—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Education ↔ relates to ↔ Legal

12 Wikipedia bridge articles confirmed in both vertical ledgers. 268 deterministic cross-vertical edges. 8,305 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
268 Cross Edges
8,305 External Sources
333 Wikipedia Articles
13 🌲 Evergreen
136 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Education
× Legal
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
268
External Sources Harvested
8,305
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
University of Idaho College of Law
score: 1.0000  ·  type: exact_title_cross  ·  34 shared tokens
QID Bridge Titles (12)
University of Idaho College of LawBoise State UniversityTreasure ValleyLaw schoolJuris DoctorNampa, IdahoBoise, IdahoAda County, IdahoCanyon County, IdahoCaldwell, IdahoMeridian, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationcollegeuniversityeducationschooladapublicwestcanyonhomenorthwestamericanannualbarbusinessmemberprogramresources
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:29:13 UTC
Content Hash
cc0262534192a1db
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
U
Q7895518 EXACT TITLE 1.000
QID OVERLAP: Q7895518 in education (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (34): "aba-accredited", "american", "annual", "bar", "boise", "business", "class", "college", "education", "emphasis", "employment", "environmental", "established", "expansion", "fall", "falls", "full", "idaho", "legislature", "main".... | EXACT TITLE in education: "University of Idaho College of Law". | EXACT TITLE in legal: "University of Idaho College of Law".
aba-accreditedamericanannualbarboisebusinessclasscollegeeducationemphasisemploymentenvironmentalestablishedexpansionfallfallsfullidaholegislaturemainmembermonthsmoscownaturalnewsopenedprogrampublicrankedresources+4
he Association of American Law Schools since 1914, and has been accredited by the American Bar Association (ABA) since 1925. In the 2023 rankings, U.S. News & World Report ranked Idaho Law at #142 of ABA-accredited law schools in its annual law school rankings. The College of Law in fall of 2016 had an enrollment of around 300 students, with an entering first-year class of 97 students. As a public law school, new students hail from across Idaho and 18 different states and foreign countries. They represent over 70 undergraduate colleges and universities. The college offers four areas of emphasis: Native American Law, Natural Resources and Environmental Law, Business Law and Entrepreneurship, and Intellectual Property and Technology Law. The college opened its Idaho Law and JusticexLearning Center in Boise in 2010, initially as a third-year program only. Second-year classes were added in 2014. The plans for a full three-year program in Boise, which UI had first discussed in the late 1990s and the state legislature had addressed in 2008, were fully realized in 2017 after the Idaho Board of Education and the ABA approved the addition of first-year courses at the Boise campus. The Boise campus initially accommodated about 35 students annually; with the expansion to a full three-year program, it can now accept up to 60 first-year students. UI's addition of the Boise campus has led the University of South Dakota to consider establishing a second law school campus in Sioux Falls. The University of Idaho College of Law is the only law school in Idaho fully accredited by the ABA. A second accredited law school, the Concordia University School of Law, operated from 2019 to 2020. According to Idaho Law's 2015 American Bar Association-required disclosures, 78.5% of the Class of 2015 obtained full-time, long-term, JD-required employment nine months after graduation.
Boise. As of the entering class of 2017–18, students may take all three years of instruction at either location. The UI College of Law was established in 1909, has been a member of the Association of American Law Schools since 1914, and has been accredited by the American Bar Association (ABA) since 1925. In the 2023 rankings, U.S. News & World Report ranked Idaho Law at #142 of ABA-accredited law schools in its annual law school rankings. The College of Law in fall of 2016 had an enrollment of around 300 students, with an entering first-year class of 97 students. As a public law school, new students hail from across Idaho and 18 different states and foreign countries. They represent over 70 undergraduate colleges and universities. The college offers four areas of emphasis: Native American Law, Natural Resources and Environmental Law, Business Law and Entrepreneurship, and Intellectual Property and Technology Law. The college opened its Idaho Law and JusticexLearning Center in Boise in 2010, initially as a third-year program only. Second-year classes were added in 2014. The plans for a full three-year program in Boise, which UI had first discussed in the late 1990s and the state legislature had addressed in 2008, were fully realized in 2017 after the Idaho Board of Education and the ABA approved the addition of first-year courses at the Boise campus. The Boise campus initially accommodated about 35 students annually; with the expansion to a full three-year program, it can now accept up to 60 first-year students. UI's addition of the Boise campus has led the University of South Dakota to consider establishing a second law school campus in Sioux Falls. The University of Idaho College of Law is the only law school in Idaho fully accredited by the ABA. A second accredited law school, the Concordia University School of Law, operated from 2019 to 2020. According to Idaho Law's 2015 American Bar Association-required disclosures, 78.5% of the Class of 2015 obtained full-time, long-term, JD-required employment nine months after graduation.
l, new students hail from across Idaho and 18 different states and foreign countries. They represent over 70 undergraduate colleges and universities. The college offers four areas of emphasis: Native American Law, Natural Resources and Environmental Law, Business Law and Entrepreneurship, and Intellectual Property and Technology Law. The college opened its Idaho Law and JusticexLearning Center in Boise in 2010, initially as a third-year program only. Second-year classes were added in 2014. The plans for a full three-year program in Boise, which UI had first discussed in the late 1990s and the state legislature had addressed in 2008, were fully realized in 2017 after the Idaho Board of Education and the ABA approved the addition of first-year courses at the Boise campus. The Boise campus initially accommodated about 35 students annually; with the expansion to a full three-year program, it can now accept up to 60 first-year students. UI's addition of the Boise campus has led the University of South Dakota to consider establishing a second law school campus in Sioux Falls. The University of Idaho College of Law is the only law school in Idaho fully accredited by the ABA. A second accredited law school, the Concordia University School of Law, operated from 2019 to 2020. According to Idaho Law's 2015 American Bar Association-required disclosures, 78.5% of the Class of 2015 obtained full-time, long-term, JD-required employment nine months after graduation.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in education (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (16): "boise", "business", "college", "education", "founded", "idaho", "independent", "member", "mountain", "program", "public", "school", "sciences", "total", "university", "west". | EXACT TITLE in education: "Boise State University".
boisebusinesscollegeeducationfoundedidahoindependentmembermountainprogrampublicschoolsciencestotaluniversitywest
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
A program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
CAA Division I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in education (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (10): "boise", "idaho", "land", "local", "resources", "river", "snake", "treasure", "valley", "western". | EXACT TITLE in education: "Treasure Valley". | EXACT TITLE in legal: "Treasure Valley".
boiseidaholandlocalresourcesriversnaketreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Law school
Q1321960 EXACT TITLE 0.860
QID OVERLAP: Q1321960 in education (tier:evergreen) and legal (tier:evergreen). | SHARED TOKENS (8): "college", "department", "education", "legal", "professional", "school", "system", "university". | EXACT TITLE in education: "Law school". | EXACT TITLE in legal: "Law school".
collegedepartmenteducationlegalprofessionalschoolsystemuniversity
A law school (also known as a law centre/center, college of law, or faculty of law) is an institution, professional school, or department of a college or university specializing in legal education, usually involved as part of a process for becoming a judge, lawyer, or other legal professional within a given jurisdiction.
On July 3, 2007, the Korean National Assembly passed legislation introducing 'Law School', closely modeled on the American post-graduate system. Moreover, naturally, since March 2, 2009, 25 (both public and private) 3-year professional Law Schools that officially approved by Korean Government, has been opened to teach future Korean lawyers. The first bar test to the lawschool graduates was scheduled in 2012. Sri Lanka In Sri Lanka to practice law, one must be admitted and enrolled as an Attorney-at-Law of the Supreme Court of Sri Lanka. This is achieved by passing law exams at the Sri Lanka Law College, which are administered by the Council of Legal Education and spending a period of six months under a practicing attorney of at least 8 years standing. To undertake law exams students must gain admission to the Sri Lanka Law College and study law or directly undertake exams after gaining an LL.B.
Sri Lanka In Sri Lanka to practice law, one must be admitted and enrolled as an Attorney-at-Law of the Supreme Court of Sri Lanka. This is achieved by passing law exams at the Sri Lanka Law College, which are administered by the Council of Legal Education and spending a period of six months under a practicing attorney of at least 8 years standing. To undertake law exams students must gain admission to the Sri Lanka Law College and study law or directly undertake exams after gaining an LL.B.
Juris Doctor
Q1540185 QID OVERLAP 0.800
QID OVERLAP: Q1540185 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (24): "additional", "alongside", "american", "bar", "civil", "complete", "corporate", "courts", "criminal", "department", "education", "federal", "individuals", "legal", "matters", "national", "office", "professional", "public", "requirement"....
additionalalongsideamericanbarcivilcompletecorporatecourtscriminaldepartmenteducationfederalindividualslegalmattersnationalofficeprofessionalpublicrequirementrequiresschooltraininguniversity
elor's degree or the equivalent in certain scientific or engineering fields alongside their Juris Doctor degree in order to practice in patent cases —prosecuting patent applications — before it. This additional requirement does not apply to the litigation of patent-related matters in state and federal courts. Etymology and abbreviations In the United States, the professional doctorate in law may be conferred in Latin or in English as Juris Doctor (sometimes shown on Latin diplomas in the accusative form Juris Doctorem) and at some law schools Doctor of Law (JD), or Doctor of Jurisprudence (also abbreviated JD). "Juris Doctor" literally means "teacher of law", while the Latin for "Doctor of Jurisprudence" (Jurisprudentiae Doctor) literally means "teacher of legal knowledge". The JSD and SJD are equivalent to PhD degrees in law, while the LLD may be equivalent to the PhD or may be a higher doctorate. The JD differs from the Doctor of the Science of Law (Juridicae Scientiae Doctor; JSD), Doctor of Juridical Science (Scientiae Juridicae Doctor; SJD), or Doctor of Laws (Legum Doctor; LLD).
Italy In Italy, only one program gives access to traditional legal professions such as lawyer, magistrate or public notary, and that is the Laurea Magistrale in Giurisprudenza. Legal studies have a long history in Italy, with the University of Bologna being the main Italian center for studies of both canon law and civil law in the 12th and 13th centuries. The Laurea Magistrale in Giurisprudenza is a five-year academic program, deemed a master's-level degree under the Bologna process, that can be entered into with a high school diploma. The program comprises universities classes in legal theory and legal subjects, excluding practical courses, and is concluded with a thesis (Italian: tesi di laurea) to be defended before an academic commission. In a novel approach, a few universities are trialing a 3+2 model, which initially offers a bachelor's degree in law, followed by the option to undertake an additional two years to earn the Italian Juris Doctor. Italian graduates in law are awarded the title of Doctor of Law (Italian: Dottore Magistrale in Giurisprudenza, commonly known as Dottore in legge), in keeping with standard Italian practice of awarding the title of doctor to university graduates. Holders of the Laurea Magistrale in Giurisprudenza are eligible to register with an Italian bar association, which is a prerequisite for the mandatory eighteen-month apprenticeship under a practicing attorney-at-law before taking the bar examination. Alternatively, graduates may opt for two additional years of study at the Scuole di Specializzazione per le Professioni Legali (Specialization Schools for the Legal Profession), leading to a Diploma di Specializzazione per le Professioni Legali (Specialization Diploma for the Legal Profession), akin to a master's degree.
During the medieval period, the teaching of law at Cambridge and Oxford Universities was mainly for philosophical or scholarly purposes and not meant to prepare one to practice law. The universities only taught civil and canon law (used in very few jurisdictions, such as the courts of admiralty and church courts) but not the common law that applied in most jurisdictions. Professional training for practicing common law in England was undertaken at the Inns of Court, but over time the training functions of the Inns lessened considerably, and apprenticeships with individual practitioners arose as the prominent medium of preparation. However, because of the lack of standardization of study, and of objective standards for appraisal of these apprenticeships, the role of universities became subsequently important for the education of lawyers in the English-speaking world. In England in 1292, when Edward I first requested that lawyers be trained, students merely sat in the courts and observed, but over time the students would hire professionals to lecture them in their residences, which led to the institution of the Inns of Court system. The original method of education at the Inns of Court was a mix of moot court-like practice and lecture, as well as court proceedings observation. By the fifteenth century, the Inns functioned like a university, akin to the University of Oxford and the University of Cambridge, though very specialized in purpose. With the frequent absence of parties to suits during the Crusades, the importance of the lawyer role grew tremendously, and the demand for lawyers grew. Historically, Oxford and Cambridge did not see common law as worthy of academic study, and included coursework in law only in the context of canon and civil law (the two "laws" in the original Bachelor of Laws, which became the Bachelor of Civil Law when the study of canon law was barred after the Reformation) and for the purpose of the study of philosophy or history only. As a consequence of the need for practical education in law, the apprenticeship program for solicitors emerged, structured and governed by the same rules as the apprenticeship programs for the trades. The training of solicitors by a five-year apprenticeship was formally established by the Attorneys and Solicitors Act 1728. William Blackstone became the first lecturer in English common law at the University of Oxford in 1753, but the university did not establish the program for the purpose of professional study, and the lectures were philosophical and theoretical in nature. Blackstone insisted that the study of law should be university-based, where concentration on foundational principles can be had, instead of concentration on detail and procedure provided by apprenticeship and the Inns of Court. The 1728 act was amended in 1821 to reduce the period of the required apprenticeship to three years for graduates from Oxford, Cambridge, and Dublin, as "the admission of such graduates should be facilitated, in consideration of the learning and abilities requisite for taking such degree". This was extended in 1837 to cover the newly established universities of Durham and London, and again in 1851 to include the new Queen's University of Ireland. The Inns of Court continued but became less effective, and admission to the bar still did not require any significant educational activity or examination. In 1846, Parliament examined the education and training of prospective barristers and found the system to be inferior to that of Europe and the United States, as Britain did not regulate the admission of barristers. Therefore, formal schools of law were called for but were not finally established until later in the century, and even then the bar did not consider a university degree in admission decisions. Until the mid-19th century, most law degrees in England, for example the BCL at Oxford and Durham, and the LLB at London, were postgraduate degrees. The Cambridge degree was an exception: it took six years from matriculation to complete, but only three of these had to be in residence, and the BA was not required (although those not holding a BA had to produce a certificate to prove they had not only been in residence but had actually attended lectures for at least three terms). These degrees specialized in Roman civil law rather than in English common law, the latter being the domain of the Inns of Court, and thus they were more theoretical than practical. Cambridge re-established its LLB degree in 1858 as an undergraduate course alongside the BA, and the London LLB, which had previously required a minimum of one year after the BA, become an undergraduate degree in 1866. The older nomenclature continues to be used for the BCL at Oxford today, which is a master's level program, while Cambridge moved its LLB back to being a postgraduate degree in 1922 but only renamed it as the LLM in 1982. Between the 1960s and the 1990s, law schools in England took on a more central role in the preparation of lawyers and consequently improved their coverage of advanced legal topics to become more professionally relevant.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "northwest", "population", "student", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannampanorthwestpopulationstudentuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "counties", "employers", "home", "idaho", "population", "river", "technology", "treasure", "valley".
adaannualboisecountiesemployershomeidahopopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in education (tier:evergreen) and legal (tier:branch). | SHARED TOKENS (12): "ada", "boise", "district", "home", "idaho", "largest", "local", "northwest", "pacific", "population", "ranks", "washington".
adaboisedistricthomeidaholargestlocalnorthwestpacificpopulationrankswashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "ada", "boise", "fastest-growing", "idaho", "meridian", "population".
adaboisefastest-growingidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in education (tier:branch) and legal (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
256 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP256 edges
🌲 EVERGREEN1 edges
0.650
adaboisecanyoncollegecommunitycountiesdevelopmenteducationelectedfallgovernedidahonampapopulationprimarypublicresidentsstudenttreasurevalley
SHARED TOKENS (21): "ada", "boise", "canyon", "college", "community", "counties", "development", "education", "elected", "fall", "governed", "idaho", "nampa", "population", "primary", "public", "residents", "student", "treasure", "valley".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in education: "College of Western Idaho".
🌿 BRANCH136 edges
0.530
americaneducationfoundednorthwestonlineprofessionalsuniversityutahwestern
SHARED TOKENS (9): "american", "education", "founded", "northwest", "online", "professionals", "university", "utah", "western". | URL->A (1): http://www.wgu.edu/. | EXACT TITLE in education: "Western Governors University".
0.530
boisefamilyheadquartersidahonetworknorthernoperatespublicuniversity
SHARED TOKENS (9): "boise", "family", "headquarters", "idaho", "network", "northern", "operates", "public", "university". | URL->A (1): https://www.boisestatepublicradio.org/. | EXACT TITLE in education: "Boise State Public Radio".
0.510
collegefoundedidahomedicalmeridianownedschooluniversity
SHARED TOKENS (8): "college", "founded", "idaho", "medical", "meridian", "owned", "school", "university". | URL->A (1): http://www.icom.edu/. | EXACT TITLE in education: "Idaho College of Osteopathic Medicine".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturebestboisehighestidahoindustrieslandlargestmountainnationalnorthwestpacificpopulationpriorranksriversnaketechnologyutahwashington
SHARED TOKENS (23): "agriculture", "best", "boise", "highest", "idaho", "industries", "land", "largest", "mountain", "national", "northwest", "pacific", "population", "prior", "ranks", "river", "snake", "technology", "utah", "washington".... | EXACT TITLE in education: "Idaho". | EXACT TITLE in legal: "Idaho".
0.500
Corporation ↗ Q167037 EXACT TITLE
bodybusinesscontextcorporateestablishedjointlegallegislaturelocalmembernaturalofficeownedpublicrecognizedrightservesinglethird
SHARED TOKENS (19): "body", "business", "context", "corporate", "established", "joint", "legal", "legislature", "local", "member", "natural", "office", "owned", "public", "recognized", "right", "serve", "single", "third". | EXACT TITLE in legal: "Corporation".
0.500
NPR ↗ EXACT TITLE
americanannualcorporatedistrictsfeesfullgovernmentheadquarteredheadquartersindependentmembernationalnetworknewsnonprofitonlineoperatesorganizationownedpaid
SHARED TOKENS (27): "american", "annual", "corporate", "districts", "fees", "full", "government", "headquartered", "headquarters", "independent", "member", "national", "network", "news", "nonprofit", "online", "operates", "organization", "owned", "paid".... | EXACT TITLE in education: "NPR". | EXACT TITLE in legal: "NPR".
0.500
branchcomplexconcentrationdepartmentenergyenvironmentalfallsformerhistoryidahoknowledgelargestnationalwestwesternworld
SHARED TOKENS (16): "branch", "complex", "concentration", "department", "energy", "environmental", "falls", "former", "history", "idaho", "knowledge", "largest", "national", "west", "western", "world". | EXACT TITLE in education: "Idaho National Laboratory".
0.500
accessaddressamericanbestcommunitydevelopmenteducationemployersfoundedgovernmenthistoryhomeindustrynetworkpublicresidentssystemtraining
SHARED TOKENS (18): "access", "address", "american", "best", "community", "development", "education", "employers", "founded", "government", "history", "home", "industry", "network", "public", "residents", "system", "training". | EXACT TITLE in education: "Workforce development".
0.500
contextestablishedexperiencefamilyfinancialformerhomemarriagemembersofficeorganizationpartnerpartnersphysicalratesrelationshipsresourcestechnologyworld
SHARED TOKENS (19): "context", "established", "experience", "family", "financial", "former", "home", "marriage", "members", "office", "organization", "partner", "partners", "physical", "rates", "relationships", "resources", "technology", "world". | EXACT TITLE in legal: "Domestic violence".
0.500
Scholarship ↗ Q188823 EXACT TITLE
accessaidcommunitycoveringdevelopmenteducationexperiencefinancialglobalkeyminimumnationalprofessionalpublicschoolstudentsupportuniversity
SHARED TOKENS (18): "access", "aid", "community", "covering", "development", "education", "experience", "financial", "global", "key", "minimum", "national", "professional", "public", "school", "student", "support", "university". | EXACT TITLE in education: "Scholarship".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesbestcollegeemployersemploymentexperiencegovernmentindustryleadmedicalnetworkorganizationpaidprofessionalschoolservesystemtraininguniversitywork
SHARED TOKENS (20): "agencies", "best", "college", "employers", "employment", "experience", "government", "industry", "lead", "medical", "network", "organization", "paid", "professional", "school", "serve", "system", "training", "university", "work". | EXACT TITLE in education: "Internship".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalagriculturebodydepartmentemployersemploymentgrowthindividualsknowledgeleadleadingminimumphysicalpresenceprogramprojectsrequiressectiontotal
SHARED TOKENS (19): "additional", "agriculture", "body", "department", "employers", "employment", "growth", "individuals", "knowledge", "lead", "leading", "minimum", "physical", "presence", "program", "projects", "requires", "section", "total". | EXACT TITLE in legal: "H-1B visa".
0.500
boisebranchestablishedfallsidahomainmoscowofficesopenedoperatesprofessionalpublicstatewideuidahouniversity
SHARED TOKENS (15): "boise", "branch", "established", "falls", "idaho", "main", "moscow", "offices", "opened", "operates", "professional", "public", "statewide", "uidaho", "university". | EXACT TITLE in education: "University of Idaho". | EXACT TITLE in legal: "University of Idaho".
0.500
americanaugustboisefoundedhistoryhomeidaholocalmountainopenedpriorrightsschooluniversitywestwestern
SHARED TOKENS (16): "american", "august", "boise", "founded", "history", "home", "idaho", "local", "mountain", "opened", "prior", "rights", "school", "university", "west", "western". | EXACT TITLE in education: "Albertsons Stadium".
0.500
americanaugustdevelopmentdollarsfederalformerindustryprojectspublicsemiconductorsignedsupplytechnologytitletotaltraining
SHARED TOKENS (16): "american", "august", "development", "dollars", "federal", "former", "industry", "projects", "public", "semiconductor", "signed", "supply", "technology", "title", "total", "training". | EXACT TITLE in education: "CHIPS and Science Act".
0.500
agenciescollegecontinuingdevelopmenteducationgeneralgovernmentonlinepersonalprofessionalrecognizedschoolsupporttraininguniversity
SHARED TOKENS (15): "agencies", "college", "continuing", "development", "education", "general", "government", "online", "personal", "professional", "recognized", "school", "support", "training", "university". | EXACT TITLE in education: "Continuing education".
0.500
Real estate ↗ Q684740 EXACT TITLE
businessestategeneralgovernmentindividualslandlegalnaturalnonprofitownedpersonalpublicrealresourceswater
SHARED TOKENS (15): "business", "estate", "general", "government", "individuals", "land", "legal", "natural", "nonprofit", "owned", "personal", "public", "real", "resources", "water". | EXACT TITLE in education: "Real estate". | EXACT TITLE in legal: "Real estate".
0.500
Snake River ↗ EXACT TITLE
agenciesamericancanyonconstructioncreatedfallshistoryidahoirrigationlargestleadingnationalnorthwestpacificprojectspublicriversectionsnaketribal
SHARED TOKENS (26): "agencies", "american", "canyon", "construction", "created", "falls", "history", "idaho", "irrigation", "largest", "leading", "national", "northwest", "pacific", "projects", "public", "river", "section", "snake", "tribal".... | EXACT TITLE in education: "Snake River". | EXACT TITLE in legal: "Snake River".
0.500
Pell Grant ↗ Q2068057 EXACT TITLE
administeredaidcollegecreateddepartmenteducationfamilyfederalfinancialfreegovernmentinstitutionsnationallypayprogramschoolstandardstudenttoptotal
SHARED TOKENS (21): "administered", "aid", "college", "created", "department", "education", "family", "federal", "financial", "free", "government", "institutions", "nationally", "pay", "program", "school", "standard", "student", "top", "total".... | EXACT TITLE in education: "Pell Grant".
0.500
Finance ↗ Q43015 EXACT TITLE
analysisbusinesscorporateestablishedfinancialglobalhistoryleadingorganizationpersonalplanningpublicresourcessystemtechnology
SHARED TOKENS (15): "analysis", "business", "corporate", "established", "financial", "global", "history", "leading", "organization", "personal", "planning", "public", "resources", "system", "technology". | EXACT TITLE in legal: "Finance".
0.500
agenciesbranchdevelopmentenergyenvironmentenvironmentalglobalgrowthkeylegalnationalnationallynaturalregulatoryresourcesrightssafety
SHARED TOKENS (17): "agencies", "branch", "development", "energy", "environment", "environmental", "global", "growth", "key", "legal", "national", "nationally", "natural", "regulatory", "resources", "rights", "safety". | EXACT TITLE in legal: "Environmental law".
0.500
bodybranchbusinesscivilcodedistrictemploymentfallfinancialfoodformationgenerallegalmatterspublicregulatoryrelationshipsrightssafetysystem
SHARED TOKENS (20): "body", "branch", "business", "civil", "code", "district", "employment", "fall", "financial", "food", "formation", "general", "legal", "matters", "public", "regulatory", "relationships", "rights", "safety", "system". | EXACT TITLE in legal: "Commercial law".
0.500
americancollegecreatededucationemphasisexplicitlygeneralglobalindependentknowledgeleadnewsprofessionalsciencesuniversityworld
SHARED TOKENS (16): "american", "college", "created", "education", "emphasis", "explicitly", "general", "global", "independent", "knowledge", "lead", "news", "professional", "sciences", "university", "world". | EXACT TITLE in education: "Liberal arts college".
0.500
civilcouncilcreateddevelopmentfamilyfinancialjointmarriagememberminimumpaidpayprimaryrecognizedrequiresreviewrightrightssignedsingle
SHARED TOKENS (23): "civil", "council", "created", "development", "family", "financial", "joint", "marriage", "member", "minimum", "paid", "pay", "primary", "recognized", "requires", "review", "right", "rights", "signed", "single".... | EXACT TITLE in legal: "Child support".
0.480
addressanalysiscommunitycontexteffectiveexperiencefoundedgovernmentinstitutionsnonprofitorganizationpublicrecognizedrelationships
SHARED TOKENS (14): "address", "analysis", "community", "context", "effective", "experience", "founded", "government", "institutions", "nonprofit", "organization", "public", "recognized", "relationships". | EXACT TITLE in education: "Public administration".
0.480
Trust (law) ↗ Q854022 EXACT TITLE
bodybusinesscreatedcriminalestablishedfederalgovernedindividualslegalnaturalpublicrequiresrightsingle
SHARED TOKENS (14): "body", "business", "created", "criminal", "established", "federal", "governed", "individuals", "legal", "natural", "public", "requires", "right", "single". | EXACT TITLE in education: "Trust (law)". | EXACT TITLE in legal: "Trust (law)".
0.480
addressarchitecturecomplexconstructiondataenvironmentalgeneralhighestnaturaloperatingplanningprocessingrecognizedsciences
SHARED TOKENS (14): "address", "architecture", "complex", "construction", "data", "environmental", "general", "highest", "natural", "operating", "planning", "processing", "recognized", "sciences". | EXACT TITLE in education: "Computer science".
0.480
americancoloradojanuarylasmembermembersmountainoperationsuniversityutahvegaswestwesternwyoming
SHARED TOKENS (14): "american", "colorado", "january", "las", "member", "members", "mountain", "operations", "university", "utah", "vegas", "west", "western", "wyoming". | EXACT TITLE in education: "Mountain West Conference".
0.460
americanbodycollegefreegovernedgovernshighestmembersnationalprofessionalschoolsinglesupport
SHARED TOKENS (13): "american", "body", "college", "free", "governed", "governs", "highest", "members", "national", "professional", "school", "single", "support". | EXACT TITLE in education: "College football".
0.460
boisebranchdatadistrictdistrictsgovernmentidaholegislaturememberspopulationresidentssinglewashington
SHARED TOKENS (13): "boise", "branch", "data", "district", "districts", "government", "idaho", "legislature", "members", "population", "residents", "single", "washington". | EXACT TITLE in education: "Idaho Legislature". | EXACT TITLE in legal: "Idaho Legislature".
0.460
bodybusinesscommunitycorporateenvironmentfinancialformationgovernancegovernslegalmattersrightssystem
SHARED TOKENS (13): "body", "business", "community", "corporate", "environment", "financial", "formation", "governance", "governs", "legal", "matters", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.460
annualcombineddevelopmentgrowthhighestindustryleadingrankedreachsemiconductorsingletechtechnology
SHARED TOKENS (13): "annual", "combined", "development", "growth", "highest", "industry", "leading", "ranked", "reach", "semiconductor", "single", "tech", "technology". | EXACT TITLE in education: "Semiconductor industry".
0.460
Pharmacy ↗ Q614304 EXACT TITLE
communityeffectiveindustriesmedicationnaturalofficeprimarypriorprofessionalprofessionalssafetyscienceswork
SHARED TOKENS (13): "community", "effective", "industries", "medication", "natural", "office", "primary", "prior", "professional", "professionals", "safety", "sciences", "work". | EXACT TITLE in education: "Pharmacy".
0.460
additionalcollegefinancialhighestinstitutionsmembermembersminimumnationalprogramschoolsupportuniversity
SHARED TOKENS (13): "additional", "college", "financial", "highest", "institutions", "member", "members", "minimum", "national", "program", "school", "support", "university". | EXACT TITLE in education: "NCAA Division I".
0.450
boisecreatedidaholegislatureoperations
SHARED TOKENS (5): "boise", "created", "idaho", "legislature", "operations". | URL->B (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.450
chiefcourtshighestidahojustice
SHARED TOKENS (5): "chief", "courts", "highest", "idaho", "justice". | URL->B (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.440
Patent ↗ Q253623 EXACT TITLE
disclosurefalllegalmemberminimumnationalorganizationpublicrightrightstechnologyworld
SHARED TOKENS (12): "disclosure", "fall", "legal", "member", "minimum", "national", "organization", "public", "right", "rights", "technology", "world". | EXACT TITLE in legal: "Patent".
0.440
civilcourtsestablishedfactsfinalhighestlegalreviewrightstandardsystemworld
SHARED TOKENS (12): "civil", "courts", "established", "facts", "final", "highest", "legal", "review", "right", "standard", "system", "world". | EXACT TITLE in legal: "Appellate court".
0.440
Economics ↗ Q8134 EXACT TITLE
analysisbusinesseducationenvironmentfamilyglobalgovernmentgrowthinstitutionslandpublicwork
SHARED TOKENS (12): "analysis", "business", "education", "environment", "family", "global", "government", "growth", "institutions", "land", "public", "work". | EXACT TITLE in education: "Economics".
0.440
HP Inc. ↗ Q21404084 EXACT TITLE
americanbusinessfoundedheadquarterslegallistedpersonalrankedservingtechnologytotalworld
SHARED TOKENS (12): "american", "business", "founded", "headquarters", "legal", "listed", "personal", "ranked", "serving", "technology", "total", "world". | EXACT TITLE in education: "HP Inc.".
0.440
aidassistancecriminalestablishedfederalfreefullgovernmentlegalofficepublicrequires
SHARED TOKENS (12): "aid", "assistance", "criminal", "established", "federal", "free", "full", "government", "legal", "office", "public", "requires". | EXACT TITLE in legal: "Public defender".
0.430
idahonampanorthwestuniversity
SHARED TOKENS (4): "idaho", "nampa", "northwest", "university". | URL->A (1): https://nnu.edu/. | EXACT TITLE in education: "Northwest Nazarene University".
0.420
civilenvironmentalgovernsindividualslandlegalpersonalpublicrealrelationshipsrights
SHARED TOKENS (11): "civil", "environmental", "governs", "individuals", "land", "legal", "personal", "public", "real", "relationships", "rights". | EXACT TITLE in legal: "Property law".
0.420
brancheducationexperienceknowledgemedicalphysicalreceivedrequirementresidencyschooltraining
SHARED TOKENS (11): "branch", "education", "experience", "knowledge", "medical", "physical", "received", "requirement", "residency", "school", "training". | EXACT TITLE in education: "Residency (medicine)". | EXACT TITLE in legal: "Residency (medicine)".
0.420
accessbestcontactfamilyjointlegalmemberphysicalrightrightsstandard
SHARED TOKENS (11): "access", "best", "contact", "family", "joint", "legal", "member", "physical", "right", "rights", "standard". | EXACT TITLE in legal: "Child custody".
0.420
Social work ↗ EXACT TITLE
agenciescommunitydevelopmenteducationfamilygovernmentgroupindividualslaborpublicwork
SHARED TOKENS (11): "agencies", "community", "development", "education", "family", "government", "group", "individuals", "labor", "public", "work". | EXACT TITLE in education: "Social work".
0.420
concentrationcriticaldevelopmentenergyfreegroupphysicalresponsiblesemiconductorsinglework
SHARED TOKENS (11): "concentration", "critical", "development", "energy", "free", "group", "physical", "responsible", "semiconductor", "single", "work". | EXACT TITLE in education: "Semiconductor". | EXACT TITLE in legal: "Semiconductor".
0.420
bestfactsfamilylandlegalpublicrealrightrightsservestitle
SHARED TOKENS (11): "best", "facts", "family", "land", "legal", "public", "real", "right", "rights", "serves", "title". | EXACT TITLE in education: "Title (property)". | EXACT TITLE in legal: "Title (property)".
0.420
Nursing ↗ Q121176 EXACT TITLE
demandeducationhealthcarelargestmemberspresenceprofessionalspublicqualitysupplysupport
SHARED TOKENS (11): "demand", "education", "healthcare", "largest", "members", "presence", "professionals", "public", "quality", "supply", "support". | EXACT TITLE in education: "Nursing".
0.420
agenciescivilconstructiondepartmentsenvironmentglobalgovernmentnationalphysicalprofessionalpublic
SHARED TOKENS (11): "agencies", "civil", "construction", "departments", "environment", "global", "government", "national", "physical", "professional", "public". | EXACT TITLE in education: "Civil engineering".
0.420
Lawyer ↗ Q40348 EXACT TITLE
bareducationindividualsknowledgelegalmattersprofessionalrightssystemtrainingwork
SHARED TOKENS (11): "bar", "education", "individuals", "knowledge", "legal", "matters", "professional", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.420
communityeducationfactsfreedomlegalmattersmembersprofessionalrightstudentuniversity
SHARED TOKENS (11): "community", "education", "facts", "freedom", "legal", "matters", "members", "professional", "right", "student", "university". | EXACT TITLE in education: "Academic freedom".
0.420
businessdevelopmentemphasisgovernmentprofessionalprogrampublicrequirestraininguniversitywork
SHARED TOKENS (11): "business", "development", "emphasis", "government", "professional", "program", "public", "requires", "training", "university", "work". | EXACT TITLE in education: "Master of Public Administration".
0.420
Accounting ↗ Q4116214 EXACT TITLE
analysisbusinesscouncilfinancialhistoryoperationsorganizationprocessingprofessionalsupportsystem
SHARED TOKENS (11): "analysis", "business", "council", "financial", "history", "operations", "organization", "processing", "professional", "support", "system". | EXACT TITLE in education: "Accounting".
0.420
americanboisecreateddatademandfoundedidahoownedreachsemiconductortechnology
SHARED TOKENS (11): "american", "boise", "created", "data", "demand", "founded", "idaho", "owned", "reach", "semiconductor", "technology". | EXACT TITLE in education: "Micron Technology".
0.420
Contract ↗ Q93288 EXACT TITLE
businesscivilcodegeneralgovernedindependentindividualslegalnationalpriorrights
SHARED TOKENS (11): "business", "civil", "code", "general", "governed", "independent", "individuals", "legal", "national", "prior", "rights". | EXACT TITLE in legal: "Contract".
0.420
developmentfinalfullgovernmentlandlegalpublicrightthirdtitletotal
SHARED TOKENS (11): "development", "final", "full", "government", "land", "legal", "public", "right", "third", "title", "total". | EXACT TITLE in legal: "Eminent domain".
0.400
Arbitration ↗ Q207946 EXACT TITLE
classcontextcourtsemploymentlocalmattersreviewrightrightsthird
SHARED TOKENS (10): "class", "context", "courts", "employment", "local", "matters", "review", "right", "rights", "third". | EXACT TITLE in legal: "Arbitration".
0.400
developmentestatefinancialgovernmentlegalnationalrealrightssystemworld
SHARED TOKENS (10): "development", "estate", "financial", "government", "legal", "national", "real", "rights", "system", "world". | EXACT TITLE in legal: "Real estate transaction".
0.400
Ericsson ↗ Q52618 EXACT TITLE
americandevelopmentfallfamilyfoundedheadquarteredindustrylistedoperatestechnology
SHARED TOKENS (10): "american", "development", "fall", "family", "founded", "headquartered", "industry", "listed", "operates", "technology". | EXACT TITLE in education: "Ericsson".
0.400
Law firm ↗ Q613142 EXACT TITLE
assistancebusinesscivilclientscriminalindividualslegalmattersprimaryrights
SHARED TOKENS (10): "assistance", "business", "civil", "clients", "criminal", "individuals", "legal", "matters", "primary", "rights". | EXACT TITLE in legal: "Law firm".
0.380
Divorce ↗ Q93190 EXACT TITLE
accesscivilformerlegalmarriagepartnerrequiressupportworld
SHARED TOKENS (9): "access", "civil", "former", "legal", "marriage", "partner", "requires", "support", "world". | EXACT TITLE in legal: "Divorce".
0.380
barcompletecontinuingdevelopmentdistricteducationlegalminimumprofessional
SHARED TOKENS (9): "bar", "complete", "continuing", "development", "district", "education", "legal", "minimum", "professional". | EXACT TITLE in legal: "Continuing legal education".
0.380
agenciescourtscriminalgovernmentinstitutionsjusticeprimarysupportsystem
SHARED TOKENS (9): "agencies", "courts", "criminal", "government", "institutions", "justice", "primary", "support", "system". | EXACT TITLE in education: "Criminal justice".
0.380
demanddepartmentnetoperationspartnersplanningsupplysystemtotal
SHARED TOKENS (9): "demand", "department", "net", "operations", "partners", "planning", "supply", "system", "total". | EXACT TITLE in education: "Supply chain management".
0.380
caldwellcollegeeducationfoundedidahomedicaloldestprofessionalstandard
SHARED TOKENS (9): "caldwell", "college", "education", "founded", "idaho", "medical", "oldest", "professional", "standard". | EXACT TITLE in education: "College of Idaho".
0.380
Court ↗ Q41487 EXACT TITLE
civilcourtscriminalestablishedgovernmentjusticelegallegislaturematters
SHARED TOKENS (9): "civil", "courts", "criminal", "established", "government", "justice", "legal", "legislature", "matters". | EXACT TITLE in education: "Court". | EXACT TITLE in legal: "Court".
0.380
civilcourtsfinalformerhighestlegalnorthernreviewsingle
SHARED TOKENS (9): "civil", "courts", "final", "former", "highest", "legal", "northern", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.380
agriculturebusinessconstructioneducationfederalgovernmentleadmedicaltechnology
SHARED TOKENS (9): "agriculture", "business", "construction", "education", "federal", "government", "lead", "medical", "technology". | EXACT TITLE in education: "Career and technical education".
0.380
Mediation ↗ Q223871 EXACT TITLE
assistancecivilindependentindividualslegalprofessionalreachthirdtraining
SHARED TOKENS (9): "assistance", "civil", "independent", "individuals", "legal", "professional", "reach", "third", "training". | EXACT TITLE in legal: "Mediation".
0.380
createdcriticalhistoryinstitutionsknowledgeprocessingrecognizedrelationshipsworld
SHARED TOKENS (9): "created", "critical", "history", "institutions", "knowledge", "processing", "recognized", "relationships", "world". | EXACT TITLE in education: "Materials science".
0.360
Pro bono ↗ Q127537 EXACT TITLE
communityfreelegalprofessionalprofessionalspublicspecialistwork
SHARED TOKENS (8): "community", "free", "legal", "professional", "professionals", "public", "specialist", "work". | EXACT TITLE in legal: "Pro bono".
0.360
Green card ↗ Q6676995 EXACT TITLE
certificatecriminalfederalgeneralmemberresidencyresidentsserve
SHARED TOKENS (8): "certificate", "criminal", "federal", "general", "member", "residency", "residents", "serve". | EXACT TITLE in legal: "Green card".
0.360
certificatecollegecommunityeducationinstitutionsleadingschooluniversity
SHARED TOKENS (8): "certificate", "college", "community", "education", "institutions", "leading", "school", "university". | EXACT TITLE in education: "Community college".
0.360
collegeeducationgovernmentlandscapenationalownedpublicuniversity
SHARED TOKENS (8): "college", "education", "government", "landscape", "national", "owned", "public", "university". | EXACT TITLE in education: "Public university".
0.360
Assault ↗ Q365680 EXACT TITLE
civilcombinedcontactcriminallegalphysicalsinglesystem
SHARED TOKENS (8): "civil", "combined", "contact", "criminal", "legal", "physical", "single", "system". | EXACT TITLE in legal: "Assault".
0.360
Zoning ↗ Q702232 EXACT TITLE
developmentgovernmentgrowthlandlocalplanningregulatorysingle
SHARED TOKENS (8): "development", "government", "growth", "land", "local", "planning", "regulatory", "single". | EXACT TITLE in legal: "Zoning".
0.360
americancivilcriminalgenerallegalreviewsinglesystem
SHARED TOKENS (8): "american", "civil", "criminal", "general", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.360
boisefoundedfundheadquarteredidahoofficeorganizationworld
SHARED TOKENS (8): "boise", "founded", "fund", "headquartered", "idaho", "office", "organization", "world". | EXACT TITLE in education: "The Peregrine Fund".
0.360
aidclientsexperiencefreelegalprogramschoolwork
SHARED TOKENS (8): "aid", "clients", "experience", "free", "legal", "program", "school", "work". | EXACT TITLE in education: "Legal clinic".
0.360
additionalamericanboisefinancialheadquarteredidahoofficestechnology
SHARED TOKENS (8): "additional", "american", "boise", "financial", "headquartered", "idaho", "offices", "technology". | EXACT TITLE in education: "Clearwater Analytics".
0.360
FAFSA ↗ Q5424324 EXACT TITLE
aidcollegefederalfinancialfreeorganizationprofilestudent
SHARED TOKENS (8): "aid", "college", "federal", "financial", "free", "organization", "profile", "student". | EXACT TITLE in education: "FAFSA".
0.340
healthcaremedicalservesupporttrainingworkworld
SHARED TOKENS (7): "healthcare", "medical", "serve", "support", "training", "work", "world". | EXACT TITLE in education: "Physician assistant".
0.340
civilcommunityestatemarriageownedsystemworld
SHARED TOKENS (7): "civil", "community", "estate", "marriage", "owned", "system", "world". | EXACT TITLE in legal: "Community property".
0.340
Partnership ↗ Q728646 EXACT TITLE
businessgovernedindividualsorganizationpartnerpartnersreach
SHARED TOKENS (7): "business", "governed", "individuals", "organization", "partner", "partners", "reach". | EXACT TITLE in education: "Partnership".
0.340
Immigration law ↗ EXACT TITLE
freedomgovernmentlegalmattersnationalrightrights
SHARED TOKENS (7): "freedom", "government", "legal", "matters", "national", "right", "rights". | EXACT TITLE in legal: "Immigration law".
0.340
Aquifer ↗ Q208791 EXACT TITLE
environmentformationhomelandlayerleadwater
SHARED TOKENS (7): "environment", "formation", "home", "land", "layer", "lead", "water". | EXACT TITLE in legal: "Aquifer".
0.340
civilestatelegalmarriagerightrightssupport
SHARED TOKENS (7): "civil", "estate", "legal", "marriage", "right", "rights", "support". | EXACT TITLE in legal: "Prenuptial agreement".
0.340
Jury ↗ Q837675 EXACT TITLE
bodycivilgrouplegalprofessionalsinglesystem
SHARED TOKENS (7): "body", "civil", "group", "legal", "professional", "single", "system". | EXACT TITLE in legal: "Jury".
0.340
Trademark ↗ Q167270 EXACT TITLE
agencieslegalmemberminimumofficeprimaryrights
SHARED TOKENS (7): "agencies", "legal", "member", "minimum", "office", "primary", "rights". | EXACT TITLE in education: "Trademark".
0.340
educationestablishedexperiencefallschoolstudentwork
SHARED TOKENS (7): "education", "established", "experience", "fall", "school", "student", "work". | EXACT TITLE in education: "Adult learner".
0.340
completelaborleadingprofessionalreachsystemtraining
SHARED TOKENS (7): "complete", "labor", "leading", "professional", "reach", "system", "training". | EXACT TITLE in education: "Apprenticeship".
0.340
knowledgelegalmigrationminimumnationalorganizationresidency
SHARED TOKENS (7): "knowledge", "legal", "migration", "minimum", "national", "organization", "residency". | EXACT TITLE in legal: "Naturalization".
0.340
createdemployersemploymentgeneralmedicalrightsystem
SHARED TOKENS (7): "created", "employers", "employment", "general", "medical", "right", "system". | EXACT TITLE in legal: "Workers' compensation".
0.340
developmentgrowthhealthcareindustrymedicalscienceswork
SHARED TOKENS (7): "development", "growth", "healthcare", "industry", "medical", "sciences", "work". | EXACT TITLE in education: "Biomedical engineering".
0.340
bodyfederalgovernmentlandlegislaturepopulationrights
SHARED TOKENS (7): "body", "federal", "government", "land", "legislature", "population", "rights". | EXACT TITLE in legal: "Constitutional law".
0.340
Creditor ↗ Q157165 EXACT TITLE
financialgeneralgovernmentorganizationpayrepresentsworld
SHARED TOKENS (7): "financial", "general", "government", "organization", "pay", "represents", "world". | EXACT TITLE in legal: "Creditor".
0.320
americanbodylegalmedicalpersonalquality
SHARED TOKENS (6): "american", "body", "legal", "medical", "personal", "quality". | EXACT TITLE in legal: "Personal injury".
0.320
landlegalmainprimaryrightsworld
SHARED TOKENS (6): "land", "legal", "main", "primary", "rights", "world". | EXACT TITLE in legal: "Intellectual property".
0.320
backgroundcollegefamilyindividualsschooluniversity
SHARED TOKENS (6): "background", "college", "family", "individuals", "school", "university". | EXACT TITLE in education: "College application".
0.320
irrigationlegalphysicalrightriverwater
SHARED TOKENS (6): "irrigation", "legal", "physical", "right", "river", "water". | EXACT TITLE in legal: "Water right".
0.320
americananalysisemphasisgovernancehistoryuniversity
SHARED TOKENS (6): "american", "analysis", "emphasis", "governance", "history", "university". | EXACT TITLE in education: "Political science".
0.300
billeducationestablishedestatefinancialfundgovernedindependentinstitutionsjunelargestlegalnonprofitpublicrealresourcesserveservinguniversityworld
SHARED TOKENS (20): "bill", "education", "established", "estate", "financial", "fund", "governed", "independent", "institutions", "june", "largest", "legal", "nonprofit", "public", "real", "resources", "serve", "serving", "university", "world".
0.300
complexestatelegalnetplanning
SHARED TOKENS (5): "complex", "estate", "legal", "net", "planning". | EXACT TITLE in legal: "Estate planning".
0.300
annualbusinesscompletedevelopmentfinancialfundgrowthhistoryindustriesoperatingoperationsownedpublicratesstrategicsupporttechnologytotalvia
SHARED TOKENS (19): "annual", "business", "complete", "development", "financial", "fund", "growth", "history", "industries", "operating", "operations", "owned", "public", "rates", "strategic", "support", "technology", "total", "via".
0.300
americanbestcommunitydevelopmentdistrictsenvironmentalfoundedlandnaturalnorthernphysicalplanningprojectregionalresourceswater
SHARED TOKENS (16): "american", "best", "community", "development", "districts", "environmental", "founded", "land", "natural", "northern", "physical", "planning", "project", "regional", "resources", "water".
0.300
civilclassfreedomgroupindividualsjusticekeylegalmainnaturalpersonalphysicalpressrightrightssafetysystem
SHARED TOKENS (17): "civil", "class", "freedom", "group", "individuals", "justice", "key", "legal", "main", "natural", "personal", "physical", "press", "right", "rights", "safety", "system".
0.300
additionalcreateddepartmentdevelopmentenergyfederalgovernmentheadquartersjamesmembernationalofficesphysicalprogramprojectsystemwashington
SHARED TOKENS (17): "additional", "created", "department", "development", "energy", "federal", "government", "headquarters", "james", "member", "national", "offices", "physical", "program", "project", "system", "washington".
0.300
businesscombinedcorporatedepartmentfederalgovernedgovernmentjusticelegaloperatingoperationsorganizationprohibitsregulatoryrequiresreviewsinglestrategic
SHARED TOKENS (18): "business", "combined", "corporate", "department", "federal", "governed", "government", "justice", "legal", "operating", "operations", "organization", "prohibits", "regulatory", "requires", "review", "single", "strategic".
0.300
analysisarchitecturecompletedeepenvironmentfoundedgeneralgrowthhistoryknowledgenaturaloperationsplanningprocessingreachsafetysearchsupport
SHARED TOKENS (18): "analysis", "architecture", "complete", "deep", "environment", "founded", "general", "growth", "history", "knowledge", "natural", "operations", "planning", "processing", "reach", "safety", "search", "support".
0.300
contextemployersemploymentfallsfederalgeneralgovernmentlaborlocalmembermemberspayprohibitspublicrightwork
SHARED TOKENS (16): "context", "employers", "employment", "falls", "federal", "general", "government", "labor", "local", "member", "members", "pay", "prohibits", "public", "right", "work".
0.300
activeamericancivilcommunitycreatedfallfreedomgovernmentgroupkeyminimumoldestpublicrequiresrightrightsthirdworld
SHARED TOKENS (18): "active", "american", "civil", "community", "created", "fall", "freedom", "government", "group", "key", "minimum", "oldest", "public", "requires", "right", "rights", "third", "world".
0.300
admissionsannualcourtsfallgovernmentgrouphistorylegalprogramratesresidencysectionthirdtotalworld
SHARED TOKENS (15): "admissions", "annual", "courts", "fall", "government", "group", "history", "legal", "program", "rates", "residency", "section", "third", "total", "world".
0.300
contextcriticaldepartmentdevelopmenteducationemphasisgrouplabornationalnetonlinerepresentssciencestechtechnology
SHARED TOKENS (15): "context", "critical", "department", "development", "education", "emphasis", "group", "labor", "national", "net", "online", "represents", "sciences", "tech", "technology".
0.300
adabillbusinesscivilcouncileffectiveemployersfinalindividualsjanuarynationalprohibitspublicrequiresrightssigned
SHARED TOKENS (16): "ada", "bill", "business", "civil", "council", "effective", "employers", "final", "individuals", "january", "national", "prohibits", "public", "requires", "rights", "signed".
0.300
Probate ↗ Q6500369 EXACT TITLE
courtsestatelegalpersonalpublic
SHARED TOKENS (5): "courts", "estate", "legal", "personal", "public". | EXACT TITLE in legal: "Probate".
0.300
accessamericanannualaugustcreatedfederalfinancialgovernmentjanuarykeyoperationsownedpublicreceivedsupport
SHARED TOKENS (15): "access", "american", "annual", "august", "created", "federal", "financial", "government", "january", "key", "operations", "owned", "public", "received", "support".
0.300
constructionlaborpersonalrealtitle
SHARED TOKENS (5): "construction", "labor", "personal", "real", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.300
addressbillcriminalestablishedfederalgovernmenthistoryindividualsjameslegallocalmainphysicalprohibitsrightssearchvia
SHARED TOKENS (17): "address", "bill", "criminal", "established", "federal", "government", "history", "individuals", "james", "legal", "local", "main", "physical", "prohibits", "rights", "search", "via".
0.300
americanboisecoloradoformerfoundedfullhighesthistoryidahoinstitutionsleadmembersnationalpacificplusschooltitleutahwashingtonwestern
SHARED TOKENS (21): "american", "boise", "colorado", "former", "founded", "full", "highest", "history", "idaho", "institutions", "lead", "members", "national", "pacific", "plus", "school", "title", "utah", "washington", "western"....
0.300
activeamericancourtscoveringcreateddistrictdistrictsfederalheadquarteredidahojameslargestnorthernpacificservetotalwashingtonwestern
SHARED TOKENS (18): "active", "american", "courts", "covering", "created", "district", "districts", "federal", "headquartered", "idaho", "james", "largest", "northern", "pacific", "serve", "total", "washington", "western".
0.300
legalmedicalprofessionalrecognizedstandard
SHARED TOKENS (5): "legal", "medical", "professional", "recognized", "standard". | EXACT TITLE in legal: "Medical malpractice".
0.300
corporatefeesfinancialgovernanceindependentkeymattersnationallynotableoperatingorganizationprimarypublicsinglesystem
SHARED TOKENS (15): "corporate", "fees", "financial", "governance", "independent", "key", "matters", "nationally", "notable", "operating", "organization", "primary", "public", "single", "system".
0.300
agriculturecivilcollegedepartmenteducationestablishedexpansionfallfederalfullfundhomeinstitutionslandpublicschoolsupportsystemtribaluniversity
SHARED TOKENS (21): "agriculture", "civil", "college", "department", "education", "established", "expansion", "fall", "federal", "full", "fund", "home", "institutions", "land", "public", "school", "support", "system", "tribal", "university"....
0.300
Simplot ↗ Q3484788 EXACT TITLE
agricultureamericanboiseheadquarteredidaho
SHARED TOKENS (5): "agriculture", "american", "boise", "headquartered", "idaho". | EXACT TITLE in education: "Simplot".
0.300
admissionsamericancollegecommunitydepartmenteducationfallinstitutionsjanuaryminimumonlinepublicratesschoolstudentvia
SHARED TOKENS (16): "admissions", "american", "college", "community", "department", "education", "fall", "institutions", "january", "minimum", "online", "public", "rates", "school", "student", "via".
0.300
businesscertificatecorporategovernedlegalmedicalmemberoperatingoperationsorganizationphysicalprimaryprofessionalrightssingle
SHARED TOKENS (15): "business", "certificate", "corporate", "governed", "legal", "medical", "member", "operating", "operations", "organization", "physical", "primary", "professional", "rights", "single".
0.300
activeamericanbodycommunitycontextcreateddevelopmentestatefastest-growinggovernedgovernsgrowthlandlegallocalmemberorganizationplanningqualityreal
SHARED TOKENS (24): "active", "american", "body", "community", "context", "created", "development", "estate", "fastest-growing", "governed", "governs", "growth", "land", "legal", "local", "member", "organization", "planning", "quality", "real"....
0.300
additionaladministeredbilldepartmentelectedemployersfamilyhourlabormedicalmembermonthspublicsignedwork
SHARED TOKENS (15): "additional", "administered", "bill", "department", "elected", "employers", "family", "hour", "labor", "medical", "member", "months", "public", "signed", "work".
0.300
activeagenciesannualcourtsdistrictestablishedfederalfinalformerlegalnationalpopulationreviewservesystemwashingtonwest
SHARED TOKENS (17): "active", "agencies", "annual", "courts", "district", "established", "federal", "final", "former", "legal", "national", "population", "review", "serve", "system", "washington", "west".
0.300
americancollegecriticaldepartmentshealthcarehomemedicalnationalregulatoryresponsibleservespecialistsupportuniversitywork
SHARED TOKENS (15): "american", "college", "critical", "departments", "healthcare", "home", "medical", "national", "regulatory", "responsible", "serve", "specialist", "support", "university", "work".
0.300
agenciescouncilcourtscreatedenvironmentenvironmentalestablishedfederalfinalgovernmentjanuarynationalqualityrequirementrequiressignedworld
SHARED TOKENS (17): "agencies", "council", "courts", "created", "environment", "environmental", "established", "federal", "final", "government", "january", "national", "quality", "requirement", "requires", "signed", "world".
0.300
agenciesbillcouncildatadepartmenteducationfederalgovernmentinstitutionsmembernationallyorganizationqualityrecognizedregionalresourcesreviewtraininguniversity
SHARED TOKENS (19): "agencies", "bill", "council", "data", "department", "education", "federal", "government", "institutions", "member", "nationally", "organization", "quality", "recognized", "regional", "resources", "review", "training", "university".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accesschiefdatafinancialfullgovernmentlargestofficeonlinepersonalprogramrecordsresourcesresponsibletechnologyuniversity
SHARED TOKENS (16): "access", "chief", "data", "financial", "full", "government", "largest", "office", "online", "personal", "program", "records", "resources", "responsible", "technology", "university".
0.300
annualdollarsfoodgrouphighestidahoindustrieslandlargestnorthernownedprocessingriversnaketopworld
SHARED TOKENS (16): "annual", "dollars", "food", "group", "highest", "idaho", "industries", "land", "largest", "northern", "owned", "processing", "river", "snake", "top", "world".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
americananalysisassistancebarbusinesscourtscreateddepartmentseducationenvironmentestablishedexperiencefamilyfullgovernmentknowledgelaborlegalofficeoffices
SHARED TOKENS (33): "american", "analysis", "assistance", "bar", "business", "courts", "created", "departments", "education", "environment", "established", "experience", "family", "full", "government", "knowledge", "labor", "legal", "office", "offices"....
🫐 BERRY119 edges
0.280
Adoption ↗ Q180472 EXACT TITLE
governedlegalrequiresrights
SHARED TOKENS (4): "governed", "legal", "requires", "rights". | EXACT TITLE in legal: "Adoption".
0.280
collegeinstitutionsschooluniversity
SHARED TOKENS (4): "college", "institutions", "school", "university". | EXACT TITLE in education: "Dual enrollment".
0.280
agenciesbranchcivilcourtscreatededucationenvironmentenvironmentalgovernmentlegalopenedpublicreviewsystem
SHARED TOKENS (14): "agencies", "branch", "civil", "courts", "created", "education", "environment", "environmental", "government", "legal", "opened", "public", "review", "system".
0.280
Inheritance ↗ Q200303 EXACT TITLE
civilindividualslegalrights
SHARED TOKENS (4): "civil", "individuals", "legal", "rights". | EXACT TITLE in legal: "Inheritance".
0.280
americancivileducationfederalgovernmentindividualsjusticelocalprimaryrequiresrightrightssectionvia
SHARED TOKENS (14): "american", "civil", "education", "federal", "government", "individuals", "justice", "local", "primary", "requires", "right", "rights", "section", "via".
0.280
additionaladministeredcompletecontinuingdepartmenteducationfederalgovernmentmedicalprogramresidencyschooltotaltraining
SHARED TOKENS (14): "additional", "administered", "complete", "continuing", "department", "education", "federal", "government", "medical", "program", "residency", "school", "total", "training".
0.280
Annexation ↗ Q194465 EXACT TITLE
legalphysicalrecognizedtitle
SHARED TOKENS (4): "legal", "physical", "recognized", "title". | EXACT TITLE in legal: "Annexation".
0.280
americanbarbranchfoundedheadquarterslegalmembersnationalofficeorganizationprofessionalsinglethirdwashington
SHARED TOKENS (14): "american", "bar", "branch", "founded", "headquarters", "legal", "members", "national", "office", "organization", "professional", "single", "third", "washington".
0.280
analysiscombinedcontextdevelopmentenvironmentglobalgovernmentinstitutionsknowledgeorganizationpartnerspublicrightstechnology
SHARED TOKENS (14): "analysis", "combined", "context", "development", "environment", "global", "government", "institutions", "knowledge", "organization", "partners", "public", "rights", "technology".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
Felony ↗ Q178844 EXACT TITLE
additionalcivilland
SHARED TOKENS (3): "additional", "civil", "land". | EXACT TITLE in legal: "Felony".
0.260
criminallegalpresence
SHARED TOKENS (3): "criminal", "legal", "presence". | EXACT TITLE in legal: "Manslaughter".
0.260
Student affairs ↗ KW CROSS HIGH
departmentdepartmentsdevelopmenteducationgrowthinstitutionsorganizationprofessionalsstudentsupporttitleuniversitywork
SHARED TOKENS (13): "department", "departments", "development", "education", "growth", "institutions", "organization", "professionals", "student", "support", "title", "university", "work".
0.260
accessbusinesscommunitydisclosureemploymentformerindividualsknowledgelegalpaidprogramsignedsingle
SHARED TOKENS (13): "access", "business", "community", "disclosure", "employment", "former", "individuals", "knowledge", "legal", "paid", "program", "signed", "single".
0.250
branchelectedgovernmentidahooffice
SHARED TOKENS (5): "branch", "elected", "government", "idaho", "office". | URL->B (1): https://sos.idaho.gov/.
0.240
alongsideeducationexperiencefallslargestoperatesprogramschoolstudentuniversityworkworld
SHARED TOKENS (12): "alongside", "education", "experience", "falls", "largest", "operates", "program", "school", "student", "university", "work", "world".
0.240
assistancebillcommunitycriminaldistrictgovernmentmonthspublicrequirementrequiresrightrights
SHARED TOKENS (12): "assistance", "bill", "community", "criminal", "district", "government", "months", "public", "requirement", "requires", "right", "rights".
0.240
additionalalongsideeducationmedicalnotableoperatingprogramresidencyschoolsciencessystemtraining
SHARED TOKENS (12): "additional", "alongside", "education", "medical", "notable", "operating", "program", "residency", "school", "sciences", "system", "training".
0.240
employersestablishedfederalformationgovernmentindependentlabormembersnationalorganizationrightsigned
SHARED TOKENS (12): "employers", "established", "federal", "formation", "government", "independent", "labor", "members", "national", "organization", "right", "signed".
0.240
agenciesbillcivilfreefreedomgovernmentpresspriorrightrightsschoolthird
SHARED TOKENS (12): "agencies", "bill", "civil", "free", "freedom", "government", "press", "prior", "right", "rights", "school", "third".
0.240
classcorporateexperiencefreefreedomfullgovernmentjusticeoperationspresenceresourcestraining
SHARED TOKENS (12): "class", "corporate", "experience", "free", "freedom", "full", "government", "justice", "operations", "presence", "resources", "training".
0.240
annualeducationfederalgovernmentindependentmedicalmembersnationaloperationsplanningresponsiblesciences
SHARED TOKENS (12): "annual", "education", "federal", "government", "independent", "medical", "members", "national", "operations", "planning", "responsible", "sciences".
0.240
Labour law ↗ Q628967 KW CROSS HIGH
agenciescodeemployersemploymentformergovernmentlaborlegislatureminimumregulatoryrightswork
SHARED TOKENS (12): "agencies", "code", "employers", "employment", "former", "government", "labor", "legislature", "minimum", "regulatory", "rights", "work".
0.240
classdevelopmenteducationfamilyleadmembermembersprimaryresponsibleschoolstudentuniversity
SHARED TOKENS (12): "class", "development", "education", "family", "lead", "member", "members", "primary", "responsible", "school", "student", "university".
0.240
activecodecourtscreateddistrictdistrictseffectivefederalgovernmentmatterssystemwest
SHARED TOKENS (12): "active", "code", "courts", "created", "district", "districts", "effective", "federal", "government", "matters", "system", "west".
0.240
barbodybusinesscouncilgenerallegalmembersphysicalprofessionalpublicresponsibleserving
SHARED TOKENS (12): "bar", "body", "business", "council", "general", "legal", "members", "physical", "professional", "public", "responsible", "serving".
0.240
businessestatefinancialgeneralindependentlandlegalraterealrequirementsystemtitle
SHARED TOKENS (12): "business", "estate", "financial", "general", "independent", "land", "legal", "rate", "real", "requirement", "system", "title".
0.240
combineddevelopmenteducationemploymentgeneralinstitutionsjusticeplanningprofessionalrelationshipssupportwork
SHARED TOKENS (12): "combined", "development", "education", "employment", "general", "institutions", "justice", "planning", "professional", "relationships", "support", "work".
0.240
addressbodydisclosureemploymentfinancialgovernmentinstitutionsorganizationpublicresourcesthirdwork
SHARED TOKENS (12): "address", "body", "disclosure", "employment", "financial", "government", "institutions", "organization", "public", "resources", "third", "work".
0.240
billcriminalfederalgovernmentlocalmainpublicrequirementrequiresrightrightsserve
SHARED TOKENS (12): "bill", "criminal", "federal", "government", "local", "main", "public", "requirement", "requires", "right", "rights", "serve".
0.220
employersemploymentgrouporganizationpayreachrightssafetysingletrainingwork
SHARED TOKENS (11): "employers", "employment", "group", "organization", "pay", "reach", "rights", "safety", "single", "training", "work".
0.220
Family law ↗ Q384014 EXACT TITLE
familymatters
SHARED TOKENS (2): "family", "matters". | EXACT TITLE in legal: "Family law".
0.220
addressadministeredassistanceenvironmentalfederalownedphysicalprimaryqualityviawater
SHARED TOKENS (11): "address", "administered", "assistance", "environmental", "federal", "owned", "physical", "primary", "quality", "via", "water".
0.220
bodybranchindustriesmembersnationalorganizationprocessingprofessionalprojecttechnologywork
SHARED TOKENS (11): "body", "branch", "industries", "members", "national", "organization", "processing", "professional", "project", "technology", "work".
0.220
codeemploymentenvironmentgeneralkeylegalpersonalphysicalprofessionalrelationshipswork
SHARED TOKENS (11): "code", "employment", "environment", "general", "key", "legal", "personal", "physical", "professional", "relationships", "work".
0.220
advocatebusinesscourtsemployersformerindividualsindustrylaborlegalsupportsystem
SHARED TOKENS (11): "advocate", "business", "courts", "employers", "former", "individuals", "industry", "labor", "legal", "support", "system".
0.220
departmentsenvironmentfinancialgovernmenthighestindividualsnationalpressrateratesstreet
SHARED TOKENS (11): "departments", "environment", "financial", "government", "highest", "individuals", "national", "press", "rate", "rates", "street".
0.220
Grand jury ↗ Q1323789 KW CROSS HIGH
civilcourtscriminalindependentlegalmattersmembersphysicalpublicreviewserve
SHARED TOKENS (11): "civil", "courts", "criminal", "independent", "legal", "matters", "members", "physical", "public", "review", "serve".
0.220
Tuition ↗ Q129529471 EXACT TITLE
educationfees
SHARED TOKENS (2): "education", "fees". | EXACT TITLE in education: "Tuition".
0.220
agenciesbodyeffectivefoodgovernmenthealthcareindependentofficeregulatoryresponsiblesafety
SHARED TOKENS (11): "agencies", "body", "effective", "food", "government", "healthcare", "independent", "office", "regulatory", "responsible", "safety".
0.220
communityfoodfreefreedomlegalmembernationalpublicrecognizedrightrights
SHARED TOKENS (11): "community", "food", "free", "freedom", "legal", "member", "national", "public", "recognized", "right", "rights".
0.220
criticaleducationemphasisemployersinstitutionskeyknowledgememberspublicstudentuniversity
SHARED TOKENS (11): "critical", "education", "emphasis", "employers", "institutions", "key", "knowledge", "members", "public", "student", "university".
0.200
createddistrictdistrictsgovernmentirrigationlegislaturelocalprojectspublicwater
SHARED TOKENS (10): "created", "district", "districts", "government", "irrigation", "legislature", "local", "projects", "public", "water".
0.200
accesseducationenvironmentnetworkonlineprogramschoolstudentviaworld
SHARED TOKENS (10): "access", "education", "environment", "network", "online", "program", "school", "student", "via", "world".
0.200
Dentistry ↗ Q12128 KW CROSS HIGH
branchcomplexdevelopmenthistoryinstitutionsjointmedicalprimarywaterwork
SHARED TOKENS (10): "branch", "complex", "development", "history", "institutions", "joint", "medical", "primary", "water", "work".
0.200
Attorney ↗ Q1289214 EXACT TITLE
south
EXACT TITLE in legal: "Attorney".
0.200
Raptor ↗ Q137956 EXACT TITLE
raptor
EXACT TITLE in education: "Raptor".
0.200
EXACT TITLE in legal: "Subdivision".
0.200
contextcontinuingeducationgeneralmedicalpopulationprimarypublictrainingwork
SHARED TOKENS (10): "context", "continuing", "education", "general", "medical", "population", "primary", "public", "training", "work".
0.200
Due process ↗ Q1068288 KW CROSS HIGH
agenciesamericancourtsgovernmentjusticelandlegalnaturalrequirementrights
SHARED TOKENS (10): "agencies", "american", "courts", "government", "justice", "land", "legal", "natural", "requirement", "rights".
0.200
Plea bargain ↗ Q664736 KW CROSS HIGH
civilcourtscriminalfinaljusticelegallocalpublicresourcesserves
SHARED TOKENS (10): "civil", "courts", "criminal", "final", "justice", "legal", "local", "public", "resources", "serves".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in education: "Will". | EXACT TITLE in legal: "Will".
0.200
educationgovernmentinstitutionsnationalnonprofitownedpublicstudentuniversityworld
SHARED TOKENS (10): "education", "government", "institutions", "national", "nonprofit", "owned", "public", "student", "university", "world".
0.200
civilemployersemploymentestablishedfederalgovernmentnationalpriorrightsvia
SHARED TOKENS (10): "civil", "employers", "employment", "established", "federal", "government", "national", "prior", "rights", "via".
0.200
Paternity ↗ Q16881001 EXACT TITLE
EXACT TITLE in legal: "Paternity".
0.200
civilcourtscriminalirrigationlandlegalresponsiblestandardsystemwater
SHARED TOKENS (10): "civil", "courts", "criminal", "irrigation", "land", "legal", "responsible", "standard", "system", "water".
0.180
americanbrancheducationfullmedicalrightsschooltrainingwork
SHARED TOKENS (9): "american", "branch", "education", "full", "medical", "rights", "school", "training", "work".
0.180
Legal guardian ↗ Q157509 KW CROSS HIGH
criticalfamilylegalmedicalmemberpersonalprofessionalpublicserve
SHARED TOKENS (9): "critical", "family", "legal", "medical", "member", "personal", "professional", "public", "serve".
0.180
Family court ↗ Q82749 KW CROSS HIGH
addresscourtscreatedfamilylegalmattersrelationshipssupportsystem
SHARED TOKENS (9): "address", "courts", "created", "family", "legal", "matters", "relationships", "support", "system".
0.180
americancourtsgeneralindividualslegalpublicrightsystemthird
SHARED TOKENS (9): "american", "courts", "general", "individuals", "legal", "public", "right", "system", "third".
0.180
Expungement ↗ Q2352928 KW CROSS HIGH
criminalfederalgeneralgovernorlegalpriorpublicrecordsreview
SHARED TOKENS (9): "criminal", "federal", "general", "governor", "legal", "prior", "public", "records", "review".
0.180
Civil liberties ↗ Q29556 KW CROSS HIGH
advocatecivilfreedomgovernmentpersonalpressrightrightswork
SHARED TOKENS (9): "advocate", "civil", "freedom", "government", "personal", "press", "right", "rights", "work".
0.180
activecontexteducationexperiencefrontgeneralknowledgerequireswork
SHARED TOKENS (9): "active", "context", "education", "experience", "front", "general", "knowledge", "requires", "work".
0.180
Overtime ↗ Q667022 KW CROSS HIGH
employersemploymentnationalpayrateratesreceivedsupplywork
SHARED TOKENS (9): "employers", "employment", "national", "pay", "rate", "rates", "received", "supply", "work".
0.180
americancouncilcreateddataeducationinstitutionsnationalservessystem
SHARED TOKENS (9): "american", "council", "created", "data", "education", "institutions", "national", "serves", "system".
0.180
businesscorporateeducationgeneralprofessionalprogramqualityrequiresstandard
SHARED TOKENS (9): "business", "corporate", "education", "general", "professional", "program", "quality", "requires", "standard".
0.180
collegecommunityeducationgeneralindividualsknowledgeschooltechnologytraining
SHARED TOKENS (9): "college", "community", "education", "general", "individuals", "knowledge", "school", "technology", "training".
0.180
advocateamericancivilcriminalleadinglegalmattersmemberpublic
SHARED TOKENS (9): "advocate", "american", "civil", "criminal", "leading", "legal", "matters", "member", "public".
0.180
Easement ↗ Q448405 KW CROSS HIGH
accessbestlandownedpublicrealrightrightsthird
SHARED TOKENS (9): "access", "best", "land", "owned", "public", "real", "right", "rights", "third".
0.180
americanaugustgovernoridaholabormemberpaidservingwestern
SHARED TOKENS (9): "american", "august", "governor", "idaho", "labor", "member", "paid", "serving", "western".
0.180
Student loan ↗ Q462058 KW CROSS HIGH
aideducationfeesfinancialpayrateschoolstudentsystem
SHARED TOKENS (9): "aid", "education", "fees", "financial", "pay", "rate", "school", "student", "system".
0.180
Road transport ↗ KW CROSS HIGH
developmentfoodfullindustrieslocalsafetyspecialiststandardvia
SHARED TOKENS (9): "development", "food", "full", "industries", "local", "safety", "specialist", "standard", "via".
0.180
codecourtsdistrictfederalgovernedgovernsrightssectiontitle
SHARED TOKENS (9): "code", "courts", "district", "federal", "governed", "governs", "rights", "section", "title".
0.180
Private equity ↗ Q476115 KW CROSS HIGH
activebusinessdevelopmentexpansionfinancialfundgeneralpresspublic
SHARED TOKENS (9): "active", "business", "development", "expansion", "financial", "fund", "general", "press", "public".
0.160
criminalfactsknowledgelegalrequirementrightsearchstandard
SHARED TOKENS (8): "criminal", "facts", "knowledge", "legal", "requirement", "right", "search", "standard".
0.160
Magistrate ↗ Q4594605 KW CROSS HIGH
civilcriminalgovernmenthighestlocalmattersresponsibleworld
SHARED TOKENS (8): "civil", "criminal", "government", "highest", "local", "matters", "responsible", "world".
0.160
criminaljusticelegalmainpaidpublicratesystem
SHARED TOKENS (8): "criminal", "justice", "legal", "main", "paid", "public", "rate", "system".
0.160
educationenvironmentmedicalprofessionalsprogramresidencytraininguniversity
SHARED TOKENS (8): "education", "environment", "medical", "professionals", "program", "residency", "training", "university".
0.160
Complaint ↗ Q836925 KW CROSS HIGH
civilcourtscriminalfactsfederaljusticelegalsupport
SHARED TOKENS (8): "civil", "courts", "criminal", "facts", "federal", "justice", "legal", "support".
0.160
Drug court ↗ Q5308883 KW CROSS HIGH
addressbarcombinedcourtscriminalleadingpublicwork
SHARED TOKENS (8): "address", "bar", "combined", "courts", "criminal", "leading", "public", "work".
0.160
U visa ↗ Q17086349 KW CROSS HIGH
agenciescreatedcriminalfamilygovernmentmembersphysicalserve
SHARED TOKENS (8): "agencies", "created", "criminal", "family", "government", "members", "physical", "serve".
0.160
branchcollegegovernancemainprimaryregionalresourcesuniversity
SHARED TOKENS (8): "branch", "college", "governance", "main", "primary", "regional", "resources", "university".
0.160
Debtor ↗ Q157470 KW CROSS HIGH
familyfullgovernmentlegalpaidpaypersonalrequires
SHARED TOKENS (8): "family", "full", "government", "legal", "paid", "pay", "personal", "requires".
0.160
americanfulllegalpriorrightrightssystemwater
SHARED TOKENS (8): "american", "full", "legal", "prior", "right", "rights", "system", "water".
0.160
Foreclosure ↗ Q231710 KW CROSS HIGH
completecourtsfeeslegalpayrealrighttitle
SHARED TOKENS (8): "complete", "courts", "fees", "legal", "pay", "real", "right", "title".
0.160
americanemploymentindividualsjuneresidencyrightsupportwork
SHARED TOKENS (8): "american", "employment", "individuals", "june", "residency", "right", "support", "work".
0.160
analysisbodycivilcourtscriminalfulllegalrequires
SHARED TOKENS (8): "analysis", "body", "civil", "courts", "criminal", "full", "legal", "requires".
0.160
codecourtsfinancialgeneralpaypersonalsectiontitle
SHARED TOKENS (8): "code", "courts", "financial", "general", "pay", "personal", "section", "title".
0.160
Probation ↗ Q13961 KW CROSS HIGH
communitycontactcourtscriminalformerpartnerpayprogram
SHARED TOKENS (8): "community", "contact", "courts", "criminal", "former", "partner", "pay", "program".
0.160
Probate court ↗ Q7246899 KW CROSS HIGH
countiescourtscreateddistrictestatemattersmedicationpersonal
SHARED TOKENS (8): "counties", "courts", "created", "district", "estate", "matters", "medication", "personal".
0.140
adaboisegovernmentidahomainpopulationstreet
SHARED TOKENS (7): "ada", "boise", "government", "idaho", "main", "population", "street".
0.140
civilcourtscriminaldistrictdistrictsfederalresidents
SHARED TOKENS (7): "civil", "courts", "criminal", "district", "districts", "federal", "residents".
0.140
Criminal law ↗ Q146491 KW CROSS HIGH
bodycivilcriminalemphasisestablishedlegislaturesafety
SHARED TOKENS (7): "body", "civil", "criminal", "emphasis", "established", "legislature", "safety".
0.140
additionalcriminalemployershistorynationalrecordsvia
SHARED TOKENS (7): "additional", "criminal", "employers", "history", "national", "records", "via".
0.140
agenciescriminalfederalfinancialindustryprimaryregulatory
SHARED TOKENS (7): "agencies", "criminal", "federal", "financial", "industry", "primary", "regulatory".
0.140
Discrimination ↗ Q169207 KW CROSS HIGH
classgroupinstitutionslegalmembersrightsworld
SHARED TOKENS (7): "class", "group", "institutions", "legal", "members", "rights", "world".
0.140
educationfederalinstitutionsnonprofitpublicstudenttotal
SHARED TOKENS (7): "education", "federal", "institutions", "nonprofit", "public", "student", "total".
0.140
bodydistrictlegalownedpublicregulatoryserves
SHARED TOKENS (7): "body", "district", "legal", "owned", "public", "regulatory", "serves".
0.140
clientseffectivefulllegaloldestprofessionalright
SHARED TOKENS (7): "clients", "effective", "full", "legal", "oldest", "professional", "right".
0.140
combinedcompletehealthcarelegalmedicalpersonalsingle
SHARED TOKENS (7): "combined", "complete", "healthcare", "legal", "medical", "personal", "single".
0.140
Lawsuit ↗ Q697327 KW CROSS HIGH
businesscivilcriminalindividualslegalpublicright
SHARED TOKENS (7): "business", "civil", "criminal", "individuals", "legal", "public", "right".
0.140
Beneficiary ↗ Q2596417 KW CROSS HIGH
aidcontextcreateddevelopmentlegalprimaryprojects
SHARED TOKENS (7): "aid", "context", "created", "development", "legal", "primary", "projects".
0.140
courtsfactsfullrealstandardsupportvia
SHARED TOKENS (7): "courts", "facts", "full", "real", "standard", "support", "via".
0.140
departmenteducationindependentnorthwestorganizationrecognizeduniversity
SHARED TOKENS (7): "department", "education", "independent", "northwest", "organization", "recognized", "university".
0.120
Tort ↗ Q158970 KW CROSS HIGH
civilcodecriminalestablishedindividualslegal
SHARED TOKENS (6): "civil", "code", "criminal", "established", "individuals", "legal".
0.120
Deed ↗ Q705914 KW CROSS HIGH
legalrightrightssignedthirdtitle
SHARED TOKENS (6): "legal", "right", "rights", "signed", "third", "title".
0.120
corporatefinancialgovernmentindividualslaborprofessionals
SHARED TOKENS (6): "corporate", "financial", "government", "individuals", "labor", "professionals".
0.120
aidcollegefinancialschooluniversityworld
SHARED TOKENS (6): "aid", "college", "financial", "school", "university", "world".
0.120
americancollegecreatedlistedprogramschool
SHARED TOKENS (6): "american", "college", "created", "listed", "program", "school".
0.120
Damages ↗ Q308922 KW CROSS HIGH
generallegalmedicalpaidphysicalrecognized
SHARED TOKENS (6): "general", "legal", "medical", "paid", "physical", "recognized".
0.120
civilfreelegalpublicrightsearch
SHARED TOKENS (6): "civil", "free", "legal", "public", "right", "search".
0.120
Machine learning ↗ Q2539 KW CROSS HIGH
analysisclassdatadeepdevelopmentexplicitly
SHARED TOKENS (6): "analysis", "class", "data", "deep", "development", "explicitly".
0.120
addresscivilgovernedlegalrealrights
SHARED TOKENS (6): "address", "civil", "governed", "legal", "real", "rights".
0.120
educationhomeonlineresourcesschooltechnology
SHARED TOKENS (6): "education", "home", "online", "resources", "school", "technology".
0.100
Alimony ↗ Q368305 KW CROSS HIGH
familyfinanciallegalnorthernsupport
SHARED TOKENS (5): "family", "financial", "legal", "northern", "support".
0.100
Wage theft ↗ Q7959502 KW CROSS HIGH
annualemployersindependentpaywork
SHARED TOKENS (5): "annual", "employers", "independent", "pay", "work".
0.100
federallegalofficepriorreview
SHARED TOKENS (5): "federal", "legal", "office", "prior", "review".
0.100
Injunction ↗ Q6495575 KW CROSS HIGH
civilcourtscriminalfulllegal
SHARED TOKENS (5): "civil", "courts", "criminal", "full", "legal".
0.100
codefederalgovernssectiontitle
SHARED TOKENS (5): "code", "federal", "governs", "section", "title".
◈ Frequently Asked Questions
Education × Legal — Treasure Valley
HAIKU · HIGH GATE
Where can students in the Treasure Valley earn a Juris Doctor degree?
The University of Idaho College of Law, located in Moscow, serves students across Idaho including those from Ada County and Canyon County in the Treasure Valley. This is the only law school in the state offering the Juris Doctor program.
What legal education resources exist in Boise and Caldwell for Treasure Valley residents?
Boise State University partners with regional legal institutions and offers programs that connect undergraduates in Ada County to pre-law pathways. The University of Idaho College of Law maintains connections with Treasure Valley communities including Nampa, Eagle, and Meridian through continuing education and public service programs.
How do Canyon County and Ada County residents access law school preparation through higher education?
Boise State University provides undergraduate education in Ada County that prepares students for law school applications, while Canyon County students in Nampa and Caldwell can access similar preparation through the university's satellite programs. The University of Idaho College of Law specifically recruits from these Treasure Valley counties.
What role does Boise State University play in legal education for the Treasure Valley?
Boise State University in Ada County offers pre-law advising and courses that prepare Treasure Valley undergraduate students for the Juris Doctor program at the University of Idaho College of Law. The university maintains partnerships with legal professionals across Boise, Nampa, and surrounding communities to support legal career pathways.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Education × Legal 12 QID bridges 268 edges 8,305 ext links 2026-07-17 20:29:13 UTC b4588fd404f92544
Education corridor ↗ Legal corridor ↗ Legal × Education ↗ boisestandard.org/standard ↗
Parent Corridors
Education × All Other Verticals