".
0.200
451 Group ↗ Q55602817 KW CROSS HIGH
analyticscenterdatafirmglobalindustryinformationoperatingoperatorstechnology
SHARED TOKENS (10): "analytics", "center", "data", "firm", "global", "industry", "information", "operating", "operators", "technology".
0.180
advantageairbenefitsbuildingenergylargereducesystemswater
SHARED TOKENS (9): "advantage", "air", "benefits", "building", "energy", "large", "reduce", "systems", "water".
0.180
commercedevelopmenteconomicgrowthidahopublicresourcesstate-leveltax
SHARED TOKENS (9): "commerce", "development", "economic", "growth", "idaho", "public", "resources", "state-level", "tax".
0.180
applicationdecisionsdesignedinformationmakesnetworkpoliciessystemsystems
SHARED TOKENS (9): "application", "decisions", "designed", "information", "makes", "network", "policies", "system", "systems".
0.180
cannotcommissionemploymentestablishedgovernmentindividualinformationnationalrights
SHARED TOKENS (9): "cannot", "commission", "employment", "established", "government", "individual", "information", "national", "rights".
0.180
facilitieshealthcarehospitalhospitalsidahonetworkoperatingsupportsystem
SHARED TOKENS (9): "facilities", "healthcare", "hospital", "hospitals", "idaho", "network", "operating", "support", "system".
0.160
anotherelectricalinformationlocalnetworkssignalstypevisible
SHARED TOKENS (8): "another", "electrical", "information", "local", "networks", "signals", "type", "visible".
0.160
advantagesbusinesscontractsoperationsorganizationsproviderprovidersspecialized
SHARED TOKENS (8): "advantages", "business", "contracts", "operations", "organizations", "provider", "providers", "specialized".
0.160
claimcommercecreatesemploymenthourslaborlawwork
SHARED TOKENS (8): "claim", "commerce", "creates", "employment", "hours", "labor", "law", "work".
0.160
businessbusinesseseducationindustryoperateorganizationsproducingpublic
SHARED TOKENS (8): "business", "businesses", "education", "industry", "operate", "organizations", "producing", "public".
0.140
approximatelyboisedataevengovernmentidahosingle
SHARED TOKENS (7): "approximately", "boise", "data", "even", "government", "idaho", "single".
0.140
associatedboisecenteridaholargestsidevalley
SHARED TOKENS (7): "associated", "boise", "center", "idaho", "largest", "side", "valley".
0.120
Land development ↗ KW CROSS HIGH
buildingdevelopmentestatehousinglandreal
SHARED TOKENS (6): "building", "development", "estate", "housing", "land", "real".
0.120
advanceddevelopmenteducationestablishedprofessionalprovide
SHARED TOKENS (6): "advanced", "development", "education", "established", "professional", "provide".
0.120
boiseidaholargelawsinglework
SHARED TOKENS (6): "boise", "idaho", "large", "law", "single", "work".
0.120
developmentmaintainmeetneedssoftwaresystems
SHARED TOKENS (6): "development", "maintain", "meet", "needs", "software", "systems".
0.100
Electrician ↗ Q165029 KW CROSS HIGH
dataelectricalexistinginfrastructurerelated
SHARED TOKENS (5): "data", "electrical", "existing", "infrastructure", "related".
0.100
Labor mobility ↗ Q282773 KW CROSS HIGH
distinctevenlaborphysicalresources
SHARED TOKENS (5): "distinct", "even", "labor", "physical", "resources".
0.100
accessdemandnetworkphysicalresources
SHARED TOKENS (5): "access", "demand", "network", "physical", "resources".
◈ Frequently Asked Questions
Employment Workforce × Data Center — Treasure Valley
HAIKU · HIGH GATE
How do data center operations in the Treasure Valley create employment opportunities in Ada County and Canyon County?
Data centers operating in Boise, Nampa, and Garden City require skilled technicians, security personnel, and infrastructure managers to maintain facilities and systems. Micron Technology's presence in the region alongside major data center development has intensified demand for technology workers across Ada County and Canyon County, driving both direct hiring and contract employment growth.
What role does Idaho Power play in supporting both data center infrastructure and workforce development in the Treasure Valley?
Idaho Power supplies the electrical capacity required for data centers in Boise, Nampa, Garden City, and Kuna, while the company itself employs engineers and technicians whose skills overlap with data center workforce needs. The utility's infrastructure investments enable the expansion of computing facilities that generate additional employment across the Treasure Valley region.
How does computer security employment connect to data center job creation in Meridian and surrounding Treasure Valley areas?
Data centers require specialized computer security professionals to protect infrastructure and data, creating dedicated job categories in Meridian, Boise, and Ada County. Micron Technology and other major employers in the region compete for the same security workforce, raising compensation and expanding employment pipelines for cybersecurity expertise across the Treasure Valley.
Why do data center employers in the Treasure Valley recruit from multiple Idaho communities including Kuna and Canyon County?
Data center facilities distributed across Boise, Nampa, Garden City, Kuna, and Meridian require operational staff that can commute within the broader Treasure Valley labor market. Canyon County and Ada County residents increasingly access data center employment without relocating, as operations expand beyond traditional technology hubs into the wider western Idaho region.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Employment Workforce × Data Center 11 QID bridges 195 edges 5,361 ext links 2026-07-17 20:32:58 UTC d5f12f69145c3c24
Employment Workforce corridor ↗ Data Center corridor ↗ Data Center × Employment Workforce ↗ boisestandard.org/standard ↗
Parent Corridors
Employment Workforce × All Other Verticals