—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Cleaning Services ↔ relates to ↔ Energy Utilities

28 Wikipedia bridge articles confirmed in both vertical ledgers. 272 deterministic cross-vertical edges. 7,181 external source links harvested. Every edge provenance-stamped. Every claim auditable.

28 QID Bridge Articles
272 Cross Edges
7,181 External Sources
313 Wikipedia Articles
29 🌲 Evergreen
207 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Cleaning Services
× Energy Utilities
QID Bridge Articles
28
confirmed Wikipedia overlap
Total Cross Edges
272
External Sources Harvested
7,181
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Safe Drinking Water Act
score: 1.0000  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (20)
Safe Drinking Water ActWastewaterStormwaterApprenticeshipBureau of Labor StatisticsClean Water ActCollege of Western IdahoTreasure ValleyHazardous wasteEnvironmental remediationBoise metropolitan areaUnited States Environmental Protection AgencySewage treatmentHeating, ventilation, and air conditioningSanitary sewerPrivate equityBoise RiverNampa, IdahoBoise, IdahoMunicipal solid waste
Shared Semantics (20 tokens)
idahopopulationboisemetropolitanadapublicwaterwastetreatmentenvironmentalqualitymunicipallandmajorlocalcanyonnorthwestfederalsystemsystems
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:56:14 UTC
Content Hash
e9a472bee0929bff
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
28 BRIDGES
Safe Drinking Water Act
Q7398466 EXACT TITLE 1.000
QID OVERLAP: Q7398466 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (21): "act", "administration", "applies", "apply", "environmental", "epa", "federal", "food", "law", "private", "protection", "providing", "public", "quality", "regulated", "served", "set", "standards", "system", "systems".... | EXACT TITLE in energy_utilities: "Safe Drinking Water Act".
actadministrationappliesapplyenvironmentalepafederalfoodlawprivateprotectionprovidingpublicqualityregulatedservedsetstandardssystemsystemswater
The Safe Drinking Water Act (SDWA) is the primary federal law in the United States intended to ensure safe drinking water for the public. Pursuant to the act, the Environmental Protection Agency (EPA) is required to set standards for drinking water quality and oversee all states, localities, and water suppliers that implement the standards. The SDWA applies to every public water system (PWS) in the United States. There are currently over 148,000 public water systems providing water to almost all Americans at some time in their lives. The Act does not cover private wells (in 2020, 13% of US households were served by private wells). The SDWA does not apply to bottled water.
he SDWA applies to every public water system (PWS) in the United States. There are currently over 148,000 public water systems providing water to almost all Americans at some time in their lives. The Act does not cover private wells (in 2020, 13% of US households were served by private wells). The SDWA does not apply to bottled water.
US households were served by private wells). The SDWA does not apply to bottled water. Bottled water is regulated by the Food and Drug Administration (FDA), under the Federal Food, Drug, and Cosmetic Act. National Primary Drinking Water Regulations The SDWA requires EPA to establish National Primary Drinking Water Regulations (NPDWRs) for contaminants that may cause adverse public health effects. The regulations include both mandatory requirements (Maximum Contaminant Levels, or MCLs; and Treatment Techniques) and nonenforceable health goals (Maximum Contaminant Level Goals, or MCLGs) for each included contaminant. As of 2019 EPA has issued 88 standards for microorganisms, chemicals and radionuclides. MCLs have additional significance because they can be used under the Superfund law as "Applicable or Relevant and Appropriate Requirements" in cleanups of contaminated sites on the National Priorities List. For some contaminants, EPA establishes a Treatment Technique (TT) instead of an MCL.
Wastewater
Q336191 EXACT TITLE 1.000
QID OVERLAP: Q336191 in cleaning_services (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (16): "activities", "another", "applications", "combination", "commercial", "definition", "domestic", "industrial", "municipal", "processes", "sewer", "storm", "surface", "waste", "wastewater", "water". | EXACT TITLE in cleaning_services: "Wastewater". | EXACT TITLE in energy_utilities: "Wastewater".
activitiesanotherapplicationscombinationcommercialdefinitiondomesticindustrialmunicipalprocessessewerstormsurfacewastewastewaterwater
w water, or saline water in a variety of deliberate applications or processes. Another definition of wastewater is "Used water from any combination of domestic, industrial, commercial or agricultural activities, surface runoff / storm water, and any sewer infiltration or sewer inflow".
Stormwater
Q1421263 EXACT TITLE 1.000
QID OVERLAP: Q1421263 in cleaning_services (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (21): "become", "create", "demand", "directly", "falls", "land", "large", "major", "pollutants", "population", "potentially", "related", "resource", "soil", "storm", "stormwater", "surface", "treatment", "urban", "volume".... | EXACT TITLE in cleaning_services: "Stormwater". | EXACT TITLE in energy_utilities: "Stormwater".
becomecreatedemanddirectlyfallslandlargemajorpollutantspopulationpotentiallyrelatedresourcesoilstormstormwatersurfacetreatmenturbanvolumewater
Stormwater, also written storm water, is water that originates from precipitation (storm), including heavy rain and meltwater from hail and snow. Stormwater can soak into the soil (infiltrate) and become groundwater, be stored on depressed land surface in ponds and puddles, evaporate back into the atmosphere, or contribute to surface runoff. Most runoff is conveyed directly as surface water to nearby streams, rivers or other large water bodies (wetlands, lakes and oceans) without treatment. In natural landscapes, such as forests, soil absorbs much of the stormwater. Plants also reduce stormwater by improving infiltration, intercepting precipitation as it falls, and by taking up water through their roots. In developed environments, such as cities, unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
Stormwater creation of sinkhole collapses An example of urban stormwater creating a sinkhole collapse is the February 25, 2002 Dishman Lane collapse in Bowling Green, Kentucky where a sinkhole suddenly dropped the road under four traveling vehicles. The nine-month repair of the Dishman Lane collapse cost a million dollars but there remains the potential for future problems. In undisturbed areas with natural subsurface (karst) drainage, soil and rock fragments choke karst openings, thereby being a self-limitation to the growth of openings. The undisturbed karst drainage system becomes balanced with the climate so it can drain the water produced by most storms. However, problems occur when the landscape is altered by urban development. In urban areas with natural subsurface karst drainage there are no surface streams for the increased stormwater from impervious surfaces such as roofs, parking lots, and streets to receive drainage. Instead, the stormwater enters the subsurface drainage system by moving down through the ground. When the subsurface water flow becomes great enough to transport soil and rock fragments, the karst openings grow rapidly. Where karst openings are roofed by supportive (competent) limestone, there frequently is no surface warning that an opening has grown so large it will suddenly collapse catastrophically. It is recommended that land-use planning agencies avoid karst areas when considering new development projects.
so reduce stormwater by improving infiltration, intercepting precipitation as it falls, and by taking up water through their roots. In developed environments, such as cities, unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in cleaning_services (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (17): "apprenticeship", "boundaries", "certification", "competence", "field", "formal", "labor", "level", "license", "outside", "professional", "reach", "regulated", "system", "trade", "training", "vary". | EXACT TITLE in cleaning_services: "Apprenticeship". | EXACT TITLE in energy_utilities: "Apprenticeship".
apprenticeshipboundariescertificationcompetencefieldformallaborlevellicenseoutsideprofessionalreachregulatedsystemtradetrainingvary
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Bureau of Labor Statistics
Q2928428 EXACT TITLE 1.000
QID OVERLAP: Q2928428 in cleaning_services (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (31): "accuracy", "agencies", "american", "bls", "bureau", "businesses", "coordination", "current", "data", "department", "economic", "economics", "federal", "field", "labor", "levels", "local", "maintain", "major", "management".... | EXACT TITLE in cleaning_services: "Bureau of Labor Statistics". | EXACT TITLE in energy_utilities: "Bureau of Labor Statistics".
accuracyagenciesamericanblsbureaubusinessescoordinationcurrentdatadepartmenteconomiceconomicsfederalfieldlaborlevelslocalmaintainmajormanagementneedofficeprocessespublicqualityresearchresourceservesstatisticssubject+1
sfactory quality of life. BLS data must satisfy a number of criteria, including relevance to current social and economic issues, timeliness in reflecting today's rapidly changing economic conditions, accuracy and consistently high statistical quality, impartiality in both subject matter and presentation, and accessibility to all.
a principal agency of the U.S. federal statistical system. The BLS collects, processes, analyzes, and disseminates essential statistical data to the American public, the U.S. Congress, other Federal agencies, state and local governments, businesses, and labor representatives. The BLS also serves as a statistical resource to the United States Department of Labor, and conducts research measuring the income levels families need to maintain a satisfactory quality of life. BLS data must satisfy a number of criteria, including relevance to current social and economic issues, timeliness in reflecting today's rapidly changing economic conditions, accuracy and consistently high statistical quality, impartiality in both subject matter and presentation, and accessibility to all.
Current Employment Statistics (CES) This program produces detailed industry estimates of nonfarm employment, hours, and earnings of workers on payrolls. CES National Estimates (CES-N) produces data for the nation, and CES State and Metro Area (CES-SA) produces estimates for all 50 States, the District of Columbia, Puerto Rico, the Virgin Islands, and about 450 metropolitan areas and divisions. Each month, CES surveys approximately 121,000 businesses and government agencies, representing approximately 631,000 individual worksites, drawn from a sampling frame of unemployment insurance tax accounts. Both programs use the same sample and collection methods. Participation in the survey is voluntary under federal law, but it is mandatory in California, New Mexico, Ohio, Oregon, South Carolina, and Puerto Rico. The South Carolina requirement applies to firms with more than 20 employees. The businesses report data on employment, hours, and earnings for all paid workers from their payroll records. The data is collected for the pay period that includes the 12th of the month (regardless of its length), via a form sent to workplaces, by telephone, and online (but not by email, for security reasons). For its monthly estimation, the CES-N program uses a matched sample concept and weighted sample data to produce employment, hours, and earnings estimates. Regarding its reliability, the CES survey, like other sample surveys, is subject to two types of error: sampling and nonsampling error. The magnitude of sampling error, or variance, is directly related to the size of the sample and the percentage of universe coverage achieved by the sample. The CES sample covers over one-third of total universe employment, yielding a very small variance for the total nonfarm estimates.
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (31): "act", "address", "addressing", "changes", "chemical", "clean", "control", "coordination", "directly", "environmental", "epa", "federal", "form", "governing", "law", "maintain", "major", "name", "owned", "physical".... | EXACT TITLE in energy_utilities: "Clean Water Act".
actaddressaddressingchangeschemicalcleancontrolcoordinationdirectlyenvironmentalepafederalformgoverninglawmaintainmajornameownedphysicalprotectionprovidingprovisionsqualityrecoveryresourcethoughtreatmentwastewaterwater+1
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in cleaning_services (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (24): "ada", "board", "boise", "canyon", "classes", "college", "counties", "education", "fall", "idaho", "large", "nampa", "population", "programs", "public", "reported", "served", "southern", "technical", "throughout".... | EXACT TITLE in cleaning_services: "College of Western Idaho". | EXACT TITLE in energy_utilities: "College of Western Idaho".
adaboardboisecanyonclassescollegecountieseducationfallidaholargenampapopulationprogramspublicreportedservedsoutherntechnicalthroughouttreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in cleaning_services (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (11): "association", "boise", "idaho", "land", "local", "metropolitan", "name", "region", "treasure", "valley", "western". | EXACT TITLE in cleaning_services: "Treasure Valley". | EXACT TITLE in energy_utilities: "Treasure Valley".
associationboiseidaholandlocalmetropolitannameregiontreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Hazardous waste
Q1069369 EXACT TITLE 0.880
QID OVERLAP: Q1069369 in cleaning_services (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (9): "environment", "hazardous", "international", "local", "materials", "national", "produces", "regulated", "waste". | EXACT TITLE in cleaning_services: "Hazardous waste".
environmenthazardousinternationallocalmaterialsnationalproducesregulatedwaste
Hazardous waste is waste that can damage human health or the environment. Waste can be hazardous because it is toxic, reactive, or corrosive, etc. As of 2022, humanity produces 300–500 million metric tons of hazardous waste annually. Some common sources of hazardous wastes are solvents, batteries, and byproducts of metal refining.
Global goals The UN has a mandate on hazardous substances and wastes with recommendations to countries for dealing with hazardous waste. 199 countries signed the 1992 Basel Convention, seeking to stop the flow of hazardous waste from developed countries to developing countries with less stringent environmental regulations. The international community has defined the responsible management of hazardous waste and chemicals as an important part of sustainable development by including it in Sustainable Development Goal 12. Target 12.4 of this goal is to "achieve the environmentally sound management of chemicals and all wastes throughout their life cycle".
In the US, hazardous wastes are regulated under the Resource Conservation and Recovery Act (RCRA), Subtitle C. Hazardous wastes are wastes with properties that make them dangerous or potentially harmful to human health or the environment. Hazardous wastes can be liquids, solids, contained gases, or sludges. They can be by-products of manufacturing processes or simply discarded commercial products, like cleaning fluids or pesticides. In regulatory terms, RCRA hazardous wastes are wastes that appear on one of the four hazardous wastes lists (F-list, K-list, P-list, or U-list), or exhibit at least one of the following four characteristics; ignitability, corrosivity, reactivity, or toxicity. By definition, EPA determined that some specific wastes are hazardous. These wastes are incorporated into lists published by the Agency.
Environmental remediation
Q2019586 QID OVERLAP 0.800
QID OVERLAP: Q2019586 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (27): "another", "application", "barriers", "construction", "create", "depend", "disposal", "environmental", "field", "generally", "hazardous", "industry", "land", "materials", "media", "municipal", "physical", "pressure", "program", "programs"....
anotherapplicationbarriersconstructioncreatedependdisposalenvironmentalfieldgenerallyhazardousindustrylandmaterialsmediamunicipalphysicalpressureprogramprogramsregulatoryrequirementssoilstandardssubjecttreatmentwaste
ed incentives under state or municipal programs like New York State's Brownfield Cleanup Program. If remediation is done by removal the waste materials are simply transported off-site for disposal at another location. The waste material can also be contained by physical barriers like slurry walls. The use of slurry walls is well-established in the construction industry.
Nanoremediation Using nano-sized reactive agents to degrade or immobilize contaminants is termed nanoremediation. In soil or groundwater nanoremediation, nanoparticles are brought into contact with the contaminant through either in situ injection or a pump-and-treat process. The nanomaterials then degrade organic contaminants through redox reactions or adsorb to and immobilize metals such as lead or arsenic. In commercial settings, this technology has been dominantly applied to groundwater remediation, with research into wastewater treatment. Research is also investigating how nanoparticles may be applied to cleanup of soil and gases. Nanomaterials are highly reactive because of their high surface area per unit mass, and due to this reactivity nanomaterials may react with target contaminants at a faster rate than would larger particles. Most field applications of nanoremediation have used nano zero-valent iron (nZVI), which may be emulsified or mixed with another metal to enhance dispersion. That nanoparticles are highly reactive can mean that they rapidly clump together or react with soil particles or other material in the environment, limiting their dispersal to target contaminants. Some of the important challenges currently limiting nanoremediation technologies include identifying coatings or other formulations that increase dispersal of the nanoparticle agents to better reach target contaminants while limiting any potential toxicity to bioremediation agents, wildlife, or people. Nanotechnology-based advanced oxidation processes in environmental remediation Advanced oxidation processes (AOPs) are a group of physicochemical technologies used in environmental remediation to remove persistent organic pollutants from water and soil, including pharmaceuticals, pesticides, and industrial chemicals. These contaminants are environmentally relevant due to their continuous release, chemical stability, and biological activity, and they are often insufficiently removed by conventional treatment methods such as adsorption or membrane filtration. AOPs are based on the in situ generation of highly reactive oxygen species, primarily hydroxyl radicals (•OH), which exhibit strong and non-selective oxidation capacity and can mineralize organic pollutants into carbon dioxide, water, and inorganic ions. Because they focus on contaminant destruction rather than phase transfer, AOPs are considered an effective alternative to conventional remediation technologies. Among AOPs, heterogeneous photocatalysis has been extensively studied for environmental applications. This process typically employs semiconductor photocatalysts activated by ultraviolet or solar radiation to initiate redox reactions at the catalyst surface. Titanium dioxide (TiO₂) and zinc oxide (ZnO) are the most widely investigated photocatalysts due to their suitable bandgap energies, chemical stability, relatively low toxicity, and cost-effectiveness. Photocatalytic performance is strongly influenced by crystal structure, surface chemistry, and electron–hole recombination dynamics. To improve efficiency, material modification strategies such as metal and non-metal doping, semiconductor coupling, and surface sensitization have been developed to enhance charge separation and extend activity into the visible region of the solar spectrum.
Bioremediation Bioremediation is a process that treats a polluted area either by altering environmental conditions to stimulate growth of microorganisms or through natural microorganism activity, resulting in the degradation of the target pollutants. Broad categories of bioremediation include biostimulation, bioaugmentation, and natural recovery (natural attenuation). Bioremediation is either done on the contaminated site (in situ) or after the removal of contaminated soils at another more controlled site (ex situ). In the past, it has been difficult to turn to bioremediation as an implemented policy solution, as lack of adequate production of remediating microbes led to little options for implementation. Those that manufacture microbes for bioremediation must be approved by the EPA; however, the EPA traditionally has been more cautious about negative externalities that may or may not arise from the introduction of these species.
Boise metropolitan area
Q4938481 QID OVERLAP 0.800
QID OVERLAP: Q4938481 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (18): "ada", "boise", "canyon", "component", "counties", "home", "idaho", "main", "meridian", "metropolitan", "nampa", "nearly", "northwest", "percent", "population", "treasure", "valley", "wider".
adaboisecanyoncomponentcountieshomeidahomainmeridianmetropolitannampanearlynorthwestpercentpopulationtreasurevalleywider
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (30): "around", "department", "education", "energy", "enforcement", "environmental", "epa", "federal", "financial", "independent", "information", "january", "laboratories", "legal", "level", "levels", "local", "measures", "monitoring", "national"....
arounddepartmenteducationenergyenforcementenvironmentalepafederalfinancialindependentinformationjanuarylaboratorieslegallevellevelslocalmeasuresmonitoringnationaloperationpermittingprogramsproposedprotectionpublicregionalresearchspecialistsstandards
ent, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
President Joe Biden appointed Michael S. Regan to be administrator in 2021. Regan began serving on March 11, 2021. In October 2021 EPA announced its "PFAS Strategic Roadmap." PFASs are organofluorine chemical compounds referred to as "forever chemicals". The roadmap is a "whole-of-EPA" strategy and the agency will consider the full life cycle of PFAS, including preventing PFAS from entering the environment, holding polluters accountable, and remediation of contaminated sites. It also will include drinking water monitoring and risk assessment for PFOA and PFOS in biosolids (processed sewage sludge used as fertilizer). In December 2021 EPA issued new greenhouse gas standards for passenger cars and light trucks. The standards, which will reduce climate pollution and improve public health, became effective for the 2023 vehicle model year. In March 2022 the Biden administration allowed California to again set stricter auto emissions standards. In August 2022 the EPA was allotted a listed ~$53.216 billion in funding pursuant to the Inflation Reduction Act (IRA). The EPA listed 24 total initiatives, the most notable among them being greenhouse gas reduction and monitoring, a superfund petroleum tax, replacing current heavy-duty vehicles with zero-emission vehicles, and a methane incentive program. On February 3, 2023, more than 100 train cars were derailed in East Palestine, and around half of those cars containing chemicals like butyl acrylate, vinyl chloride, and ethylhexyl acrylate. Subsequently, the chemicals combusted into a flame being seen from miles around and the fumes filled the air with residents reporting animals falling ill and a burning sensation in their eyes and nose. The EPA monitered the situation and experts recommended that local residents take part in the EPA's at-home air screening. On April 21, 2023, the White House implemented the Justice40 Initiative as part of its broader effort to improve equality in minority communities. The goal of Justice40 is to make sure that 40 percent of the benefits from major federal investments go to communities that have been ignored. These investments include climate programs, clean energy projects, and efforts to reduce pollution. Justice40 changed the way federal agencies planned their programs and worked with each other. It guided how they identified disadvantaged communities and how they decided where money and support should go. For the EPA, this meant adjusting some of its grant programs and technical assistance, so they clearly supported Justice40’s goals and showed that the benefits were reaching the communities that needed them most. In March 2024, EPA published regulations for tailpipe emissions standards that accelerate the transition to electric vehicles (EVs). The standards require at least two-thirds of all new cars sold in the United States to be zero-emissions vehicles by 2032, in order to reduce air pollution and climate change. The agency projected that the regulations would cut emissions by 7 billion metric tons, or 56% of 2026 levels, by 2032. In April 2024, EPA finalized new standards for power plant carbon emissions, projecting cuts of 65,000 tons by 2028 and 1.38 billion tons by 2047. The agency also issued final drinking water standards for six PFAS compounds. In December, 2024 the EPA announced it approved California's plan to end the sale of gasoline-only vehicles by 2035. EPA Administrator Michael Regan granted a waiver under the Clean Air Act to California to implement the plan which was first announced in 2020. It required that by 2035 at least 80% of new cars sold be electric and up to 20% plug-in hybrid models.
Chemical approval, manufacture and usage EPA regulates pesticides under the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) and the Food Quality Protection Act. The agency assesses, registers, regulates, and regularly reevaluates all pesticides legally sold in the United States. A few challenges this program faces are transforming toxicity testing, screening pesticides for endocrine disruptors, and regulating biotechnology and nanotechnology. EPA approves and regulates new chemicals issuing "safety reviews". TSCA required EPA to create and maintain a national inventory of all existing chemicals in U.S. commerce. When the act was passed in 1976, there were more than 60,000 chemicals on the market that had never been comprehensively cataloged. To do so, the EPA developed and implemented procedures that have served as a model for Canada, Japan, and the European Union. For the inventory, the EPA also established a baseline for new chemicals that the agency should be notified about before being commercially manufactured. Today, this rule keeps the EPA updated on volumes, uses, and exposures of around 7,000 of the highest-volume chemicals via industry reporting. The Toxics Release Inventory (TRI) is a resource established by the Emergency Planning and Community Right-to-Know Act specifically for the public to learn about toxic chemical releases and pollution prevention activities reported by industrial and federal facilities. TRI data support informed decision-making by communities, government agencies, companies, and others. Annually, the agency collects data from more than 20,000 facilities.
Sewage treatment
Q221275 QID OVERLAP 0.800
QID OVERLAP: Q221275 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (52): "account", "advanced", "application", "around", "availability", "businesses", "centralized", "connected", "construction", "decentralized", "demand", "design", "different", "discharge", "discharges", "drainage", "energy", "environment", "even", "example"....
accountadvancedapplicationaroundavailabilitybusinessescentralizedconnectedconstructiondecentralizeddemanddesigndifferentdischargedischargesdrainageenergyenvironmentevenexamplefieldindustriallandlargelevelmainmanagementmunicipalneednetwork+22
ented in full-scale in Sweden. A large number of sewage treatment technologies have been developed, mostly using biological treatment processes. Design engineers and decision makers need to take into account technical and economical criteria of each alternative when choosing a suitable technology. Often, the main criteria for selection are desired effluent quality, expected construction and operating costs, availability of land, energy requirements and sustainability aspects. In developing countries and in rural areas with low population densities, sewage is often treated by various on-site sanitation systems and not conveyed in sewers. These systems include septic tanks connected to drain fields, on-site sewage systems (OSS), and vermifilter systems. On the other hand, advanced and relatively expensive sewage treatment plants may include tertiary treatment with disinfection and possibly even a fourth treatment stage to remove micropollutants. At the global level, an estimated 52% of sewage is treated. However, sewage treatment rates are highly unequal for different countries around the world. For example, while high-income countries treat approximately 74% of their sewage, developing countries treat an average of just 4.2%. The treatment of sewage is part of the field of sanitation. Sanitation also includes the management of human waste and solid waste as well as stormwater (drainage) management.
Population equivalent The per person organic matter load is a parameter used in the design of sewage treatment plants. This concept is known as population equivalent (PE). The base value used for PE can vary from one country to another. Commonly used definitions used worldwide are: 1 PE equates to 60 gram of BOD per person per day, and it also equals 200 liters of sewage per day. This concept is also used as a comparison parameter to express the strength of industrial wastewater compared to sewage. Process selection When choosing a suitable sewage treatment process, decision makers need to take into account technical and economical criteria. Therefore, each analysis is site-specific. A life cycle assessment (LCA) can be used, and criteria or weightings are attributed to the various aspects. This makes the final decision subjective to some extent. A range of publications exist to help with technology selection. In industrialized countries, the most important parameters in process selection are typically efficiency, reliability, and space requirements. In developing countries, they might be different and the focus might be more on construction and operating costs as well as process simplicity. Choosing the most suitable treatment process is complicated and requires expert inputs, often in the form of feasibility studies. This is because the main important factors to be considered when evaluating and selecting sewage treatment processes are numerous.
ve a combined sewer, the sewers will also carry urban runoff (stormwater) to the sewage treatment plant. Sewage treatment often involves two main stages, called primary and secondary treatment, while advanced treatment also incorporates a tertiary treatment stage with polishing processes and nutrient removal. Secondary treatment can reduce organic matter (measured as biological oxygen demand) from sewage,  using aerobic or anaerobic biological processes. A quaternary treatment step (sometimes referred to as advanced treatment) can also be added for the removal of organic micropollutants, such as pharmaceuticals. This has been implemented in full-scale in Sweden. A large number of sewage treatment technologies have been developed, mostly using biological treatment processes. Design engineers and decision makers need to take into account technical and economical criteria of each alternative when choosing a suitable technology. Often, the main criteria for selection are desired effluent quality, expected construction and operating costs, availability of land, energy requirements and sustainability aspects. In developing countries and in rural areas with low population densities, sewage is often treated by various on-site sanitation systems and not conveyed in sewers. These systems include septic tanks connected to drain fields, on-site sewage systems (OSS), and vermifilter systems. On the other hand, advanced and relatively expensive sewage treatment plants may include tertiary treatment with disinfection and possibly even a fourth treatment stage to remove micropollutants. At the global level, an estimated 52% of sewage is treated. However, sewage treatment rates are highly unequal for different countries around the world. For example, while high-income countries treat approximately 74% of their sewage, developing countries treat an average of just 4.2%. The treatment of sewage is part of the field of sanitation. Sanitation also includes the management of human waste and solid waste as well as stormwater (drainage) management.
Heating, ventilation, and air conditioning
Q1798773 QID OVERLAP 0.800
QID OVERLAP: Q1798773 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (19): "air", "building", "buildings", "control", "design", "electrical", "energy", "environmental", "hvac", "maintenance", "mechanical", "operating", "performance", "quality", "regulate", "systems", "technology", "vehicles", "water".
airbuildingbuildingscontroldesignelectricalenergyenvironmentalhvacmaintenancemechanicaloperatingperformancequalityregulatesystemstechnologyvehicleswater
Heating, ventilation, and air conditioning (HVAC ) systems regulate temperature, humidity, and indoor air quality in vehicles and buildings. They are designed to provide thermal comfort and to control airborne contaminants through heating, cooling, ventilation, filtration, and humidity control. HVAC design considerations include energy efficiency, indoor air quality, maintenance, and environmental impact, particularly in green building projects. In building design, mechanical, electrical, and plumbing engineers may integrate HVAC systems with other building systems (i.e.
nce, and environmental impact, particularly in green building projects. In building design, mechanical, electrical, and plumbing engineers may integrate HVAC systems with other building systems (i.e. air-source heat pump water heaters) and use energy modeling to evaluate performance and operating costs. Summary The three major functions of heating, ventilation, and air conditioning are intertwined. HVAC systems can provide ventilation and maintain pressure relationships between spaces.
other building systems (i.e. air-source heat pump water heaters) and use energy modeling to evaluate performance and operating costs. Summary The three major functions of heating, ventilation, and air conditioning are intertwined. HVAC systems can provide ventilation and maintain pressure relationships between spaces.
Sanitary sewer
Q1805497 QID OVERLAP 0.800
QID OVERLAP: Q1805497 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (22): "buildings", "commercial", "directly", "disposal", "drains", "industrial", "infrastructure", "municipalities", "separate", "served", "serving", "sewer", "storm", "stormwater", "surface", "system", "systems", "treatment", "type", "urban"....
buildingscommercialdirectlydisposaldrainsindustrialinfrastructuremunicipalitiesseparateservedservingsewerstormstormwatersurfacesystemsystemstreatmenttypeurbanwastewaterwaters
A sanitary sewer is an underground pipe or tunnel system for transporting sewage from houses and commercial buildings (but not stormwater) to a sewage treatment plant or disposal. Sanitary sewers are a type of gravity sewer and are part of an overall system called a "sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
Purpose Sewage treatment is less effective when sanitary waste is diluted with stormwater, and combined sewer overflows occur when runoff from heavy rainfall or snowmelt exceeds the hydraulic capacity of sewage treatment plants. To overcome these disadvantages, some cities built separate sanitary sewers to collect only municipal wastewater and exclude stormwater runoff, which is collected in separate storm drains. The decision to build a combined sewer system or two separate systems is mainly based on the need for sewage treatment and the cost of providing treatment during heavy rain events. Many cities with combined sewer systems built their systems prior to installing sewage treatment plants, and have not subsequently replaced those sewer systems. Types Conventional gravity sewers In the developed world, sewers are pipes from buildings to one or more levels of larger underground trunk mains, which transport the sewage to sewage treatment facilities. Vertical pipes, usually made of precast concrete, called manholes, connect the mains to the surface. Depending upon site application and use, these vertical pipes can be cylindrical, eccentric, or concentric. The manholes are used for access to the sewer pipes for inspection and maintenance, and as a means to vent sewer gases. They also facilitate vertical and horizontal angles in otherwise straight pipelines. Pipes conveying sewage from an individual building to a common gravity sewer line are called laterals. Branch sewers typically run under streets receiving laterals from buildings along that street and discharge by gravity into trunk sewers at manholes. Larger cities may have sewers called interceptors, receiving flow from multiple trunk sewers. Design and sizing of sanitary sewers considers the population to be served over the anticipated life of the sewer, per capita wastewater production, and flow peaking from timing of daily routines. Minimum sewer diameters are often specified to prevent blockage by solid materials flushed down toilets; gradients may be selected to maintain flow velocities generating sufficient turbulence to minimize solids deposition within the sewer.
In the developed world, sewers are pipes from buildings to one or more levels of larger underground trunk mains, which transport the sewage to sewage treatment facilities. Vertical pipes, usually made of precast concrete, called manholes, connect the mains to the surface. Depending upon site application and use, these vertical pipes can be cylindrical, eccentric, or concentric. The manholes are used for access to the sewer pipes for inspection and maintenance, and as a means to vent sewer gases. They also facilitate vertical and horizontal angles in otherwise straight pipelines. Pipes conveying sewage from an individual building to a common gravity sewer line are called laterals. Branch sewers typically run under streets receiving laterals from buildings along that street and discharge by gravity into trunk sewers at manholes. Larger cities may have sewers called interceptors, receiving flow from multiple trunk sewers. Design and sizing of sanitary sewers considers the population to be served over the anticipated life of the sewer, per capita wastewater production, and flow peaking from timing of daily routines. Minimum sewer diameters are often specified to prevent blockage by solid materials flushed down toilets; gradients may be selected to maintain flow velocities generating sufficient turbulence to minimize solids deposition within the sewer.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (20): "active", "business", "capital", "category", "changes", "control", "expansion", "finance", "financial", "firm", "firms", "limited", "management", "operational", "ownership", "private", "product", "public", "rather", "specialized".
activebusinesscapitalcategorychangescontrolexpansionfinancefinancialfirmfirmslimitedmanagementoperationalownershipprivateproductpublicratherspecialized
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Boise River
Q891080 EXACT TITLE 0.800
QID OVERLAP: Q891080 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (5): "boise", "drains", "idaho", "urban", "western". | EXACT TITLE in energy_utilities: "Boise River".
boisedrainsidahourbanwestern
The Boise River is a 102-mile-long (164 km) tributary of the Snake River in the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "footprint", "home", "idaho", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "university", "western".
boisecanyoncollegefootprinthomeidahomeridianmetropolitannamenampanorthwestpopulationuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (14): "ada", "boise", "capital", "counties", "home", "idaho", "level", "locally", "major", "metropolitan", "population", "technology", "treasure", "valley".
adaboisecapitalcountieshomeidaholevellocallymajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Municipal solid waste
Q18538 QID OVERLAP 0.740
QID OVERLAP: Q18538 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (12): "code", "definition", "disposal", "food", "municipal", "municipalities", "public", "separately", "solid", "specifically", "type", "waste".
codedefinitiondisposalfoodmunicipalmunicipalitiespublicseparatelysolidspecificallytypewaste
can also refer specifically to food waste, as in a garbage disposal; the two are sometimes collected separately. In the European Union, the semantic definition is 'mixed municipal waste,' given waste code 20 03 01 in the European Waste Catalog.
Composition The composition of municipal solid waste varies greatly from municipality to municipality, and it changes significantly with time. In municipalities which have a well-developed waste recycling system, the waste stream mainly consists of intractable wastes such as plastic film and non-recyclable packaging materials. At the start of the 20th century, the majority of domestic waste (53%) in the UK consisted of coal ash from open fires. In developed areas without significant recycling activity it predominantly includes food wastes, market wastes, yard wastes, plastic containers, and product packaging materials, and other miscellaneous solid wastes from residential, commercial, institutional, and industrial sources. Most definitions of municipal solid waste do not include industrial wastes, agricultural wastes, medical waste, radioactive waste or sewage sludge. Waste collection is performed by the municipality within a given area. The term "residual waste" relates to waste left from household sources containing materials that have not been separated out or sent for processing.
Biodegradable waste: food and kitchen waste, green waste, paper (most can be recycled, although some difficult to compost plant material may be excluded) Recyclable materials: paper, cardboard, glass, bottles, jars, tin cans, aluminum cans, aluminium foil, metals, certain plastics, textiles, clothing, tires, batteries, etc. Inert waste: construction and demolition waste, dirt, rocks, debris Electrical and electronic waste (WEEE) – ⁣electrical appliances, light bulbs, washing machines, TVs, computers, screens, mobile phones, alarm clocks, watches, etc. Composite wastes: waste clothing, Tetra Pack food and drink cartons, waste plastics such as toys and plastic garden furniture Hazardous waste including most paints, chemicals, tires, batteries, light bulbs, electrical appliances, fluorescent lamps, aerosol spray cans, and fertilizers Toxic waste including pesticides, herbicides, and fungicides Biomedical waste, expired pharmaceutical drugs, etc. For example, typical municipal solid waste in China is composed of 55.9% food residue, 8.5% paper, 11.2% plastics, 3.2% textiles, 2.9% wood waste, 0.8% rubber, and 18.4% non-combustibles. Components of solid waste management The municipal solid waste industry has four components: recycling, composting, disposal, and waste-to-energy via incineration. There is no single approach that can be applied to the management of all waste streams, therefore governmental bodies such as the United States Environmental Protection Agency and the European Union have developed hierarchy ranking strategies for municipal solid waste. Waste hierarchies consist of four levels ordered from most preferred to least preferred methods based on their environmental soundness: Source reduction and reuse; recycling or composting; energy recovery; treatment and disposal.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in cleaning_services (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
adaboisecapitalhomeidahojurisdictionlocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Waste collection
QID OVERLAP 0.700
QID OVERLAP: Q1324934 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (10): "disposal", "facility", "management", "materials", "municipal", "process", "program", "solid", "treatment", "waste".
disposalfacilitymanagementmaterialsmunicipalprocessprogramsolidtreatmentwaste
Waste collection is a part of the process of waste management. It is the transfer of solid waste from the point of use and disposal to the point of treatment or landfill.
Employment as garbage collector According to USNews, The Bureau of Labor Statistics projects 3.2% employment growth for garbage collectors between 2022 and 2032.
The Bureau of Labor Statistics projects 3.2% employment growth for garbage collectors between 2022 and 2032.
Kuna, Idaho
Q1515177 QID OVERLAP 0.680
QID OVERLAP: Q1515177 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (9): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "nearly", "percent", "population".
adaadditionalboiseidahokunametropolitannearlypercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in cleaning_services (tier:evergreen) and energy_utilities (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
boisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
QID OVERLAP 0.620
QID OVERLAP: Q1516870 in cleaning_services (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Snake River Plain
Q1396049 QID OVERLAP 0.600
QID OVERLAP: Q1396049 in cleaning_services (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (5): "idaho", "land", "major", "northwest", "southern".
idaholandmajornorthwestsouthern
The Snake River Plain is a geologic feature located primarily within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain has a significant effect on the climate of Yellowstone National Park and the adjacent areas to the south and west of Yellowstone. Over time, the Yellowstone hotspot left a 70-mile (110 km) wide channel through the Rocky Mountains. This channel is in line with the gap between the Cascade Range and the Sierra Nevada. The result is a moisture channel extending from the Pacific Ocean to Yellowstone. Moisture from the Pacific Ocean streams onshore in the form of clouds and humid air. It passes through the gap between the Sierra and Cascades and into the Snake River Plain where it is channeled through most of the Rocky Mountains with no high plateaus or mountain ranges to impede its progress. It finally encounters upslope conditions at the head of the Snake River Valley at Ashton, Idaho; at Island Park, Idaho; at the Teton Range east of Driggs, Idaho; and at the Yellowstone Plateau of Yellowstone National Park where the channeled moisture precipitates out as rain and snow. The result is a localized climate on the eastern side of the Rockies that is akin to a climate on the west slope of the Cascades or the northern Sierra. The head of the Snake River Valley, the Tetons, and the Yellowstone Plateau receive much more precipitation than other areas of the region, and the area is known for being wet, green, having many streams, and having abundant snow in winter. Although the topography of the Plain has largely gone unchanged for several million years, this region's climate has not been so constant. Current climatic conditions began to characterize the region in the early Pleistocene (approximately 2.5 million years ago). However, the arid climate of today was born from the gradual dissipation of a climate defined by greater moisture and narrower ranges of annual temperatures.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
244 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP244 edges
🌲 EVERGREEN1 edges
0.610
commissioncustomerselectricitygasidahomunicipalitiesownedpowerpublicregulateregulatesutilitywater
SHARED TOKENS (13): "commission", "customers", "electricity", "gas", "idaho", "municipalities", "owned", "power", "public", "regulate", "regulates", "utility", "water". | URL->B (1): https://puc.idaho.gov/. | EXACT TITLE in energy_utilities: "Idaho Public Utilities Commission".
🌿 BRANCH207 edges
0.590
adaboisecanyoncapacitychannelidahosourcedsystemtreasurevalleywaterwestern
SHARED TOKENS (12): "ada", "boise", "canyon", "capacity", "channel", "idaho", "sourced", "system", "treasure", "valley", "water", "western". | URL->B (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in energy_utilities: "New York Canal".
0.550
Electrician ↗ Q165029 EXACT TITLE
buildingscomponentsdataelectricalequipmentexistinginfrastructuremaintenancerelatedrepair
SHARED TOKENS (10): "buildings", "components", "data", "electrical", "equipment", "existing", "infrastructure", "maintenance", "related", "repair". | URL->B (1): http://www.bls.gov/ooh/construction-and-extraction/electricians.htm. | EXACT TITLE in energy_utilities: "Electrician".
0.500
Well ↗ Q43483 EXACT TITLE
anothercasechemicalclassesconstructioncreateenvironmentalfallsleastmethodneedsplacingreachrequiresitesoilstructuresupplysurfacetreatment
SHARED TOKENS (23): "another", "case", "chemical", "classes", "construction", "create", "environmental", "falls", "least", "method", "needs", "placing", "reach", "require", "site", "soil", "structure", "supply", "surface", "treatment".... | EXACT TITLE in cleaning_services: "Well". | EXACT TITLE in energy_utilities: "Well".
0.500
Tariff ↗ EXACT TITLE
againstamericanamongbarriersconsumerconsumersdistributeddomesticeconomiceconomyfallsformgrowthindustrylocalmaterialsmeansnationalpolicypressure
SHARED TOKENS (31): "against", "american", "among", "barriers", "consumer", "consumers", "distributed", "domestic", "economic", "economy", "falls", "form", "growth", "industry", "local", "materials", "means", "national", "policy", "pressure".... | EXACT TITLE in energy_utilities: "Tariff".
0.500
activitiesaroundbuildingbuildingsbuiltconstructiondesigndomesticeconomicexamplefacilitieshazardousindustrialindustryinfrastructuremaintenancepercentplanningprocesspromotes
SHARED TOKENS (21): "activities", "around", "building", "buildings", "built", "construction", "design", "domestic", "economic", "example", "facilities", "hazardous", "industrial", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "promotes".... | EXACT TITLE in cleaning_services: "Construction". | EXACT TITLE in energy_utilities: "Construction".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturearoundboisecapitaldistinctdividedeconomyidahoisolatedlandnationalnorthwestofficialpopulationrestseparatesmallsuppliestechnologyterritory
SHARED TOKENS (22): "agriculture", "around", "boise", "capital", "distinct", "divided", "economy", "idaho", "isolated", "land", "national", "northwest", "official", "population", "rest", "separate", "small", "supplies", "technology", "territory".... | EXACT TITLE in cleaning_services: "Idaho". | EXACT TITLE in energy_utilities: "Idaho".
0.500
applicationbuildingbuildingscodecodescurrentdepartmentevenfacilitiesfirelawlocalmeasuresoperatorsownerspersonnelpotentiallyproductionprotectionrelated
SHARED TOKENS (23): "application", "building", "buildings", "code", "codes", "current", "department", "even", "facilities", "fire", "law", "local", "measures", "operators", "owners", "personnel", "potentially", "production", "protection", "related".... | EXACT TITLE in cleaning_services: "Fire protection". | EXACT TITLE in energy_utilities: "Fire protection".
0.500
allowsamericanassociationbecomebureaubusinessbusinessescodeconsumerscustomerevenindependentlyindustryinternationallocalmarketplacematerialsnearlyoperatingorganizations
SHARED TOKENS (30): "allows", "american", "association", "become", "bureau", "business", "businesses", "code", "consumers", "customer", "even", "independently", "industry", "international", "local", "marketplace", "materials", "nearly", "operating", "organizations".... | EXACT TITLE in cleaning_services: "Better Business Bureau".
0.500
activitiesactivityadditionalaircenterschemicalcommercialcontrolleddifferentdisposaleconomicelectricityenergyenvironmentenvironmentalexampleexistingfoodhouseholdindustrial
SHARED TOKENS (48): "activities", "activity", "additional", "air", "centers", "chemical", "commercial", "controlled", "different", "disposal", "economic", "electricity", "energy", "environment", "environmental", "example", "existing", "food", "household", "industrial".... | EXACT TITLE in cleaning_services: "Waste management".
0.500
abilityactivitiesaffectairaloneamericanarchitecturebeyondbuildingbuildingsclearcodecodescomponentcontroldemanddependdesigndirectdirectly
SHARED TOKENS (51): "ability", "activities", "affect", "air", "alone", "american", "architecture", "beyond", "building", "buildings", "clear", "code", "codes", "component", "control", "demand", "depend", "design", "direct", "directly".... | EXACT TITLE in cleaning_services: "Ventilation (architecture)".
0.500
centralizedcomponentsconventionaldecentralizeddifferentdistributeddistributionelectricalelectricityenergyenvironmentalgashigherincreasinglyintegrationmajormakesmeansnetworkoperate
SHARED TOKENS (31): "centralized", "components", "conventional", "decentralized", "different", "distributed", "distribution", "electrical", "electricity", "energy", "environmental", "gas", "higher", "increasingly", "integration", "major", "makes", "means", "network", "operate".... | EXACT TITLE in energy_utilities: "Distributed generation".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturebecomecapacitycentralcleandischargedisposaldistributionenvironmentalexampleextractionfieldformformationhouseholdindustriallandlevelmajormunicipal
SHARED TOKENS (36): "agriculture", "become", "capacity", "central", "clean", "discharge", "disposal", "distribution", "environmental", "example", "extraction", "field", "form", "formation", "household", "industrial", "land", "level", "major", "municipal".... | EXACT TITLE in energy_utilities: "Groundwater".
0.500
Corporation ↗ Q167037 EXACT TITLE
abilityactagainstboardbusinesscapacitycontrolcorporatecorporationsdifferentdividedentitiesentitygenerallyjurisdictionlawlegallimitedlocalmeans
SHARED TOKENS (35): "ability", "act", "against", "board", "business", "capacity", "control", "corporate", "corporations", "different", "divided", "entities", "entity", "generally", "jurisdiction", "law", "legal", "limited", "local", "means".... | EXACT TITLE in cleaning_services: "Corporation". | EXACT TITLE in energy_utilities: "Corporation".
0.500
Natural gas ↗ Q40858 EXACT TITLE
airalongsideassetschemicalcommercialdemandelectricityenergyextractionfootprintgasgenerallyhigherindustryinfrastructuremajorpetroleumpollutantspressureprocesses
SHARED TOKENS (30): "air", "alongside", "assets", "chemical", "commercial", "demand", "electricity", "energy", "extraction", "footprint", "gas", "generally", "higher", "industry", "infrastructure", "major", "petroleum", "pollutants", "pressure", "processes".... | EXACT TITLE in energy_utilities: "Natural gas".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowingbuildingbuildingscasedeterminedifferentformgoverngrowthindustriallandland-uselocalmethodplanningpolicyprocedurepropertyregulatory
SHARED TOKENS (30): "activities", "allowing", "building", "buildings", "case", "determine", "different", "form", "govern", "growth", "industrial", "land", "land-use", "local", "method", "planning", "policy", "procedure", "property", "regulatory".... | EXACT TITLE in cleaning_services: "Zoning". | EXACT TITLE in energy_utilities: "Zoning".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
acquisitionallowsamericanamongaroundbecomebeyondbusinesscapitalchannelconnectionscreatedesignfirmshandlinginformationnetworkplatformportalpractices
SHARED TOKENS (30): "acquisition", "allows", "american", "among", "around", "become", "beyond", "business", "capital", "channel", "connections", "create", "design", "firms", "handling", "information", "network", "platform", "portal", "practices".... | EXACT TITLE in cleaning_services: "LinkedIn".
0.500
Pipeline ↗ Q25471856 EXACT TITLE
constructiondesignenvironmentalevengasindustrymainmarketmaterialsmoveneedsnetworkpetroleumpipelineplanningpressuresolidstablesystemsystems
SHARED TOKENS (23): "construction", "design", "environmental", "even", "gas", "industry", "main", "market", "materials", "move", "needs", "network", "petroleum", "pipeline", "planning", "pressure", "solid", "stable", "system", "systems".... | EXACT TITLE in cleaning_services: "Pipeline". | EXACT TITLE in energy_utilities: "Pipeline".
0.500
Laundry ↗ Q852100 EXACT TITLE
americanbuildingbusinesscleaningcommercialdifferentfacilityfunctionhistoryhomeindustrialitselfneedoutsidesharedutilitywork
SHARED TOKENS (17): "american", "building", "business", "cleaning", "commercial", "different", "facility", "function", "history", "home", "industrial", "itself", "need", "outside", "shared", "utility", "work". | EXACT TITLE in cleaning_services: "Laundry".
0.500
centralizedcommercialcomponentsconsumersdistributionfireindustrialinfrastructurenetworkrequirementsresidentialsupplysystemtreatmentwater
SHARED TOKENS (15): "centralized", "commercial", "components", "consumers", "distribution", "fire", "industrial", "infrastructure", "network", "requirements", "residential", "supply", "system", "treatment", "water". | EXACT TITLE in energy_utilities: "Water distribution system".
0.500
actbecomebuiltbureaudepartmentfederallawmanagementoperationpowerproduceprogramprovidingprovisionsresourcerevenuespecificallystoragesupplythroughout
SHARED TOKENS (22): "act", "become", "built", "bureau", "department", "federal", "law", "management", "operation", "power", "produce", "program", "providing", "provisions", "resource", "revenue", "specifically", "storage", "supply", "throughout".... | EXACT TITLE in energy_utilities: "Bureau of Reclamation".
0.500
agenciescomponentsdifferentdistincteconomiceconomyeducationalelectricalemergencyenforcementenvironmentenvironmentalfacilitiesfirmsfunctionindustrialindustryinfrastructureinstitutionsinternational
SHARED TOKENS (43): "agencies", "components", "different", "distinct", "economic", "economy", "educational", "electrical", "emergency", "enforcement", "environment", "environmental", "facilities", "firms", "function", "industrial", "industry", "infrastructure", "institutions", "international".... | EXACT TITLE in cleaning_services: "Infrastructure". | EXACT TITLE in energy_utilities: "Infrastructure".
0.500
airbecomecapacitycleancompetitivecurrentelectricityenergyenvironmentalevenexpansionextractionfinancialgasinternationallandlargelocalmainmajor
SHARED TOKENS (38): "air", "become", "capacity", "clean", "competitive", "current", "electricity", "energy", "environmental", "even", "expansion", "extraction", "financial", "gas", "international", "land", "large", "local", "main", "major".... | EXACT TITLE in energy_utilities: "Renewable energy".
0.500
Journeyman ↗ Q582096 EXACT TITLE
apprenticeshipbecomebuildingbusinesseducationexaminationexperiencefieldgenerallylicenseofficialprotectpublictradeworkworkers
SHARED TOKENS (16): "apprenticeship", "become", "building", "business", "education", "examination", "experience", "field", "generally", "license", "official", "protect", "public", "trade", "work", "workers". | EXACT TITLE in energy_utilities: "Journeyman".
0.500
Fire ↗ Q3196 EXACT TITLE
agricultureanotherbecomechemicaldependdirectlyexamplefireformgrowthhistoryhomeintensitylandmajorphysicalprocessproduceproducesprofessional
SHARED TOKENS (31): "agriculture", "another", "become", "chemical", "depend", "directly", "example", "fire", "form", "growth", "history", "home", "intensity", "land", "major", "physical", "process", "produce", "produces", "professional".... | EXACT TITLE in cleaning_services: "Fire". | EXACT TITLE in energy_utilities: "Fire".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundavailabilitybuildingbuiltcleanconstructiondesigndownstreamelectricityengineeringfunctionsgoverninghazardhouseholdindustriallandlargemaintenance
SHARED TOKENS (35): "additional", "application", "around", "availability", "building", "built", "clean", "construction", "design", "downstream", "electricity", "engineering", "functions", "governing", "hazard", "household", "industrial", "land", "large", "maintenance".... | EXACT TITLE in cleaning_services: "Dam". | EXACT TITLE in energy_utilities: "Dam".
0.500
activitiesadditionalbroaderbusinesscleaningcommercialdomestichospitalhospitalshouseholdindustrialinstitutionalinstitutionslargemaintenancemanagementoccupationalpersonpersonsphysical
SHARED TOKENS (28): "activities", "additional", "broader", "business", "cleaning", "commercial", "domestic", "hospital", "hospitals", "household", "industrial", "institutional", "institutions", "large", "maintenance", "management", "occupational", "person", "persons", "physical".... | EXACT TITLE in cleaning_services: "Housekeeping".
0.500
Hepatitis B ↗ Q6853 EXACT TITLE
againstanotheraroundbecomecannotcontactexposurefullhealthcarehigherhoursmainnationalpersonpopulationpracticesprogramspublicrapidreceive
SHARED TOKENS (29): "against", "another", "around", "become", "cannot", "contact", "exposure", "full", "healthcare", "higher", "hours", "main", "national", "person", "population", "practices", "programs", "public", "rapid", "receive".... | EXACT TITLE in cleaning_services: "Hepatitis B".
0.500
airappropriateconnectingenteredentryequipmentexamplelimitedmaintenancenamesoccupationalplanqualitysafetystoragetrainingworkers
SHARED TOKENS (17): "air", "appropriate", "connecting", "entered", "entry", "equipment", "example", "limited", "maintenance", "names", "occupational", "plan", "quality", "safety", "storage", "training", "workers". | EXACT TITLE in cleaning_services: "Confined space".
0.500
actualcapacitycombinationcommercialconsumerscustomercustomersdemanddomesticelectricalelectricityenergyevenhigherindustriallevelmanagementoperatingpowerrepresents
SHARED TOKENS (23): "actual", "capacity", "combination", "commercial", "consumers", "customer", "customers", "demand", "domestic", "electrical", "electricity", "energy", "even", "higher", "industrial", "level", "management", "operating", "power", "represents".... | EXACT TITLE in energy_utilities: "Peak demand".
0.500
Heat pump ↗ Q131313 EXACT TITLE
airanotherbuildingdependselectricalelectricityenergyfallsfootprintgaslimitedmeansmechanicalmodelsmoveneedneedsoperatespowerpressure
SHARED TOKENS (29): "air", "another", "building", "depends", "electrical", "electricity", "energy", "falls", "footprint", "gas", "limited", "means", "mechanical", "models", "move", "need", "needs", "operates", "power", "pressure".... | EXACT TITLE in energy_utilities: "Heat pump".
0.500
abilityactivitiesadditionaladministrativeappliesbarrierscannotcategorieschemicalcontrolcontrolscreatedesignelectricalengineeringenvironmentequipmentexposureframeworkhazard
SHARED TOKENS (40): "ability", "activities", "additional", "administrative", "applies", "barriers", "cannot", "categories", "chemical", "control", "controls", "create", "design", "electrical", "engineering", "environment", "equipment", "exposure", "framework", "hazard".... | EXACT TITLE in cleaning_services: "Personal protective equipment".
0.500
anothercasechemicaldischargeddisposaldomesticenvironmentfacilityindustrialindustrymainmunicipalprocessprocessesresultingtreatedtreatmenttypeuseswaste
SHARED TOKENS (22): "another", "case", "chemical", "discharged", "disposal", "domestic", "environment", "facility", "industrial", "industry", "main", "municipal", "process", "processes", "resulting", "treated", "treatment", "type", "uses", "waste".... | EXACT TITLE in energy_utilities: "Wastewater treatment".
0.500
aroundbusinessdistributionelectricalelectricityfollowsgasgenerallyidahooperatespowerregulatedsolarsouthernutility
SHARED TOKENS (15): "around", "business", "distribution", "electrical", "electricity", "follows", "gas", "generally", "idaho", "operates", "power", "regulated", "solar", "southern", "utility". | EXACT TITLE in energy_utilities: "Idaho Power".
0.500
Disinfectant ↗ Q73984 EXACT TITLE
buildingchemicalcleancontactdifferentdischargedexampleformgenerallyhospitalsmedicalphysicalprocesssanitationsimultaneouslysurfacetreatmentwastewastewaterwork
SHARED TOKENS (20): "building", "chemical", "clean", "contact", "different", "discharged", "example", "form", "generally", "hospitals", "medical", "physical", "process", "sanitation", "simultaneously", "surface", "treatment", "waste", "wastewater", "work". | EXACT TITLE in cleaning_services: "Disinfectant".
0.500
Substation ↗ Q174814 EXACT TITLE
centralcommercialcomponentconnectedconsumercontrolcustomerdifferentdistributionelectricalenergyfunctionsgenerallyindustrialinfrastructurelargelevelsownedperformpower
SHARED TOKENS (26): "central", "commercial", "component", "connected", "consumer", "control", "customer", "different", "distribution", "electrical", "energy", "functions", "generally", "industrial", "infrastructure", "large", "levels", "owned", "perform", "power".... | EXACT TITLE in energy_utilities: "Substation".
0.500
activitybecomechemicalcomponentsconnectedconsumerscustomersdesigndistributedeconomyengineeringequipmentfieldhouseholdindustriallaborlargematerialsprocessproducing
SHARED TOKENS (25): "activity", "become", "chemical", "components", "connected", "consumers", "customers", "design", "distributed", "economy", "engineering", "equipment", "field", "household", "industrial", "labor", "large", "materials", "process", "producing".... | EXACT TITLE in cleaning_services: "Manufacturing".
0.500
Lineworker ↗ Q691225 EXACT TITLE
buildingscasecommercialdistributionelectricalemergencyenergyfacilitiesgenerallyindustrialinstallsmaintainmaintainsresidentialstormwork
SHARED TOKENS (16): "buildings", "case", "commercial", "distribution", "electrical", "emergency", "energy", "facilities", "generally", "industrial", "installs", "maintain", "maintains", "residential", "storm", "work". | EXACT TITLE in energy_utilities: "Lineworker".
0.500
airclassificationconstructiondefinesdesignindustrialindustryinternallegalmoveplatformpowerratherregulationspecializedspecificallystandardstandardstypevehicles
SHARED TOKENS (20): "air", "classification", "construction", "defines", "design", "industrial", "industry", "internal", "legal", "move", "platform", "power", "rather", "regulation", "specialized", "specifically", "standard", "standards", "type", "vehicles". | EXACT TITLE in cleaning_services: "Powered industrial truck".
0.500
airchemicalcleancleaningcreateepaexposureformindustrialmediamethodprocessesreducesrequiresolidsurfaceuseswaste
SHARED TOKENS (18): "air", "chemical", "clean", "cleaning", "create", "epa", "exposure", "form", "industrial", "media", "method", "processes", "reduces", "require", "solid", "surface", "uses", "waste". | EXACT TITLE in cleaning_services: "Dry-ice blasting".
0.500
actadditionalagainstamericanbureaucodecorporationsdepartmentenforcementfederalgenerallyhandlinghistoryinternallargelawmainofficeoperationalpercent
SHARED TOKENS (31): "act", "additional", "against", "american", "bureau", "code", "corporations", "department", "enforcement", "federal", "generally", "handling", "history", "internal", "large", "law", "main", "office", "operational", "percent".... | EXACT TITLE in cleaning_services: "Internal Revenue Service".
0.500
Cleaner ↗ Q1760141 EXACT TITLE
aroundbuildingcasecleancleaningdomesticfacilityindustrialmaintenancemanagersoccupyoperatorperformpersonpublicschoolssitetypework
SHARED TOKENS (19): "around", "building", "case", "clean", "cleaning", "domestic", "facility", "industrial", "maintenance", "managers", "occupy", "operator", "perform", "person", "public", "schools", "site", "type", "work". | EXACT TITLE in cleaning_services: "Cleaner".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondcharacteristicsenvironmentformationhomeindustriallandlayermajormaterialspressureregionrelatedsolidvarywater
SHARED TOKENS (16): "beyond", "characteristics", "environment", "formation", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "related", "solid", "vary", "water". | EXACT TITLE in energy_utilities: "Aquifer".
0.500
Logistics ↗ Q177777 EXACT TITLE
anothercomponentcustomersdedicatedequipmentfacilityfieldfoodinformationmanagementmaterialsmodelneedsoperationalphysicalplanningproductionprofessionalpublicrelated
SHARED TOKENS (24): "another", "component", "customers", "dedicated", "equipment", "facility", "field", "food", "information", "management", "materials", "model", "needs", "operational", "physical", "planning", "production", "professional", "public", "related".... | EXACT TITLE in cleaning_services: "Logistics".
0.500
activitycomplianceenforcementevenformhazardousindustrialmakingmunicipaloperationsprocessprocessessoilsolidvarywastewaterwaters
SHARED TOKENS (18): "activity", "compliance", "enforcement", "even", "form", "hazardous", "industrial", "making", "municipal", "operations", "process", "processes", "soil", "solid", "vary", "waste", "water", "waters". | EXACT TITLE in cleaning_services: "Industrial waste". | EXACT TITLE in energy_utilities: "Industrial waste".
0.500
assetsbroaderbuildingscapitalcategorycomponentconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitieshospitalsinfrastructuremunicipaloperatorphysicalprivateprotection
SHARED TOKENS (29): "assets", "broader", "buildings", "capital", "category", "component", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "hospitals", "infrastructure", "municipal", "operator", "physical", "private", "protection".... | EXACT TITLE in energy_utilities: "Public works".
0.500
Hotel ↗ Q27686 EXACT TITLE
additionaladministrativearrangementboardbuiltbusinesscenterclassdepartmentdepartmentsdirecteconomyenteredenvironmentequipmentexamplefacilitiesfacilityfoodform
SHARED TOKENS (48): "additional", "administrative", "arrangement", "board", "built", "business", "center", "class", "department", "departments", "direct", "economy", "entered", "environment", "equipment", "example", "facilities", "facility", "food", "form".... | EXACT TITLE in cleaning_services: "Hotel".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbuildingsbusinesscommercialcorporationsdifferententityestateexamplelandlawlegalmeansownedownershippersonprivatepropertypublicreal
SHARED TOKENS (24): "acquisition", "buildings", "business", "commercial", "corporations", "different", "entity", "estate", "example", "land", "law", "legal", "means", "owned", "ownership", "person", "private", "property", "public", "real".... | EXACT TITLE in cleaning_services: "Real estate". | EXACT TITLE in energy_utilities: "Real estate".
0.500
advancedallowsappropriatecomponentsenergyenvironmentenvironmentalindustrialmaintenancematerialspollutantsprocessprocessesqualityreceivingrecoveryrecreationreducesresourcesupply
SHARED TOKENS (24): "advanced", "allows", "appropriate", "components", "energy", "environment", "environmental", "industrial", "maintenance", "materials", "pollutants", "process", "processes", "quality", "receiving", "recovery", "recreation", "reduces", "resource", "supply".... | EXACT TITLE in energy_utilities: "Water treatment".
0.500
Microgrid ↗ Q5762595 EXACT TITLE
allowsboundariesbuildingcentralizedconnectedcontroldistributeddistributiondomesticeconomicelectricalelectricityemergencyenergyentityevenfunctiongenerallyisolatedlevel
SHARED TOKENS (42): "allows", "boundaries", "building", "centralized", "connected", "control", "distributed", "distribution", "domestic", "economic", "electrical", "electricity", "emergency", "energy", "entity", "even", "function", "generally", "isolated", "level".... | EXACT TITLE in energy_utilities: "Microgrid".
0.500
associationcertificationcontractorseducationalindustryinternationalmonitoringnationaloperatesprogramspromotespublicrelatedresearchseparatetradewater
SHARED TOKENS (17): "association", "certification", "contractors", "educational", "industry", "international", "monitoring", "national", "operates", "programs", "promotes", "public", "related", "research", "separate", "trade", "water". | EXACT TITLE in energy_utilities: "National Ground Water Association".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciesamericancanyoncentralchannelcommercialconstructioncontroldownstreamdrainsfallshistoryidaholargelimitedmajornationalnorthwestpolicy
SHARED TOKENS (32): "activities", "agencies", "american", "canyon", "central", "channel", "commercial", "construction", "control", "downstream", "drains", "falls", "history", "idaho", "large", "limited", "major", "national", "northwest", "policy".... | EXACT TITLE in energy_utilities: "Snake River".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstanothercontractentityfeefinancialformlargemanagementmeansownershippersonpolicypotentiallyprotectprotectionreceivesrisksetsmall
SHARED TOKENS (21): "against", "another", "contract", "entity", "fee", "financial", "form", "large", "management", "means", "ownership", "person", "policy", "potentially", "protect", "protection", "receives", "risk", "set", "small".... | EXACT TITLE in cleaning_services: "Insurance".
0.500
alonearrangementbusinessentityleastlegalnameownedownerownerspersonprocessreceivesseparatesubjecttradetypework
SHARED TOKENS (18): "alone", "arrangement", "business", "entity", "least", "legal", "name", "owned", "owner", "owners", "person", "process", "receives", "separate", "subject", "trade", "type", "work". | EXACT TITLE in cleaning_services: "Sole proprietorship".
0.500
businessbusinessescapacitycasecommercialcompeteconnectionscustomergenerallyhomeofficeoperateoperatesownerremoteresidentialsmallstreettypework
SHARED TOKENS (21): "business", "businesses", "capacity", "case", "commercial", "compete", "connections", "customer", "generally", "home", "office", "operate", "operates", "owner", "remote", "residential", "small", "street", "type", "work".... | EXACT TITLE in cleaning_services: "Home business".
0.500
Contract ↗ Q93288 EXACT TITLE
activitiesapplyboundarybusinesscasecategorycodecommercialcontractcontractsdifferentdistinctenforcemententeringfieldframeworkgenerallyindependentinternationallaw
SHARED TOKENS (32): "activities", "apply", "boundary", "business", "case", "category", "code", "commercial", "contract", "contracts", "different", "distinct", "enforcement", "entering", "field", "framework", "generally", "independent", "international", "law".... | EXACT TITLE in cleaning_services: "Contract". | EXACT TITLE in energy_utilities: "Contract".
0.500
Indeed ↗ Q1045367 EXACT TITLE
additionalallowingamericanapplyaroundbecomecentralcomdirectlyemploymentexamplefirmsindependentrevenuesinglesitestorage
SHARED TOKENS (17): "additional", "allowing", "american", "apply", "around", "become", "central", "com", "directly", "employment", "example", "firms", "independent", "revenue", "single", "site", "storage". | EXACT TITLE in cleaning_services: "Indeed".
0.500
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringidahoindependentprogramprogramspublicreportedresearchschooluniversity
SHARED TOKENS (19): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "idaho", "independent", "program", "programs", "public", "reported", "research", "school", "university". | EXACT TITLE in cleaning_services: "Boise State University". | EXACT TITLE in energy_utilities: "Boise State University".
0.500
businessconstructioncontractordesigndifferentdirectlyelectricalfirmhomelicensesmaintenanceoperateownerspersonprofessionalrelatedrequirementsspecializedsystemsvary
SHARED TOKENS (21): "business", "construction", "contractor", "design", "different", "directly", "electrical", "firm", "home", "licenses", "maintenance", "operate", "owners", "person", "professional", "related", "requirements", "specialized", "systems", "vary".... | EXACT TITLE in energy_utilities: "Electrical contractor".
0.500
activeamericancentercentersdisposalenergyenvironmentalepafacilitiesmanagementmaterialsoperatesoperationsownedprotectionproviderprovidingrecoveryrevenuesite
SHARED TOKENS (25): "active", "american", "center", "centers", "disposal", "energy", "environmental", "epa", "facilities", "management", "materials", "operates", "operations", "owned", "protection", "provider", "providing", "recovery", "revenue", "site".... | EXACT TITLE in energy_utilities: "Republic Services".
0.500
Compost ↗ Q212254 EXACT TITLE
agricultureairchemicalcommercialconstructioneconomicenvironmentalexamplefoodlandlevelmanagementmaterialsphysicalprocesspropertiesprovidingreducesrequiresresulting
SHARED TOKENS (24): "agriculture", "air", "chemical", "commercial", "construction", "economic", "environmental", "example", "food", "land", "level", "management", "materials", "physical", "process", "properties", "providing", "reduces", "requires", "resulting".... | EXACT TITLE in energy_utilities: "Compost".
0.500
Landfill ↗ Q152810 EXACT TITLE
activeconsolidationdischargedisposalenvironmentalformfulllandmanagementmaterialsmunicipalsitesitessoilsolidstoragetreatmentuseswaste
SHARED TOKENS (19): "active", "consolidation", "discharge", "disposal", "environmental", "form", "full", "land", "management", "materials", "municipal", "site", "sites", "soil", "solid", "storage", "treatment", "uses", "waste". | EXACT TITLE in energy_utilities: "Landfill".
0.500
buildingscannotcleancleaningconsumercreatesdifferentformhouseholdindustrialmechanicalpowerpressureprocessesproducerapidratesinglespecializedsurface
SHARED TOKENS (24): "buildings", "cannot", "clean", "cleaning", "consumer", "creates", "different", "form", "household", "industrial", "mechanical", "power", "pressure", "processes", "produce", "rapid", "rate", "single", "specialized", "surface".... | EXACT TITLE in cleaning_services: "Pressure washing".
0.500
cannotcharacteristicscleanclearcommissioncompetecontroldifferentdisposalelectricityenergyentityfederalgasinfrastructurelargelocalmaintainsmarketoperates
SHARED TOKENS (39): "cannot", "characteristics", "clean", "clear", "commission", "compete", "control", "different", "disposal", "electricity", "energy", "entity", "federal", "gas", "infrastructure", "large", "local", "maintains", "market", "operates".... | EXACT TITLE in energy_utilities: "Public utility".
0.500
activityairapplicationapplicationsaroundboundariescapacitydirectenergyevenformationhighersolarsurfacewinter
SHARED TOKENS (15): "activity", "air", "application", "applications", "around", "boundaries", "capacity", "direct", "energy", "even", "formation", "higher", "solar", "surface", "winter". | EXACT TITLE in energy_utilities: "Geothermal heating".
0.500
businesscertificationcompensationconsumerconsumerscreatescustomercustomerseconomicentryformgrowthhigherinspectionslawleastlicenselicensedlicensingmarket
SHARED TOKENS (42): "business", "certification", "compensation", "consumer", "consumers", "creates", "customer", "customers", "economic", "entry", "form", "growth", "higher", "inspections", "law", "least", "license", "licensed", "licensing", "market".... | EXACT TITLE in energy_utilities: "Occupational licensing".
0.500
abilityauthoritybusinessescomponentconstructioncontractsdirecteconomiceconomygrowthinternationallocalorganizationspracticesprivateprocessprocurementproduceproducespublic
SHARED TOKENS (29): "ability", "authority", "businesses", "component", "construction", "contracts", "direct", "economic", "economy", "growth", "international", "local", "organizations", "practices", "private", "process", "procurement", "produce", "produces", "public".... | EXACT TITLE in cleaning_services: "Government procurement".
0.500
becomeclassroomcreatesdocumentsenvironmentequipmentexistingexperiencefieldformgrowthinstructionsknowledgemanagementmaterialsmethodperformanceprocessratherrequire
SHARED TOKENS (23): "become", "classroom", "creates", "documents", "environment", "equipment", "existing", "experience", "field", "form", "growth", "instructions", "knowledge", "management", "materials", "method", "performance", "process", "rather", "require".... | EXACT TITLE in cleaning_services: "On-the-job training".
0.500
barrierscontactcontrolequipmenthandlingmeansmedicalpracticesriskrulessetstandardthemthereforetreated
SHARED TOKENS (15): "barriers", "contact", "control", "equipment", "handling", "means", "medical", "practices", "risk", "rules", "set", "standard", "them", "therefore", "treated". | EXACT TITLE in cleaning_services: "Universal precautions".
0.500
Veolia ↗ Q1632461 EXACT TITLE
activitiesboardbusinessclearenergyenvironmentenvironmentalidentificationmainmajormanagementnameoperationspublicrestrevenuesingleutilitywastewater
SHARED TOKENS (20): "activities", "board", "business", "clear", "energy", "environment", "environmental", "identification", "main", "major", "management", "name", "operations", "public", "rest", "revenue", "single", "utility", "waste", "water". | EXACT TITLE in energy_utilities: "Veolia".
0.500
Pipefitter ↗ Q5407416 EXACT TITLE
apprenticeshipcentercertifiedcommercialconstructioncontrolleddifferenteducationindustrialinstallsinstitutionallicensedmaintainsmechanicalnationalpressureprocessregulatedrequirerequirements
SHARED TOKENS (28): "apprenticeship", "center", "certified", "commercial", "construction", "controlled", "different", "education", "industrial", "installs", "institutional", "licensed", "maintains", "mechanical", "national", "pressure", "process", "regulated", "require", "requirements".... | EXACT TITLE in energy_utilities: "Pipefitter".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltchannelcontrolcreatecurrentdischargesdrainageexamplegenerallyhigherlevellevelsmanagementpressurerequiringsupplysurfacethoughvalley
SHARED TOKENS (22): "building", "built", "channel", "control", "create", "current", "discharges", "drainage", "example", "generally", "higher", "level", "levels", "management", "pressure", "requiring", "supply", "surface", "though", "valley".... | EXACT TITLE in energy_utilities: "Canal".
0.500
Agriculture ↗ Q11451 EXACT TITLE
agriculturearoundbroaderbusinessesclassesdirecteconomicsenvironmentalfoodindependentlyindustriallandlargeleastlevelmajormaterialsnearlypracticesproduce
SHARED TOKENS (29): "agriculture", "around", "broader", "businesses", "classes", "direct", "economics", "environmental", "food", "independently", "industrial", "land", "large", "least", "level", "major", "materials", "nearly", "practices", "produce".... | EXACT TITLE in cleaning_services: "Agriculture". | EXACT TITLE in energy_utilities: "Agriculture".
0.500
acquisitionadministrationapplicantsassetsbuildbuildingbusinesscapitalcommercialcontrolequipmentestatefinancialhomeindustrialinformationinspectionlandmaintainmaintenance
SHARED TOKENS (36): "acquisition", "administration", "applicants", "assets", "build", "building", "business", "capital", "commercial", "control", "equipment", "estate", "financial", "home", "industrial", "information", "inspection", "land", "maintain", "maintenance".... | EXACT TITLE in cleaning_services: "Property management".
0.500
Recycling ↗ Q132580 EXACT TITLE
abilityairanothercentercomponentcontrolconventionaldependsdifferentdisposaleconomicenergyenvironmentalexamplefoodformgashazardoushouseholdmanagement
SHARED TOKENS (38): "ability", "air", "another", "center", "component", "control", "conventional", "depends", "different", "disposal", "economic", "energy", "environmental", "example", "food", "form", "gas", "hazardous", "household", "management".... | EXACT TITLE in energy_utilities: "Recycling".
0.500
Mold ↗ Q159341 EXACT TITLE
connectedfoodformformationgenerallygrowthlargemakingmaterialsnamenetworkproductionpropertyresultshapesinglestructurestructuressurfacewater
SHARED TOKENS (20): "connected", "food", "form", "formation", "generally", "growth", "large", "making", "materials", "name", "network", "production", "property", "result", "shape", "single", "structure", "structures", "surface", "water". | EXACT TITLE in cleaning_services: "Mold".
0.500
builtcapacityclassificationdatadistributedelectricityenergyenvironmentalintegrationisolatedlevellocalnationaloperatingpermittingpowerproceduresprocessesproduceproduction
SHARED TOKENS (29): "built", "capacity", "classification", "data", "distributed", "electricity", "energy", "environmental", "integration", "isolated", "level", "local", "national", "operating", "permitting", "power", "procedures", "processes", "produce", "production".... | EXACT TITLE in energy_utilities: "Small hydro".
0.500
Hospital ↗ Q16917 EXACT TITLE
additionaladministrativecategoriescentercenterscombinesdepartmentdepartmentsdirectemergencyequipmentfacilitiesfacilityfirefunctionsgenerallyhealthcarehomehospitalhospitals
SHARED TOKENS (45): "additional", "administrative", "categories", "center", "centers", "combines", "department", "departments", "direct", "emergency", "equipment", "facilities", "facility", "fire", "functions", "generally", "healthcare", "home", "hospital", "hospitals".... | EXACT TITLE in cleaning_services: "Hospital". | EXACT TITLE in energy_utilities: "Hospital".
0.500
buildcommissiondepartmentelectricityenergyfederalgasindependentlicensingpetroleumpipelineregulatesregulatoryreviewsservingstorage
SHARED TOKENS (16): "build", "commission", "department", "electricity", "energy", "federal", "gas", "independent", "licensing", "petroleum", "pipeline", "regulates", "regulatory", "reviews", "serving", "storage". | EXACT TITLE in energy_utilities: "Federal Energy Regulatory Commission".
0.500
anotherapplicableauthoritybuildingbuiltchangescodescommercialcomplianceconstructioncontractdepartmentgenerallyindustrialjurisdictionlawlocalnecessaryoccupyownership
SHARED TOKENS (29): "another", "applicable", "authority", "building", "built", "changes", "codes", "commercial", "compliance", "construction", "contract", "department", "generally", "industrial", "jurisdiction", "law", "local", "necessary", "occupy", "ownership".... | EXACT TITLE in cleaning_services: "Certificate of occupancy".
0.500
Asbestos ↗ Q104085 EXACT TITLE
aroundbuildingbuildingsconstructioncreateelectricalexposurehazardphysicalprocessesproducingpropertiesrelatedresultsafetytype
SHARED TOKENS (16): "around", "building", "buildings", "construction", "create", "electrical", "exposure", "hazard", "physical", "processes", "producing", "properties", "related", "result", "safety", "type". | EXACT TITLE in cleaning_services: "Asbestos".
0.500
activityaddressagenciesauthorizationbusinessdepartmentsjurisdictionlicenselicenseslocalmunicipalitiesoperateoperatingpermitsphysicalrequiressinglevary
SHARED TOKENS (18): "activity", "address", "agencies", "authorization", "business", "departments", "jurisdiction", "license", "licenses", "local", "municipalities", "operate", "operating", "permits", "physical", "requires", "single", "vary". | EXACT TITLE in cleaning_services: "Business license".
0.500
Ergonomics ↗ Q1750812 EXACT TITLE
amongapplicationappliescurrentdatadesignengineeringequipmentexperiencefieldindustrialknowledgeperformanceprocessesresearchsafetysystemsystemstechnology
SHARED TOKENS (19): "among", "application", "applies", "current", "data", "design", "engineering", "equipment", "experience", "field", "industrial", "knowledge", "performance", "processes", "research", "safety", "system", "systems", "technology". | EXACT TITLE in cleaning_services: "Ergonomics".
0.480
againstcharacteristicschemicalcompliancecontactgenerallyphysicalqualitysafetysetstandardssupplytreatmentwater
SHARED TOKENS (14): "against", "characteristics", "chemical", "compliance", "contact", "generally", "physical", "quality", "safety", "set", "standards", "supply", "treatment", "water". | EXACT TITLE in energy_utilities: "Water quality".
0.480
Fungicide ↗ Q193237 EXACT TITLE
activeagriculturearoundchemicalcontactcontrolformlocallymoveprotectqualityresultingretailsurface
SHARED TOKENS (14): "active", "agriculture", "around", "chemical", "contact", "control", "form", "locally", "move", "protect", "quality", "resulting", "retail", "surface". | EXACT TITLE in cleaning_services: "Fungicide".
0.480
Hepatitis C ↗ Q154869 EXACT TITLE
againstamongcontactequipmentfoodhealthcaremedicalpersonrequireriskscreeningtreatmenttypewater
SHARED TOKENS (14): "against", "among", "contact", "equipment", "food", "healthcare", "medical", "person", "require", "risk", "screening", "treatment", "type", "water". | EXACT TITLE in cleaning_services: "Hepatitis C".
0.480
Warehouse ↗ Q181623 EXACT TITLE
agriculturebuildingbuildingsbusinessescomponentsdirectlyfacilityfunctionindustriallargematerialsproductionstandardwarehouses
SHARED TOKENS (14): "agriculture", "building", "buildings", "businesses", "components", "directly", "facility", "function", "industrial", "large", "materials", "production", "standard", "warehouses". | EXACT TITLE in cleaning_services: "Warehouse". | EXACT TITLE in energy_utilities: "Warehouse".
0.460
componenteducationemergencyenforcementengineeringenvironmentfireknowledgemeasurespracticesresponsesetthem
SHARED TOKENS (13): "component", "education", "emergency", "enforcement", "engineering", "environment", "fire", "knowledge", "measures", "practices", "response", "set", "them". | EXACT TITLE in cleaning_services: "Fire prevention".
0.460
activitycasedependsdirectlyenvironmentalfoodformmaintainmajorphysicalsuppliedwaterwork
SHARED TOKENS (13): "activity", "case", "depends", "directly", "environmental", "food", "form", "maintain", "major", "physical", "supplied", "water", "work". | EXACT TITLE in energy_utilities: "Drinking water".
0.460
againstbeyondclassescontactdirectlyexamplefunctiongrowthmainmediaresponsethoughtreat
SHARED TOKENS (13): "against", "beyond", "classes", "contact", "directly", "example", "function", "growth", "main", "media", "response", "though", "treat". | EXACT TITLE in cleaning_services: "Antimicrobial".
0.440
Upholstery ↗ Q1123578 EXACT TITLE
applicablebuildingdesigndomesticlayermakesmaterialspersonprovidingthoughuseswork
SHARED TOKENS (12): "applicable", "building", "design", "domestic", "layer", "makes", "materials", "person", "providing", "though", "uses", "work". | EXACT TITLE in cleaning_services: "Upholstery".
0.440
Angi ↗ Q85741689 EXACT TITLE
allowsamericancontractorsdirectoryhomejanuarylocalmodelownedplansreviewswork
SHARED TOKENS (12): "allows", "american", "contractors", "directory", "home", "january", "local", "model", "owned", "plans", "reviews", "work". | EXACT TITLE in cleaning_services: "Angi".
0.420
Dairy ↗ Q637776 EXACT TITLE
buildingconstitutededicateddescribesexamplefoodindustryprocessesproducesproductionworkers
SHARED TOKENS (11): "building", "constitute", "dedicated", "describes", "example", "food", "industry", "processes", "produces", "production", "workers". | EXACT TITLE in cleaning_services: "Dairy".
0.420
constructioncontrolcontrolsgenerallymanagementmeasuresneedsitesoilstormwater
SHARED TOKENS (11): "construction", "control", "controls", "generally", "management", "measures", "need", "site", "soil", "storm", "water". | EXACT TITLE in energy_utilities: "Sediment control".
0.420
agricultureamericanboisebureaucountiesengineeringidaholevelnationalwaterwestern
SHARED TOKENS (11): "agriculture", "american", "boise", "bureau", "counties", "engineering", "idaho", "level", "national", "water", "western". | EXACT TITLE in energy_utilities: "Arrowrock Dam".
0.420
HIV ↗ Q15787 EXACT TITLE
allowscontactdirectexposurelevellevelsmechanismsresearchspecificallysystemtreatment
SHARED TOKENS (11): "allows", "contact", "direct", "exposure", "level", "levels", "mechanisms", "research", "specifically", "system", "treatment". | EXACT TITLE in cleaning_services: "HIV".
0.420
activitiesamongapplieseducationemploymenthistoryidentificationnecessarypersonprocessvary
SHARED TOKENS (11): "activities", "among", "applies", "education", "employment", "history", "identification", "necessary", "person", "process", "vary". | EXACT TITLE in cleaning_services: "Background check".
0.400
airdesignexamplehvacmethodplanningpressurequalitysupplysystem
SHARED TOKENS (10): "air", "design", "example", "hvac", "method", "planning", "pressure", "quality", "supply", "system". | EXACT TITLE in cleaning_services: "Duct (flow)". | EXACT TITLE in energy_utilities: "Duct (flow)".
0.400
Cleaning ↗ EXACT TITLE
activitycleaningdifferentenvironmentenvironmentaloccupationsprocessprotectionsafetyuses
SHARED TOKENS (10): "activity", "cleaning", "different", "environment", "environmental", "occupations", "process", "protection", "safety", "uses". | EXACT TITLE in cleaning_services: "Cleaning". | EXACT TITLE in energy_utilities: "Cleaning".
0.400
Restaurant ↗ Q11707 EXACT TITLE
businesscustomersfoodgenerallymodelsrestaurantservedservessinglevary
SHARED TOKENS (10): "business", "customers", "food", "generally", "models", "restaurant", "served", "serves", "single", "vary". | EXACT TITLE in cleaning_services: "Restaurant". | EXACT TITLE in energy_utilities: "Restaurant".
0.400
Maid ↗ Q833860 EXACT TITLE
alongsidecategorydomesticemploymentremainspecificallytypeurbanwesternwork
SHARED TOKENS (10): "alongside", "category", "domestic", "employment", "remain", "specifically", "type", "urban", "western", "work". | EXACT TITLE in cleaning_services: "Maid".
0.380
Detergent ↗ Q334637 EXACT TITLE
applicationcleaningcomponentsexperiencemainproductpropertiesthemwater
SHARED TOKENS (9): "application", "cleaning", "components", "experience", "main", "product", "properties", "them", "water". | EXACT TITLE in cleaning_services: "Detergent".
0.380
differentgenerallylawlegalphysicalsurfacesystemstreatwater
SHARED TOKENS (9): "different", "generally", "law", "legal", "physical", "surface", "systems", "treat", "water". | EXACT TITLE in energy_utilities: "Water right".
0.360
Virucide ↗ Q3560867 EXACT TITLE
activitycategorychemicaldifferentfalloutsidephysicalsurface
SHARED TOKENS (8): "activity", "category", "chemical", "different", "fall", "outside", "physical", "surface". | EXACT TITLE in cleaning_services: "Virucide".
0.360
Reservoir ↗ Q131681 EXACT TITLE
buildingbuiltdrainsexistingformpowerstoragewater
SHARED TOKENS (8): "building", "built", "drains", "existing", "form", "power", "storage", "water". | EXACT TITLE in energy_utilities: "Reservoir".
0.360
boisedepartmentenvironmentalfederalidahomainqualityregional
SHARED TOKENS (8): "boise", "department", "environmental", "federal", "idaho", "main", "quality", "regional". | EXACT TITLE in energy_utilities: "Idaho Department of Environmental Quality".
0.360
Glassdoor ↗ Q15954148 EXACT TITLE
americancurrentemploymentindependentoperateownerratingsreviews
SHARED TOKENS (8): "american", "current", "employment", "independent", "operate", "owner", "ratings", "reviews". | EXACT TITLE in cleaning_services: "Glassdoor".
0.350
cleaningdisposalindustrialmaterialspotentiallyregulatedrequiretreatmenttypewaste
SHARED TOKENS (10): "cleaning", "disposal", "industrial", "materials", "potentially", "regulated", "require", "treatment", "type", "waste". | URL->A (1): https://www.osha.gov/laws-regs/regulations/standardnumber/1910/1910.1030.
0.340
changescleaningprocessresultshapespecialtywater
SHARED TOKENS (7): "changes", "cleaning", "process", "result", "shape", "specialty", "water". | EXACT TITLE in cleaning_services: "Dry cleaning".
0.340
aircontrolleddesigngasinternalpowersystem
SHARED TOKENS (7): "air", "controlled", "design", "gas", "internal", "power", "system". | EXACT TITLE in cleaning_services: "Exhaust system".
0.340
controlsfallfallsmakingpersonnelprotectiontraining
SHARED TOKENS (7): "controls", "fall", "falls", "making", "personnel", "protection", "training". | EXACT TITLE in cleaning_services: "Fall protection".
0.340
canyonidahonationalrecreationsmallwaterswestern
SHARED TOKENS (7): "canyon", "idaho", "national", "recreation", "small", "waters", "western". | EXACT TITLE in energy_utilities: "Hells Canyon".
0.340
Smoke ↗ Q130768 EXACT TITLE
aircombinationcontrolinternalproducesignalssolid
SHARED TOKENS (7): "air", "combination", "control", "internal", "produce", "signals", "solid". | EXACT TITLE in cleaning_services: "Smoke".
0.320
airamericancleaninghomeofficewater
SHARED TOKENS (6): "air", "american", "cleaning", "home", "office", "water". | EXACT TITLE in cleaning_services: "Stanley Steemer".
0.320
Bactericide ↗ Q804539 EXACT TITLE
examplephysicalpropertiessolelystructuresurface
SHARED TOKENS (6): "example", "physical", "properties", "solely", "structure", "surface". | EXACT TITLE in cleaning_services: "Bactericide".
0.320
applicationscleaningdomestichouseholdindustrialuses
SHARED TOKENS (6): "applications", "cleaning", "domestic", "household", "industrial", "uses". | EXACT TITLE in cleaning_services: "Steam cleaning".
0.320
organizationsprovidingpublicregulatorysystemwater
SHARED TOKENS (6): "organizations", "providing", "public", "regulatory", "system", "water". | EXACT TITLE in energy_utilities: "Public water system".
0.320
Odor ↗ Q485537 EXACT TITLE
americanchemicalfoodgenerallyindustrysystem
SHARED TOKENS (6): "american", "chemical", "food", "generally", "industry", "system". | EXACT TITLE in cleaning_services: "Odor".
0.320
Pesticide ↗ Q131656 EXACT TITLE
accountchemicalcontrolpropertyprotectprotection
SHARED TOKENS (6): "account", "chemical", "control", "property", "protect", "protection". | EXACT TITLE in cleaning_services: "Pesticide".
0.300
associationconsumerdesigngrowthindependentlyindustryintegratedintensitylawlicensedmakingmarketmethodnetworkspowerproducingproductionrapidreachresearch
SHARED TOKENS (26): "association", "consumer", "design", "growth", "independently", "industry", "integrated", "intensity", "law", "licensed", "making", "market", "method", "networks", "power", "producing", "production", "rapid", "reach", "research"....
0.300
Project finance ↗ KW CROSS HIGH
addressamongassetscapitalcomponentconstructioncontractscontrolcorporatedistributedeconomicentityenvironmentalfinancefinancialgenerallyhigheridentificationindustrialinfrastructure
SHARED TOKENS (43): "address", "among", "assets", "capital", "component", "construction", "contracts", "control", "corporate", "distributed", "economic", "entity", "environmental", "finance", "financial", "generally", "higher", "identification", "industrial", "infrastructure"....
0.300
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingbuildingscodescomponentconstructiondepartmentdivisionfirehazardinspectionsmeasurespracticessafetyschoolssetstructures
SHARED TOKENS (16): "building", "buildings", "codes", "component", "construction", "department", "division", "fire", "hazard", "inspections", "measures", "practices", "safety", "schools", "set", "structures".
0.300
additionalapplicationsboundariesbuiltcapacitycombinesdepartmentelectricityenergyexampleextractionformationindustrialindustryneedspowerprocessesproduceratesupply
SHARED TOKENS (21): "additional", "applications", "boundaries", "built", "capacity", "combines", "department", "electricity", "energy", "example", "extraction", "formation", "industrial", "industry", "needs", "power", "processes", "produce", "rate", "supply"....
0.300
Facility management ↗ KW CROSS HIGH
buildingbuildingscleaningdefineselectricalexamplefacilitiesfacilityfieldinternationalmaintenancemanagementmechanicaloperationsplanningrequirementssitesstandardstandardssupport
SHARED TOKENS (23): "building", "buildings", "cleaning", "defines", "electrical", "example", "facilities", "facility", "field", "international", "maintenance", "management", "mechanical", "operations", "planning", "requirements", "sites", "standard", "standards", "support"....
0.300
Black start ↗ Q655257 KW CROSS HIGH
abilityanotherelectricalelectricityemergencyenergyfacilityindustriallargemainnetworkoperationperformpowerprocessprovidingrequirestechnology
SHARED TOKENS (18): "ability", "another", "electrical", "electricity", "emergency", "energy", "facility", "industrial", "large", "main", "network", "operation", "perform", "power", "process", "providing", "requires", "technology".
0.300
allowsbaseconsumercontroldemanddirectelectricalelectricityentitiesevenexampleindustrymakesmanagementneednetworkpowerprivateprocesspublic
SHARED TOKENS (24): "allows", "base", "consumer", "control", "demand", "direct", "electrical", "electricity", "entities", "even", "example", "industry", "makes", "management", "need", "network", "power", "private", "process", "public"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
capacityconnectedelectricalelectricityenergyenvironmentgasgenerallyhighernearlyneedspowersolarsouthernstoragesuppliedsupplywinterwork
SHARED TOKENS (19): "capacity", "connected", "electrical", "electricity", "energy", "environment", "gas", "generally", "higher", "nearly", "needs", "power", "solar", "southern", "storage", "supplied", "supply", "winter", "work".
0.300
applicationscapacitydefinesdemandenergyexampleformfullgrowthintegratedlawmeansplanningpowerprocessproductionpublicrequiresresourcesupply
SHARED TOKENS (21): "applications", "capacity", "defines", "demand", "energy", "example", "form", "full", "growth", "integrated", "law", "means", "planning", "power", "process", "production", "public", "requires", "resource", "supply"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
allowingallowsarrangementconnectionconsumerscurrentelectricityenergyevenfeemechanismnetpolicypowerprivateprocedurerequirerequiresretailsingle
SHARED TOKENS (27): "allowing", "allows", "arrangement", "connection", "consumers", "current", "electricity", "energy", "even", "fee", "mechanism", "net", "policy", "power", "private", "procedure", "require", "requires", "retail", "single"....
0.300
Bleach ↗ Q11587 KW CROSS HIGH
activechemicalcleaningcontactcontrolequipmentfoodgasgenerallyhouseholdindustrialmakingmaterialsnamenicheprocessprocessesproductpropertiessanitation
SHARED TOKENS (24): "active", "chemical", "cleaning", "contact", "control", "equipment", "food", "gas", "generally", "household", "industrial", "making", "materials", "name", "niche", "process", "processes", "product", "properties", "sanitation"....
0.300
actamericanamongassociationauthoritybureauconstructioncontractsdepartmentfederallandlawmaintenancemajormeridiannationalnearlyprogramprojectprovisions
SHARED TOKENS (28): "act", "american", "among", "association", "authority", "bureau", "construction", "contracts", "department", "federal", "land", "law", "maintenance", "major", "meridian", "national", "nearly", "program", "project", "provisions"....
0.300
activitiesadvancedagricultureallowsbusinessescasecombinationdirectdistributionenvironmentalindustrialindustrymanagementmunicipalneedsprocessreachrecoveryregionremain
SHARED TOKENS (32): "activities", "advanced", "agriculture", "allows", "businesses", "case", "combination", "direct", "distribution", "environmental", "industrial", "industry", "management", "municipal", "needs", "process", "reach", "recovery", "region", "remain"....
0.300
americanbuildbureaubusinessbusinessescurrentdatadepartmentdepartmentseconomiceconomyfederalfirehospitalsinformationinfrastructurelocalmaintainmakingplan
SHARED TOKENS (28): "american", "build", "bureau", "business", "businesses", "current", "data", "department", "departments", "economic", "economy", "federal", "fire", "hospitals", "information", "infrastructure", "local", "maintain", "making", "plan"....
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
advancedcapacitycodeconnectcontrolcreatecurrentdemanddistributeddistributionelectricalelectricityenergyevenfullfunctionhomehoursindustryinformation
SHARED TOKENS (51): "advanced", "capacity", "code", "connect", "control", "create", "current", "demand", "distributed", "distribution", "electrical", "electricity", "energy", "even", "full", "function", "home", "hours", "industry", "information"....
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
applicationbuildcustomersdifferentdistributionelectricalequipmentgenerallyhigherincreasinglylargepowerpublicrelatedresidentialsafetystreetsupportsystemsystems
SHARED TOKENS (24): "application", "build", "customers", "different", "distribution", "electrical", "equipment", "generally", "higher", "increasingly", "large", "power", "public", "related", "residential", "safety", "street", "support", "system", "systems"....
0.300
analysisaroundbuildingbuildingscapacitycommercialcomponentsdistributedelectricalenergyenvironmentequipmentformindustriallargemanagementmonitoringnetpanelspower
SHARED TOKENS (30): "analysis", "around", "building", "buildings", "capacity", "commercial", "components", "distributed", "electrical", "energy", "environment", "equipment", "form", "industrial", "large", "management", "monitoring", "net", "panels", "power"....
0.300
brandchemicalconsumerdatadifferentenvironmentalhazardinformationinstructionslabellistsnamenamesnationaloccupationalproceduresproductrequirementsrisksafety
SHARED TOKENS (24): "brand", "chemical", "consumer", "data", "different", "environmental", "hazard", "information", "instructions", "label", "lists", "name", "names", "national", "occupational", "procedures", "product", "requirements", "risk", "safety"....
0.300
barrierscapitalcasecreatingeconomicselectricityentryfirmfirmsformindustryinfrastructurelargemarketoperateprovidingpublicregulationscalesingle
SHARED TOKENS (24): "barriers", "capital", "case", "creating", "economics", "electricity", "entry", "firm", "firms", "form", "industry", "infrastructure", "large", "market", "operate", "providing", "public", "regulation", "scale", "single"....
0.300
aroundcapacitycomponentscreatecreatescreatingdownstreamenergyformgashandlinglevellocalmainmarketmeansnetworkspetroleumpressureprocess
SHARED TOKENS (34): "around", "capacity", "components", "create", "creates", "creating", "downstream", "energy", "form", "gas", "handling", "level", "local", "main", "market", "means", "networks", "petroleum", "pressure", "process"....
0.300
Combined sewer ↗ Q361472 KW CROSS HIGH
buildingbuildingscapacityconstructioncontactsdesigndischargesdisposaldrainageenvironmentalexperiencefacilitieshigherindustrialinfrastructurelargemeansoperateratereceive
SHARED TOKENS (40): "building", "buildings", "capacity", "construction", "contacts", "design", "discharges", "disposal", "drainage", "environmental", "experience", "facilities", "higher", "industrial", "infrastructure", "large", "means", "operate", "rate", "receive"....
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalapplicationsavailabilitybidcapacitycurrentdemanddirectdistributionelectricalelectricityenergyfinancialgasgrowthhistoryinternationallandlargemain
SHARED TOKENS (44): "additional", "applications", "availability", "bid", "capacity", "current", "demand", "direct", "distribution", "electrical", "electricity", "energy", "financial", "gas", "growth", "history", "international", "land", "large", "main"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
abilityadditionalaffectaroundbarriersbaseconstituteeconomiceconomyexamplefacilitiesfinancialhealthcarehistoryinformationmaintenancemeansmechanismmedicalneeds
SHARED TOKENS (36): "ability", "additional", "affect", "around", "barriers", "base", "constitute", "economic", "economy", "example", "facilities", "financial", "healthcare", "history", "information", "maintenance", "means", "mechanism", "medical", "needs"....
0.300
actagainstagenciesappropriateauthoritychemicalcomplianceconsumerscontrolenvironmentenvironmentalepafederalframeworkgoverninglawprocessprotectprotectionregistration
SHARED TOKENS (26): "act", "against", "agencies", "appropriate", "authority", "chemical", "compliance", "consumers", "control", "environment", "environmental", "epa", "federal", "framework", "governing", "law", "process", "protect", "protection", "registration"....
0.300
collegeeconomiceducationeducationalformalhigherknowledgelevellevelsnamesoccupationspersonrelatedschoolschoolsspecializedspecificallytechnicaltechnologytrade
SHARED TOKENS (22): "college", "economic", "education", "educational", "formal", "higher", "knowledge", "level", "levels", "names", "occupations", "person", "related", "school", "schools", "specialized", "specifically", "technical", "technology", "trade"....
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
connecteddischargeddomesticenvironmentfacilityfieldmethodprocessesratesystemsystemsthereforetreatedtreatmenttypewastewastewater
SHARED TOKENS (17): "connected", "discharged", "domestic", "environment", "facility", "field", "method", "processes", "rate", "system", "systems", "therefore", "treated", "treatment", "type", "waste", "wastewater".
0.300
allowsapprenticeshipassociationconstructioncontractorsdataelectricalindustryinternationallabornationalnetworksprogramspublicrelatedrepresentstradetrainingworkworkers
SHARED TOKENS (20): "allows", "apprenticeship", "association", "construction", "contractors", "data", "electrical", "industry", "international", "labor", "national", "networks", "programs", "public", "related", "represents", "trade", "training", "work", "workers".
0.300
additionalbuildingcurrentdepartmentdirectlydirectsenergyfederalhandlinglaboratoriesnationaloriginatingphysicalpolicypowerproductionprogramprojectresearchserved
SHARED TOKENS (21): "additional", "building", "current", "department", "directly", "directs", "energy", "federal", "handling", "laboratories", "national", "originating", "physical", "policy", "power", "production", "program", "project", "research", "served"....
0.300
actadministrationcodeenvironmentexposurefederalgoverninglaborlawlevelsmainmechanicalnationaloccupationalprivatesafety
SHARED TOKENS (16): "act", "administration", "code", "environment", "exposure", "federal", "governing", "labor", "law", "levels", "main", "mechanical", "national", "occupational", "private", "safety".
0.300
associationavailabilitybusinessbusinessescharacteristicscorporatecorporationsdifferentdistinctentityexampleforminternallegallicenselimitedmedicaloperatingoperationsowner
SHARED TOKENS (33): "association", "availability", "business", "businesses", "characteristics", "corporate", "corporations", "different", "distinct", "entity", "example", "form", "internal", "legal", "license", "limited", "medical", "operating", "operations", "owner"....
0.300
againstallowingallowschangescommercialcontrolledcurrentdifferentdirecteconomyformindependentlynetworknetworkspowerrapidrequiresystemsystemstechnology
SHARED TOKENS (21): "against", "allowing", "allows", "changes", "commercial", "controlled", "current", "different", "direct", "economy", "form", "independently", "network", "networks", "power", "rapid", "require", "system", "systems", "technology"....
0.300
actactivitiesadministrationbusinessbusinessescapitalcentersconnectcontractsdirectoryeconomiceconomyfederalindependentjanuaryleastmaintainmakingofficeowners
SHARED TOKENS (27): "act", "activities", "administration", "business", "businesses", "capital", "centers", "connect", "contracts", "directory", "economic", "economy", "federal", "independent", "january", "least", "maintain", "making", "office", "owners"....
0.300
allowsbecomebuiltconnectedconnectingconsumerscurrentcustomersdistributionelectricalelectricityenergylargemarketsnearlyneednetworkoperatepopulationpower
SHARED TOKENS (26): "allows", "become", "built", "connected", "connecting", "consumers", "current", "customers", "distribution", "electrical", "electricity", "energy", "large", "markets", "nearly", "need", "network", "operate", "population", "power"....
0.300
anotherapplicationscapacityconsumerdemanddifferentdischargeenergyenvironmentalfireformgasgenerallyhazardhigherlargemainmaterialspotentiallypower
SHARED TOKENS (31): "another", "applications", "capacity", "consumer", "demand", "different", "discharge", "energy", "environmental", "fire", "form", "gas", "generally", "hazard", "higher", "large", "main", "materials", "potentially", "power"....
0.300
activityamongassociationboisebureaucanyoncapacitycentercountiescreatesdirectlyedgefederalformationidaholevellocalnampanationaloffice
SHARED TOKENS (29): "activity", "among", "association", "boise", "bureau", "canyon", "capacity", "center", "counties", "creates", "directly", "edge", "federal", "formation", "idaho", "level", "local", "nampa", "national", "office"....
0.300
againstanalysisbroaderbuildingchangescontrolengineeringexampleexposurehandlinginfrastructureintensitylevellevelsmanagementmeasurespracticesprocessespropertiesproviding
SHARED TOKENS (30): "against", "analysis", "broader", "building", "changes", "control", "engineering", "example", "exposure", "handling", "infrastructure", "intensity", "level", "levels", "management", "measures", "practices", "processes", "properties", "providing"....
0.300
amongassociationavailabilitybecomedistributionenergyhouseholdinternationallimitednationalpowerrapidresultsolarsupplies
SHARED TOKENS (15): "among", "association", "availability", "become", "distribution", "energy", "household", "international", "limited", "national", "power", "rapid", "result", "solar", "supplies".
0.300
Dentistry ↗ Q12128 KW CROSS HIGH
affectarrangementcallshistoryhospitalsinstitutionsmanagementmedicalpracticesprivaterequireresearchspecialtytechnicianstreatmentwaterwork
SHARED TOKENS (17): "affect", "arrangement", "calls", "history", "hospitals", "institutions", "management", "medical", "practices", "private", "require", "research", "specialty", "technicians", "treatment", "water", "work".
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcommissioncompetitiveconsolidationcontrolcorporatecreatedepartmentdirectentitiesentityexamplefederal
SHARED TOKENS (39): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "commission", "competitive", "consolidation", "control", "corporate", "create", "department", "direct", "entities", "entity", "example", "federal"....
0.300
activitiesaffectanotherappropriatechangescontroldischargesexampleformindustrialinfrastructuremainmanagementplanspollutantspowerreducesrequiresresourceresult
SHARED TOKENS (30): "activities", "affect", "another", "appropriate", "changes", "control", "discharges", "example", "form", "industrial", "infrastructure", "main", "management", "plans", "pollutants", "power", "reduces", "requires", "resource", "result"....
0.300
affectagainstarrangementcasecompensationcontractdedicatedevenlegalpolicyprotectprotectionratherriskrulesystemthough
SHARED TOKENS (17): "affect", "against", "arrangement", "case", "compensation", "contract", "dedicated", "even", "legal", "policy", "protect", "protection", "rather", "risk", "rule", "system", "though".
0.300
businessescapacitychangesconsumerscustomercustomersdemanddirectdirectlyeconomicelectricityenergyexplicitfullhigherimplicationlargemanagementnetnetworks
SHARED TOKENS (37): "businesses", "capacity", "changes", "consumers", "customer", "customers", "demand", "direct", "directly", "economic", "electricity", "energy", "explicit", "full", "higher", "implication", "large", "management", "net", "networks"....
0.300
agriculturechangeschemicalclassificationdifferentenvironmentalfoodformhomeindustriallevelsmakingnecessaryneedsphysicalproductwaste
SHARED TOKENS (17): "agriculture", "changes", "chemical", "classification", "different", "environmental", "food", "form", "home", "industrial", "levels", "making", "necessary", "needs", "physical", "product", "waste".
0.300
Energy conservation ↗ KW CROSS HIGH
activitiesaffectanotherappliancecomponentseconomicenergyengineeringenvironmentalexamplefootprintformgasgrowthhoursidentifylargemaintenancemonitoringoperations
SHARED TOKENS (27): "activities", "affect", "another", "appliance", "components", "economic", "energy", "engineering", "environmental", "example", "footprint", "form", "gas", "growth", "hours", "identify", "large", "maintenance", "monitoring", "operations"....
0.300
amongcasecompensationeconomicemploymentformgenerallylimitedmedicaloutsideplansprovidingresultsystemwageworkers
SHARED TOKENS (16): "among", "case", "compensation", "economic", "employment", "form", "generally", "limited", "medical", "outside", "plans", "providing", "result", "system", "wage", "workers".
0.300
Child care ↗ Q1455871 KW CROSS HIGH
activitiesadvancedanotherappropriatecenterscertifiedcomponentcoreeconomiceducationeducationalfacilityformhomesimplicationsinstitutionslaborlicensedorganizationsperson
SHARED TOKENS (31): "activities", "advanced", "another", "appropriate", "centers", "certified", "component", "core", "economic", "education", "educational", "facility", "form", "homes", "implications", "institutions", "labor", "licensed", "organizations", "person"....
0.300
Ammonia ↗ Q4087 KW CROSS HIGH
agriculturearoundbuildingchemicalcleaningdirectlyenergyevenformgashazardoushouseholdindustrialneedspressureprocessproductionprovidingservingsoil
SHARED TOKENS (24): "agriculture", "around", "building", "chemical", "cleaning", "directly", "energy", "even", "form", "gas", "hazardous", "household", "industrial", "needs", "pressure", "process", "production", "providing", "serving", "soil"....
0.300
actappropriatechemicalclassificationcurrentdataenforcementfederalfullhandlinghazardhazardousmakingnecessaryprocessproductprotectionregulationrelatedrequires
SHARED TOKENS (27): "act", "appropriate", "chemical", "classification", "current", "data", "enforcement", "federal", "full", "handling", "hazard", "hazardous", "making", "necessary", "process", "product", "protection", "regulation", "related", "requires"....
0.300
activitiescharacteristicschemicalcontactdisposaldistinctemergencyenvironmentenvironmentalfacilitieshazardoushealthcarehomehomeshospitalhospitalsindustriallaboratoriesmaterialsmedical
SHARED TOKENS (30): "activities", "characteristics", "chemical", "contact", "disposal", "distinct", "emergency", "environment", "environmental", "facilities", "hazardous", "healthcare", "home", "homes", "hospital", "hospitals", "industrial", "laboratories", "materials", "medical"....
0.300
becomebusinesscentralcharacteristicscommercialcreatingfinancialhistoryindependentinstitutionsnameorganizationsownerspersonsprojectprovidingrisksmall
SHARED TOKENS (18): "become", "business", "central", "characteristics", "commercial", "creating", "financial", "history", "independent", "institutions", "name", "organizations", "owners", "persons", "project", "providing", "risk", "small".
0.300
accountcombinationdomesticfacilitiesfacilityinfrastructuremunicipalproducespropertypublicservedsystemstreattreatmenttypewastewaterwestern
SHARED TOKENS (17): "account", "combination", "domestic", "facilities", "facility", "infrastructure", "municipal", "produces", "property", "public", "served", "systems", "treat", "treatment", "type", "wastewater", "western".
0.300
Solar inverter ↗ Q129316 KW CROSS HIGH
allowingcommercialcomponentcurrentdirectelectricalequipmentfunctionslocalnetworkordinarypowerprotectionsolarsystemtypeutility
SHARED TOKENS (17): "allowing", "commercial", "component", "current", "direct", "electrical", "equipment", "functions", "local", "network", "ordinary", "power", "protection", "solar", "system", "type", "utility".
0.300
amongcapacitydistributedelectricityemploymentenergygasincreasinglyindustrylocalobtainoverviewpercentplanspowerprojectrequiringresearchscaleset
SHARED TOKENS (26): "among", "capacity", "distributed", "electricity", "employment", "energy", "gas", "increasingly", "industry", "local", "obtain", "overview", "percent", "plans", "power", "project", "requiring", "research", "scale", "set"....
0.300
demanddirectlydistributionelectricalelectricityenergyexamplegasgrowthhomesindustrymeansmethodpowerprocessproductionproposedreportedsolarstorage
SHARED TOKENS (22): "demand", "directly", "distribution", "electrical", "electricity", "energy", "example", "gas", "growth", "homes", "industry", "means", "method", "power", "process", "production", "proposed", "reported", "solar", "storage"....
0.300
affectagricultureanalysisapplicationboundarycasecharacteristicsdifferentedgeexamplelandmakingmanagementmeansmechanismsmodelmodelsmonitoringpollutantspresence
SHARED TOKENS (39): "affect", "agriculture", "analysis", "application", "boundary", "case", "characteristics", "different", "edge", "example", "land", "making", "management", "means", "mechanisms", "model", "models", "monitoring", "pollutants", "presence"....
0.300
amongcapacitycleanconstructioncreatingdemanddirectelectricalelectricityenergyenvironmentalgaslandlargemakingnearlypopulationpowerprincipallyproduces
SHARED TOKENS (26): "among", "capacity", "clean", "construction", "creating", "demand", "direct", "electrical", "electricity", "energy", "environmental", "gas", "land", "large", "making", "nearly", "population", "power", "principally", "produces"....
0.300
adaboisebuiltbureauconstructioncontroldirectlydownstreamelectricityfederalfullidaholeveloperatingoperationalpowerprivatesouthernutilitywestern
SHARED TOKENS (20): "ada", "boise", "built", "bureau", "construction", "control", "directly", "downstream", "electricity", "federal", "full", "idaho", "level", "operating", "operational", "power", "private", "southern", "utility", "western".
0.300
connectsconsumerscurrentcustomersdirectdirectlydistinctdistributionelectricalelectricityenergyevenformhandlinghigherindustrylevellocalmajormarket
SHARED TOKENS (29): "connects", "consumers", "current", "customers", "direct", "directly", "distinct", "distribution", "electrical", "electricity", "energy", "even", "form", "handling", "higher", "industry", "level", "local", "major", "market"....
0.300
actadministrationairamongbuildingcentercenterscompensationcontroldepartmentdistinctdivisionengineeringexposurefederalfieldfunctionshazardindustrialinformation
SHARED TOKENS (41): "act", "administration", "air", "among", "building", "center", "centers", "compensation", "control", "department", "distinct", "division", "engineering", "exposure", "federal", "field", "functions", "hazard", "industrial", "information"....
0.300
administrationboisebuiltcanyoncapacitycontractordrainageenergyfallsidahoinformationlevelownedpowerprojectwestern
SHARED TOKENS (16): "administration", "boise", "built", "canyon", "capacity", "contractor", "drainage", "energy", "falls", "idaho", "information", "level", "owned", "power", "project", "western".
0.300
amongcleaningcomponentconnectscontroldepartmenthealthcarehospitalinfrastructurelocalmeasuresmedicalmonitoringnecessaryprotectionpublicratherrelatedsafetyset
SHARED TOKENS (21): "among", "cleaning", "component", "connects", "control", "department", "healthcare", "hospital", "infrastructure", "local", "measures", "medical", "monitoring", "necessary", "protection", "public", "rather", "related", "safety", "set"....
0.300
Off-the-grid ↗ Q267162 KW CROSS HIGH
allowsbuildingbuildingscannotconnectedelectricalenergyenvironmentalfoodgasgenerallyhomesindependentisolateditselfpublicreachresidentialscalesewer
SHARED TOKENS (26): "allows", "building", "buildings", "cannot", "connected", "electrical", "energy", "environmental", "food", "gas", "generally", "homes", "independent", "isolated", "itself", "public", "reach", "residential", "scale", "sewer"....
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adaairbaseboisecentercommercialcommissiondepartmentfacilityfallsfieldfirefunctionsidahointernationalnationaloperatesprotectionreceiverequiring
SHARED TOKENS (23): "ada", "air", "base", "boise", "center", "commercial", "commission", "department", "facility", "falls", "field", "fire", "functions", "idaho", "international", "national", "operates", "protection", "receive", "requiring"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
accuracyamericanassociationbuildingcommercialdeterminemechanicalmethodoutsideprocesspublicrequirementsresidentialsetstandardssuppliedsupplysystemtechnologytype
SHARED TOKENS (22): "accuracy", "american", "association", "building", "commercial", "determine", "mechanical", "method", "outside", "process", "public", "requirements", "residential", "set", "standards", "supplied", "supply", "system", "technology", "type"....
0.300
buildingcapabilitycodecodescommissioncontrolcurrentdesigndistributionelectricalenvironmentalexposurefireinternationallargelevelslocalmodelnationaloperating
SHARED TOKENS (32): "building", "capability", "code", "codes", "commission", "control", "current", "design", "distribution", "electrical", "environmental", "exposure", "fire", "international", "large", "levels", "local", "model", "national", "operating"....
0.300
contactdirectenergyequipmenthazardousisolatedlawmaintenancemethodpowerprocedurerepairrequiressafetywork
SHARED TOKENS (15): "contact", "direct", "energy", "equipment", "hazardous", "isolated", "law", "maintenance", "method", "power", "procedure", "repair", "requires", "safety", "work".
0.300
administersagriculturecommercialcomponentcurrentdepartmentdirectlyfederalfoodnationalneedsproductionprogramprogramspromotessafetyservedtrade
SHARED TOKENS (18): "administers", "agriculture", "commercial", "component", "current", "department", "directly", "federal", "food", "national", "needs", "production", "program", "programs", "promotes", "safety", "served", "trade".
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactivitiesactualadditionaladministrationagenciesauthorizesbusinesscannotchemicalcleancleaningcombinationcompensationcontrolsdepartmentdetermineenvironmentenvironmental
SHARED TOKENS (55): "acquisition", "act", "activities", "actual", "additional", "administration", "agencies", "authorizes", "business", "cannot", "chemical", "clean", "cleaning", "combination", "compensation", "controls", "department", "determine", "environment", "environmental"....
0.300
competedistributiondrainselectricitygasmajornationalprocesspublicstormstreettrafficutilitywastewaterwater
SHARED TOKENS (15): "compete", "distribution", "drains", "electricity", "gas", "major", "national", "process", "public", "storm", "street", "traffic", "utility", "wastewater", "water".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
applyappropriateauthoritybuildingbuildingscasecodecodescomplianceconstructioncontroldepartmentsdesignelectricalenvironmentalestateexamplefacilitygenerallyinternational
SHARED TOKENS (48): "apply", "appropriate", "authority", "building", "buildings", "case", "code", "codes", "compliance", "construction", "control", "departments", "design", "electrical", "environmental", "estate", "example", "facility", "generally", "international"....
0.300
Nursing home ↗ Q837142 KW CROSS HIGH
activitiesamericanassociationdifferentemergencyfacilitiesfacilityhomehomeshospitalhoursinstitutionsmedicalnearlyneedneedsoccupationalphysicalprivatepublic
SHARED TOKENS (24): "activities", "american", "association", "different", "emergency", "facilities", "facility", "home", "homes", "hospital", "hours", "institutions", "medical", "nearly", "need", "needs", "occupational", "physical", "private", "public"....
0.300
actualchangescontrolcontrolledcontrolsdownstreamequipmentgaslevelmaintainmaintainsmechanismmechanismsparallelplacingpressurereducesregulatedresponseseparate
SHARED TOKENS (21): "actual", "changes", "control", "controlled", "controls", "downstream", "equipment", "gas", "level", "maintain", "maintains", "mechanism", "mechanisms", "parallel", "placing", "pressure", "reduces", "regulated", "response", "separate"....
0.300
actadministrationapplyassetsauthorizationbusinessbusinessescertificationcorporationsdefinitionhomehomesindustryinspectionlargelicensemeasuresmedicalnetoperate
SHARED TOKENS (35): "act", "administration", "apply", "assets", "authorization", "business", "businesses", "certification", "corporations", "definition", "home", "homes", "industry", "inspection", "large", "license", "measures", "medical", "net", "operate"....
0.300
applieschemicaldescribesdischargedisposalenvironmentextractionfacilitiesfoodgasindustrialindustrymaterialsmunicipalpetroleumpollutantspowerpreservingprocessprocesses
SHARED TOKENS (31): "applies", "chemical", "describes", "discharge", "disposal", "environment", "extraction", "facilities", "food", "gas", "industrial", "industry", "materials", "municipal", "petroleum", "pollutants", "power", "preserving", "process", "processes"....
0.300
actadministrationdepartmenteducationemploymentfederalfirminspectionslaborlawoccupationalprovidingratingsregulatorysafetysalesstandardstraining
SHARED TOKENS (18): "act", "administration", "department", "education", "employment", "federal", "firm", "inspections", "labor", "law", "occupational", "providing", "ratings", "regulatory", "safety", "sales", "standards", "training".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherarrangementbrandbusinesscapitalcompetecorporatedirecteconomicentityexampleexpansionexplicitlyfinancialgrowthlargelegallicenseslicensingmarket
SHARED TOKENS (33): "another", "arrangement", "brand", "business", "capital", "compete", "corporate", "direct", "economic", "entity", "example", "expansion", "explicitly", "financial", "growth", "large", "legal", "licenses", "licensing", "market"....
0.300
airanotherbeyondcapacityconnecteddemandeconomiceconomicselectricalelectricityenergyexperienceformhourslargemakingmanagementneedpowerprice
SHARED TOKENS (28): "air", "another", "beyond", "capacity", "connected", "demand", "economic", "economics", "electrical", "electricity", "energy", "experience", "form", "hours", "large", "making", "management", "need", "power", "price"....
0.300
Solar power ↗ Q1483757 KW CROSS HIGH
applicationsbuiltcapacitycommercialcurrentdirectlyelectricityenergyhomesintegrationinternationallargemethodpanelspolicypowerproducesproductionregulationremote
SHARED TOKENS (26): "applications", "built", "capacity", "commercial", "current", "directly", "electricity", "energy", "homes", "integration", "international", "large", "method", "panels", "policy", "power", "produces", "production", "regulation", "remote"....
0.300
Domestic worker ↗ Q54128 KW CROSS HIGH
appliescategorycleaningdomesticemploymenthomehouseholdlargelimitedmaintenancemanagementnecessaryoccupationalpersonprovidingregulatedsubjectsystemthoughwork
SHARED TOKENS (21): "applies", "category", "cleaning", "domestic", "employment", "home", "household", "large", "limited", "maintenance", "management", "necessary", "occupational", "person", "providing", "regulated", "subject", "system", "though", "work"....
0.300
agenciesbuildingsbuiltcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublic
SHARED TOKENS (22): "agencies", "buildings", "built", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public"....
0.300
boisebureaucapacitycomponentsidahonamenampanationalprogramprojectsettreasurevalleywaterwestern
SHARED TOKENS (15): "boise", "bureau", "capacity", "components", "idaho", "name", "nampa", "national", "program", "project", "set", "treasure", "valley", "water", "western".
0.300
actagricultureamericanboardboisebureaucapacitycenterconstructiondesignfallshomeidaholaborlawlevelmaterialsnationalpowerresource
SHARED TOKENS (27): "act", "agriculture", "american", "board", "boise", "bureau", "capacity", "center", "construction", "design", "falls", "home", "idaho", "labor", "law", "level", "materials", "national", "power", "resource"....
0.300
activitiesadministersadministrationbuildingdepartmentdepartmentsdirectlyeconomicemploymentfederalgoverninghistorylaboroccupationalsafetystandardsstatisticsthemwageworkers
SHARED TOKENS (20): "activities", "administers", "administration", "building", "department", "departments", "directly", "economic", "employment", "federal", "governing", "history", "labor", "occupational", "safety", "standards", "statistics", "them", "wage", "workers".
0.300
fireprocesspropertystructuralwater
SHARED TOKENS (5): "fire", "process", "property", "structural", "water". | EXACT TITLE in cleaning_services: "Disaster restoration".
0.300
authoritybasebusinesscapitalconsumercustomerdistributedelectricityenergyformgrowthinfrastructurelargelocalmarketsmeansnationaloperatingoperationowner
SHARED TOKENS (32): "authority", "base", "business", "capital", "consumer", "customer", "distributed", "electricity", "energy", "form", "growth", "infrastructure", "large", "local", "markets", "means", "national", "operating", "operation", "owner"....
0.300
commercialconnectconnectedconsumerscustomercustomersdirectlydistributionelectricityequipmentfunctionshouseholdindustriallevellightingpowerresidentialsuppliedsystemurban
SHARED TOKENS (21): "commercial", "connect", "connected", "consumers", "customer", "customers", "directly", "distribution", "electricity", "equipment", "functions", "household", "industrial", "level", "lighting", "power", "residential", "supplied", "system", "urban"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
agriculturearoundcapitalcommercialdependdifferentenergyinstitutionallargepersonnelpolicypressureproviderspublicqualityregulationscaleseparatesmallsupply
SHARED TOKENS (25): "agriculture", "around", "capital", "commercial", "depend", "different", "energy", "institutional", "large", "personnel", "policy", "pressure", "providers", "public", "quality", "regulation", "scale", "separate", "small", "supply"....
0.300
adaamericanarchitectureboisebuildingcapitalconstructiondepartmentdesignexteriorfederalfirmformationhomeidaholistsmaterialsnationalservedterritory
SHARED TOKENS (20): "ada", "american", "architecture", "boise", "building", "capital", "construction", "department", "design", "exterior", "federal", "firm", "formation", "home", "idaho", "lists", "materials", "national", "served", "territory".
0.300
activearoundcapacityconnectioncontrolcustomerdemanddispatchelectricalelectricityenergyevenexampleextendingfacilityformfullgasgenerallyhours
SHARED TOKENS (34): "active", "around", "capacity", "connection", "control", "customer", "demand", "dispatch", "electrical", "electricity", "energy", "even", "example", "extending", "facility", "form", "full", "gas", "generally", "hours"....
🫐 BERRY36 edges
0.280
cleaningextractionprocesswater
SHARED TOKENS (4): "cleaning", "extraction", "process", "water". | EXACT TITLE in cleaning_services: "Carpet cleaning".
0.280
amongcontactcontroldeterminedirectlyevenmeansmedicalpotentiallyratherstandardthoughtypeworkers
SHARED TOKENS (14): "among", "contact", "control", "determine", "directly", "even", "means", "medical", "potentially", "rather", "standard", "though", "type", "workers".
0.280
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsenvironmentenvironmentalgrowthindustrialmainprocessprogramresultresultingsurfacewastewaterwater
SHARED TOKENS (14): "agriculture", "controls", "environment", "environmental", "growth", "industrial", "main", "process", "program", "result", "resulting", "surface", "wastewater", "water".
0.280
cleaningcommercialcompensationequipmentexteriorformalincreasinglylicensinglightingprocessesstructuraltechnologyvarywork
SHARED TOKENS (14): "cleaning", "commercial", "compensation", "equipment", "exterior", "formal", "increasingly", "licensing", "lighting", "processes", "structural", "technology", "vary", "work".
0.280
Power station ↗ Q159719 KW CROSS HIGH
connectedcreatescurrentelectricalelectricityenergyfacilityfieldgasgenerallyindustrialmechanicalpowersolar
SHARED TOKENS (14): "connected", "creates", "current", "electrical", "electricity", "energy", "facility", "field", "gas", "generally", "industrial", "mechanical", "power", "solar".
0.260
actadaagainstbusinesschangescharacteristicsjanuarylawnationalprotectionpublicrequirementsrequires
SHARED TOKENS (13): "act", "ada", "against", "business", "changes", "characteristics", "january", "law", "national", "protection", "public", "requirements", "requires".
0.260
amongchemicalcontactequipmentexposurehazardhazardousmaterialsoccupationalpressureriskseparatelytype
SHARED TOKENS (13): "among", "chemical", "contact", "equipment", "exposure", "hazard", "hazardous", "materials", "occupational", "pressure", "risk", "separately", "type".
0.240
americanconstitutefullhouseholdindustriallegalmerelyownershippersonsubsequentsystemwater
SHARED TOKENS (12): "american", "constitute", "full", "household", "industrial", "legal", "merely", "ownership", "person", "subsequent", "system", "water".
0.240
actappliescreatesemploymentfortyhourslaborlawproductionstandardswagework
SHARED TOKENS (12): "act", "applies", "creates", "employment", "forty", "hours", "labor", "law", "production", "standards", "wage", "work".
0.240
economyelectricalenergymechanicalnetperformancepowerprocessproducestransportationtypework
SHARED TOKENS (12): "economy", "electrical", "energy", "mechanical", "net", "performance", "power", "process", "produces", "transportation", "type", "work".
0.240
authorizationcenterdepartmentenergyhomeintegrationnamenationalresearchsystemstechnologytransportation
SHARED TOKENS (12): "authorization", "center", "department", "energy", "home", "integration", "name", "national", "research", "systems", "technology", "transportation".
0.220
adaboiseidahomainmetropolitanmunicipalnamenearlypopulationseparatestreet
SHARED TOKENS (11): "ada", "boise", "idaho", "main", "metropolitan", "municipal", "name", "nearly", "population", "separate", "street".
0.220
Hoarding ↗ Q1343347 EXACT TITLE
acquisitionact
SHARED TOKENS (2): "acquisition", "act". | EXACT TITLE in cleaning_services: "Hoarding".
0.220
authorityboundariesdistrictsentitylargelocalobtainpowerpublicsetwater
SHARED TOKENS (11): "authority", "boundaries", "districts", "entity", "large", "local", "obtain", "power", "public", "set", "water".
0.220
commarketplaces
SHARED TOKENS (2): "com", "marketplaces". | EXACT TITLE in cleaning_services: "Short-term rental".
0.220
Kitchen hood ↗ Q1164342 KW CROSS HIGH
airappliancecombinationcommercialexteriorfirehomemechanicaloutsidesystemtype
SHARED TOKENS (11): "air", "appliance", "combination", "commercial", "exterior", "fire", "home", "mechanical", "outside", "system", "type".
0.220
Effluent ↗ Q1057706 KW CROSS HIGH
differentdirectlydischargedfacilityindustrialpollutantssurfacetreatedwastewastewaterwaters
SHARED TOKENS (11): "different", "directly", "discharged", "facility", "industrial", "pollutants", "surface", "treated", "waste", "wastewater", "waters".
0.220
boisedistrictsfacilitieshomeidaholandmaintainnationalpercentrecreationwater
SHARED TOKENS (11): "boise", "districts", "facilities", "home", "idaho", "land", "maintain", "national", "percent", "recreation", "water".
0.220
capacitycategoriescustomersdistributionelectricalelectricitypowerstructuresupportutilitywater
SHARED TOKENS (11): "capacity", "categories", "customers", "distribution", "electrical", "electricity", "power", "structure", "support", "utility", "water".
0.200
EXACT TITLE in energy_utilities: "Suez (disambiguation)".
0.200
actdisposalfederalgoverninghazardouslawrecoveryresourcesolidwaste
SHARED TOKENS (10): "act", "disposal", "federal", "governing", "hazardous", "law", "recovery", "resource", "solid", "waste".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahometropolitannamepopulationschoolschoolsshared
SHARED TOKENS (10): "ada", "boise", "canyon", "idaho", "metropolitan", "name", "population", "school", "schools", "shared".
0.200
airelectricalenergyengineeringfacilitylightingmanagementmechanicalprovidertransportation
SHARED TOKENS (10): "air", "electrical", "energy", "engineering", "facility", "lighting", "management", "mechanical", "provider", "transportation".
0.180
Idaho Legislature ↗ KW CROSS HIGH
boisedatadistrictsdividedevenidahopopulationsinglesubsequent
SHARED TOKENS (9): "boise", "data", "districts", "divided", "even", "idaho", "population", "single", "subsequent".
0.180
boisecenterhealthcarehospitalhospitalsidahomedicalregionalsystem
SHARED TOKENS (9): "boise", "center", "healthcare", "hospital", "hospitals", "idaho", "medical", "regional", "system".
0.180
agricultureconstructioncontrolcontrolslandpropertysoilsurfacewater
SHARED TOKENS (9): "agriculture", "construction", "control", "controls", "land", "property", "soil", "surface", "water".
0.160
capitaldistributionelectricaloperatingpowerqualityrisksupply
SHARED TOKENS (8): "capital", "distribution", "electrical", "operating", "power", "quality", "risk", "supply".
0.140
affectchemicalgenerallyhazardmaterialspotentiallyrisk
SHARED TOKENS (7): "affect", "chemical", "generally", "hazard", "materials", "potentially", "risk".
0.140
certificationeducationalperformpersonprofessionalpublictrade
SHARED TOKENS (7): "certification", "educational", "perform", "person", "professional", "public", "trade".
0.140
Mildew ↗ Q1220207 KW CROSS HIGH
airdistinctformgenerallygrowthproducerelated
SHARED TOKENS (7): "air", "distinct", "form", "generally", "growth", "produce", "related".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
formalprocesspublicregulatorysetutility
SHARED TOKENS (6): "formal", "process", "public", "regulatory", "set", "utility".
0.120
categoryestatefoodindustryplanningreal
SHARED TOKENS (6): "category", "estate", "food", "industry", "planning", "real".
0.120
Clothes dryer ↗ Q496334 KW CROSS HIGH
airappliancebecomehouseholdmaintainneed
SHARED TOKENS (6): "air", "appliance", "become", "household", "maintain", "need".
0.100
actlandmethodsitewaste
SHARED TOKENS (5): "act", "land", "method", "site", "waste".
0.100
cleancleaningmainmajorthroughout
SHARED TOKENS (5): "clean", "cleaning", "main", "major", "throughout".
◈ Frequently Asked Questions
Cleaning Services × Energy Utilities — Treasure Valley
HAIKU · HIGH GATE
How do commercial cleaning services in the Boise metropolitan area comply with wastewater discharge standards?
Commercial cleaning operations in Ada County must route wastewater through municipal sewer systems regulated under the Clean Water Act and monitored by the United States Environmental Protection Agency. Energy utilities in the Treasure Valley coordinate with sewage treatment facilities to manage the volume and chemical composition of cleaning wastewater to prevent overload during peak demand periods.
What role do heating, ventilation, and air conditioning systems play in commercial cleaning operations throughout the Treasure Valley?
HVAC systems consume significant energy in commercial cleaning facilities across the Boise metropolitan area, directly impacting monthly utility bills from local energy providers. The Bureau of Labor Statistics tracks energy consumption patterns for cleaning service businesses in Idaho, helping facility managers optimize both operational efficiency and compliance with municipal environmental quality standards.
How does hazardous waste disposal from cleaning services affect public water quality in Ada County?
Cleaning services that handle hazardous waste in the Treasure Valley must follow environmental remediation protocols established by the United States Environmental Protection Agency and the Safe Drinking Water Act. Local energy utilities partner with municipal treatment centers to ensure that stormwater and sanitary sewer systems remain uncontaminated by chemical residues from commercial cleaning operations.
Why do apprenticeship programs at the College of Western Idaho address both cleaning services and energy utilities?
The College of Western Idaho integrates training on environmental quality, water treatment processes, and energy efficiency into apprenticeships serving the Boise metropolitan area's growing workforce. Apprentices learn how cleaning service facilities in the Treasure Valley optimize energy consumption while maintaining compliance with wastewater regulations and local municipal standards.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Cleaning Services × Energy Utilities 28 QID bridges 272 edges 7,181 ext links 2026-07-17 19:56:14 UTC 116a988b44576a95
Cleaning Services corridor ↗ Energy Utilities corridor ↗ Energy Utilities × Cleaning Services ↗ boisestandard.org/standard ↗
Parent Corridors
Cleaning Services × All Other Verticals