—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Arts Culture ↔ relates to ↔ Water Rights

12 Wikipedia bridge articles confirmed in both vertical ledgers. 239 deterministic cross-vertical edges. 6,226 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
239 Cross Edges
6,226 External Sources
269 Wikipedia Articles
21 🌲 Evergreen
174 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Arts Culture
× Water Rights
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
239
External Sources Harvested
6,226
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise, Idaho
score: 1.1500  ·  type: exact_title_cross  ·  16 shared tokens
QID Bridge Titles (12)
Boise, IdahoLand useBoise State UniversityTreasure ValleyNampa, IdahoAda County, IdahoHistory of IdahoEagle, IdahoCaldwell, IdahoCanyon County, IdahoKuna, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadawestnorthwestcapitalestimatedhomecollegewesterncanyonlocallymajorrivertreasurevalleyagriculturalhistorically
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:26:46 UTC
Content Hash
16fe4eab7390e02c
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
Boise, Idaho
Q35775 EXACT TITLE 1.150
QID OVERLAP: Q35775 in arts_culture (tier:evergreen) and water_rights (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "estimated", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "river", "treasure", "valley". | URL->A (2): http://www.balletidaho.org/, http://www.operaidaho.org/. | EXACT TITLE in arts_culture: "Boise, Idaho".
adaannualboisecapitalcountiesestimatedhomeidaholocallymajormanufacturingmetropolitanpopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Land use
Q1165944 EXACT TITLE 1.000
QID OVERLAP: Q1165944 in arts_culture (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (30): "agricultural", "another", "built", "categories", "category", "change", "changes", "conversion", "data", "directly", "dominant", "environment", "environmental", "historically", "impact", "land", "land-use", "major", "management", "permanent".... | EXACT TITLE in arts_culture: "Land use". | EXACT TITLE in water_rights: "Land use".
agriculturalanotherbuiltcategoriescategorychangechangesconversiondatadirectlydominantenvironmentenvironmentalhistoricallyimpactlandland-usemajormanagementpermanentpracticespreviouslyprimaryresourcessignificantsourcesstudyurbanuseswater
of land. It concerns the benefits derived from using the land, and also the land management actions that humans carry out there. The following categories are used for land use: forest land, cropland (agricultural land), grassland, wetlands, settlements and other lands. The way humans use land, and how land use is changing, has many impacts on the environment. Effects of land use choices and changes by humans include, for example, urban sprawl, soil erosion, soil degradation, land degradation and desertification. Land use and land management practices have a major impact on natural resources including water, soil, nutrients, plants and animals. Land use change is "the change from one land-use category to another". Land-use change, together with use of fossil fuels, are the major anthropogenic sources of carbon dioxide, a dominant greenhouse gas. Human activity is the most significant cause of land cover change, and humans are also directly impacted by the environmental consequences of these changes. For example, deforestation (the systematic and permanent conversion of previously forested land for other uses) has historically been a primary facilitator of land use and land cover change. The study of land change relies on the synthesis of a wide range of data and a diverse range of data collection methods.
The IPCC defines the term land use as the "total of arrangements, activities and inputs applied to a parcel of land". The same report groups land use into the following categories: forest land, cropland (agricultural land), grassland, wetlands, settlements and other lands. Another definition is that of the United Nations' Food and Agriculture Organization: "Land use concerns the products and/or benefits obtained from use of the land as well as the land management actions (activities) carried out by humans to produce those products and benefits." As of the early 1990s, about 13% of the Earth was considered arable land, with 26% in pasture, 32% forests and woodland, and 1.5% urban areas. As of 2015, the total arable land is 10.7% of the land surface, with 1.3% being permanent cropland. For example, the US Department of Agriculture has identified six major types of land use in the United States.
Land use change is "the change from one land-use category to another". Land-use change, together with use of fossil fuels, are the major anthropogenic sources of carbon dioxide, a dominant greenhouse gas. Human activity is the most significant cause of land cover change, and humans are also directly impacted by the environmental consequences of these changes. Collective land use and land cover changes have fundamentally altered the functioning of key Earth systems. For instance, human changes to land use and land cover have a profound impact on climate at a local and regional level, which in turn contributes to climate change. Land use by humans has a long history, first emerging more than 10,000 years ago. Human changes to land surfaces have been documented for centuries as having significant impacts on both earth systems and human well-being. Deforestation is an example of large-scale land use change. The deforestation of temperate regions since 1750 has had a major effect on land cover. The reshaping of landscapes to serve human needs, such as the deforestation for farmland, can have long-term effects on earth systems and exacerbate the causes of climate change. Land is the foundation of agriculture, supporting over 95% of food production while providing essential ecosystem services that sustain life on Earth. As a finite resource, it faces pressures from competing demands including urban expansion, biofuel production, and changing consumption patterns driven by rising incomes and shifting diets. Land is the basis of food security, biodiversity conservation, climate regulation and in 2025 the livelihoods of 892 million agricultural workers worldwide. The expansion of agriculture has fundamentally transformed land-use patterns across the planet over the centuries. In the twenty-first century, between 2001 and 2023, global agricultural area decreased by 78 million hectares (Mha) (−2%), with cropland area increasing by 78 Mha and permanent meadows and pastures decreasing by 151 Mha. These changes exhibit significant regional variations. Sub-Saharan Africa witnessed cropland expansion of 69 Mha accompanied by 72 Mha of forest loss, while Latin America saw 25 Mha of cropland growth alongside 85 Mha of net forest area loss. Agricultural expansion remains the primary driver of global deforestation, accounting for nearly 90% of forest loss. In this century, another important aspect to consider is that approximately 3.6 Mha of croplands are abandoned annually, with land degradation likely playing a significant role in these losses. Although the burning of fossil fuels is the primary driver of present-day climate change, prior to the Industrial Revolution, deforestation and irrigation were the largest sources of human-driven greenhouse gas emissions. Even today, 35% of anthropogenic carbon dioxide contributions can be attributed to land use or land cover changes.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in arts_culture (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (22): "among", "boise", "business", "classified", "college", "conference", "degrees", "division", "education", "engineering", "health", "idaho", "independent", "institution", "million", "program", "programs", "public", "reported", "research".... | EXACT TITLE in arts_culture: "Boise State University". | EXACT TITLE in water_rights: "Boise State University".
amongboisebusinessclassifiedcollegeconferencedegreesdivisioneducationengineeringhealthidahoindependentinstitutionmillionprogramprogramspublicreportedresearchuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in arts_culture (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in arts_culture: "Treasure Valley". | EXACT TITLE in water_rights: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitanregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Nampa, Idaho
Q622633 QID OVERLAP 0.950
QID OVERLAP: Q622633 in arts_culture (tier:evergreen) and water_rights (tier:branch). | SHARED TOKENS (16): "boise", "canyon", "college", "foot", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "student", "university", "west", "western". | URL->A (2): https://canyoncountyhistory.com/, https://nampaciviccenter.com/.
boisecanyoncollegefoothomeidahomeridianmetropolitannampanorthwestpopulationprincipalstudentuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in arts_culture (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (15): "ada", "behind", "boise", "capital", "district", "estimated", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private", "streets".
adabehindboisecapitaldistrictestimatedhomeidahojurisdictionlocalmetropolitannorthwestpopulationprivatestreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
H
Q4204547 QID OVERLAP 0.770
QID OVERLAP: Q4204547 in arts_culture (tier:evergreen) and water_rights (tier:branch). | SHARED TOKENS (6): "associated", "history", "idaho", "northwest", "west", "western". | URL->A (1): http://www.ibhm.org/.
associatedhistoryidahonorthwestwestwestern
the human history and social activity within the state of Idaho, one of the United States of America located in the Pacific Northwest area near the west coast of the United States and Canada. Other associated areas include southern Alaska, all of British Columbia, Washington, Oregon, western Montana and northern California and Nevada. Indigenous inhabitants Humans may have been present in Idaho for 16,600 years. Recent findings in Cooper's Ferry along the Salmon River in western Idaho near the town of Cottonwood have unearthed stone tools and animal bone fragments in what may be the oldest evidence of humans in North America. Earlier excavations in 1959 at Wilson Butte Cave near Twin Falls revealed evidence of human activity, including arrowheads, that rank among the oldest dated artifacts in North America.
African-American York, a slave owned by William Clark but considered a full member of Corps of Discovery during expedition to the Pacific, was the first recorded African American in Idaho. There is a significant African American population made up of those who came west after the abolition of slavery. Many settled near Pocatello and were ranchers, entertainers, and farmers. Although free, many blacks suffered discrimination in the early-to-mid-late 20th century. The black population of the state continues to grow as many come to the state because of educational opportunities, to serve in the military, and for other employment opportunities. There is a Black History Museum in Boise, Idaho, with an exhibit known as the "Invisible Idahoan", which chronicles the first African-Americans in the state. Blacks are the fourth largest ethnic group in Idaho according to the 2000 census.
After statehood, Idaho's economy began a gradual shift away from mining toward agriculture, particularly in the south. Older mining communities such as Silver City and Rocky Bar gave way to agricultural communities incorporated after statehood, such as Nampa and Twin Falls. Milner Dam on the Snake River, completed in 1905, allowed for the formation of many agricultural communities in the Magic Valley region which had previously been nearly unpopulated. Meanwhile, some of the mining towns were able to reinvent themselves as resort communities, most notably in Blaine County, where the Sun Valley ski resort opened in 1936. Others, such as Silver City and Rocky Bar, became ghost towns. Modern history In the north, mining continued to be an important industry for several more decades. The closure of the Bunker Hill Mine complex in Shoshone County in the early 1980s sent the region's economy into a tailspin. Since that time, a substantial increase in tourism in north Idaho has helped the region to recover. Coeur d'Alene, a lake-side resort town, is a destination for visitors in the area. Beginning in the 1980s, there was a rise in North Idaho of a few right-wing extremist and "survivalist" political groups, most notably one holding Neo-Nazi views, Aryan Nations. These groups were most heavily concentrated in the Panhandle region of the state, particularly in the vicinity of Coeur d'Alene. In 1992 a stand-off occurred between U.S. Marshals, the F.B.I., and white separatist Randy Weaver and his family at their compound at Ruby Ridge, located near the small, northern Idaho town of Naples. The ensuing fire-fight and deaths of a U.S. Marshal, and Weaver's son and wife gained national attention, and raised a considerable amount of controversy regarding the nature of acceptable force by the federal government in such situations. In 2001, the Aryan Nations compound, which had been located in Hayden Lake, Idaho, was confiscated as a result of a court case, and the organization moved out of state. About the same time Boise installed an impressive stone Human Rights Memorial featuring a bronze statue of Anne Frank and quotations from her and many other writers extolling human freedom and equality. The demographics of the state have changed. Due to this growth in different groups, especially in Boise, the economic expansion surged wrong-economic growth followed the high standard of living and resulted in the "growth of different groups".
Eagle, Idaho
Q1516870 QID OVERLAP 0.750
QID OVERLAP: Q1516870 in arts_culture (tier:evergreen) and water_rights (tier:branch). | SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population". | URL->A (1): http://www.cityofeagle.org/.
adaboiseidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in arts_culture (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in arts_culture (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in arts_culture (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in arts_culture (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
227 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP227 edges
🌲 EVERGREEN9 edges
0.650
annualaroundboisecompleteconductcontemporarydesigndevelopmentenvironmentfrequentlyidaholocalmainperformanceperformingproductionprofessionalwork
SHARED TOKENS (18): "annual", "around", "boise", "complete", "conduct", "contemporary", "design", "development", "environment", "frequently", "idaho", "local", "main", "performance", "performing", "production", "professional", "work". | URL->A (1): http://bctheater.org/. | EXACT TITLE in arts_culture: "Boise Contemporary Theater".
0.650
acquisitionactadministrationagencycategorycouncilcreatedfederalformgovernmenthistoricindependentinstitutelibrarymajornationalpreservationprogramsprojectsproposed
SHARED TOKENS (22): "acquisition", "act", "administration", "agency", "category", "council", "created", "federal", "form", "government", "historic", "independent", "institute", "library", "major", "national", "preservation", "programs", "projects", "proposed".... | URL->A (1): https://www.arts.gov/. | EXACT TITLE in arts_culture: "National Endowment for the Arts".
0.650
accessblackboisebridgecapitalconnectscontainscreateddepartmenthistoricalhistoryidaholandmunicipaloperatedparksrecreationregionriversouth
SHARED TOKENS (24): "access", "black", "boise", "bridge", "capital", "connects", "contains", "created", "department", "historical", "history", "idaho", "land", "municipal", "operated", "parks", "recreation", "region", "river", "south".... | URL->A (3): http://www.ibhm.org/, https://www.cityofboise.org/departments/parks-and-recreation/parks/julia-davis-park/. | EXACT TITLE in arts_culture: "Julia Davis Park".
0.650
accessagencyestablishedhistorichistoricalidahoofficeofficialplacespreservationpreservesprogrampublicrecordsresponsiblesitesstaff
SHARED TOKENS (17): "access", "agency", "established", "historic", "historical", "idaho", "office", "official", "places", "preservation", "preserves", "program", "public", "records", "responsible", "sites", "staff". | URL->A (1): http://www.history.idaho.gov/. | EXACT TITLE in arts_culture: "Idaho State Historical Society".
0.650
adaboisebuiltbureauconstructioncontroldirectlyearlyengineersfederalidaholakeoperatingoperationalpowerprimaryprivateriverwestern
SHARED TOKENS (19): "ada", "boise", "built", "bureau", "construction", "control", "directly", "early", "engineers", "federal", "idaho", "lake", "operating", "operational", "power", "primary", "private", "river", "western". | URL->B (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
0.650
adaboisecanyoncollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicreportedresidents
SHARED TOKENS (28): "ada", "boise", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "reported", "residents".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in arts_culture: "College of Western Idaho". | EXACT TITLE in water_rights: "College of Western Idaho".
0.650
bodybuildingcatalogdocumentsgeneralgovernmentinformationlibraryofficeonlineopenownershippublicrecordsregisterresearchersroleservingtitleworks
SHARED TOKENS (20): "body", "building", "catalog", "documents", "general", "government", "information", "library", "office", "online", "open", "ownership", "public", "records", "register", "researchers", "role", "serving", "title", "works". | URL->A (1): https://www.copyright.gov/. | EXACT TITLE in arts_culture: "United States Copyright Office".
0.630
administrationcaldwellcollegedegreeseducationfieldsidahomajorpreviouslyprivateprofessionalprogramssciencestudies
SHARED TOKENS (14): "administration", "caldwell", "college", "degrees", "education", "fields", "idaho", "major", "previously", "private", "professional", "programs", "science", "studies". | URL->A (1): http://www.caldwellfinearts.org/. | EXACT TITLE in arts_culture: "College of Idaho".
0.630
communitycreationdesignidentitymanagementnonprofitphysicalplaceplanningprojectpublicspaceurbanwork
SHARED TOKENS (14): "community", "creation", "design", "identity", "management", "nonprofit", "physical", "place", "planning", "project", "public", "space", "urban", "work". | URL->A (1): https://www.arts.gov/impact/creative-placemaking. | EXACT TITLE in arts_culture: "Placemaking".
🌿 BRANCH174 edges
0.570
annualboisebuiltidaholocalorganizedperformanceplaceregionalserveswest
SHARED TOKENS (11): "annual", "boise", "built", "idaho", "local", "organized", "performance", "place", "regional", "serves", "west". | URL->A (1): http://treefortmusicfest.com/. | EXACT TITLE in arts_culture: "Treefort Music Fest".
0.500
accessadministrativeaffordablecommercialcontainsdevelopmentdistrictdistrictsevenhistorichistoricalhomeincreaselargerlegalolderownerspropertiesprotectionreceive
SHARED TOKENS (28): "access", "administrative", "affordable", "commercial", "contains", "development", "district", "districts", "even", "historic", "historical", "home", "increase", "larger", "legal", "older", "owners", "properties", "protection", "receive".... | EXACT TITLE in arts_culture: "Historic district".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalapproximatelyaroundassociatedboisecapitalcontainsdistinctearlyeconomygeographicidahoisolatedlandmanufacturingmillionnationalnorthwestofficialorganized
SHARED TOKENS (33): "agricultural", "approximately", "around", "associated", "boise", "capital", "contains", "distinct", "early", "economy", "geographic", "idaho", "isolated", "land", "manufacturing", "million", "national", "northwest", "official", "organized".... | EXACT TITLE in arts_culture: "Idaho". | EXACT TITLE in water_rights: "Idaho".
0.500
anotherbodycommonlyengineeringenvironmentallakelandpermanentplacespointratherriversciencesinglesystemwater
SHARED TOKENS (16): "another", "body", "commonly", "engineering", "environmental", "lake", "land", "permanent", "places", "point", "rather", "river", "science", "single", "system", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.500
analysisanotherapplicationsbodybroaderbusinesscoordinatesdatadatabasedateengineeringgeographicindexinformationinstitutionalintegratedmanagemanagementopenoperations
SHARED TOKENS (34): "analysis", "another", "applications", "body", "broader", "business", "coordinates", "data", "database", "date", "engineering", "geographic", "index", "information", "institutional", "integrated", "manage", "management", "open", "operations".... | EXACT TITLE in arts_culture: "Geographic information system".
0.500
actamongassociationauthoritybureauconstructioncontractscreateddepartmentestablishedextendfarmersfederallandlaterlawmaintenancemajormeridiannational
SHARED TOKENS (32): "act", "among", "association", "authority", "bureau", "construction", "contracts", "created", "department", "established", "extend", "farmers", "federal", "land", "later", "law", "maintenance", "major", "meridian", "national".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
academicsactadministeredagencyapplicationbecomebuildingdepartmentdistrictdistrictsestablishedfederalgeneralgovernmenthistorichistoricalhistoryidentifyindividuallist
SHARED TOKENS (43): "academics", "act", "administered", "agency", "application", "become", "building", "department", "district", "districts", "established", "federal", "general", "government", "historic", "historical", "history", "identify", "individual", "list".... | EXACT TITLE in arts_culture: "National Register of Historic Places".
0.500
Public art ↗ Q557141 EXACT TITLE
accessiblecommercialcreatedcreationdirectformfunctiongeneralindependentmaintenancemediaofficialoutsideprivateprocessprocurementprofessionalpropertypublicrather
SHARED TOKENS (24): "accessible", "commercial", "created", "creation", "direct", "form", "function", "general", "independent", "maintenance", "media", "official", "outside", "private", "process", "procurement", "professional", "property", "public", "rather".... | EXACT TITLE in arts_culture: "Public art".
0.500
amongbuildingcommercialconnectionsdistincteconomiceducationevidencefunctionshistorichistoricallyinstitutionsmaintainmarketingmodernnetworknonprofitobjectsoperatedorganizations
SHARED TOKENS (30): "among", "building", "commercial", "connections", "distinct", "economic", "education", "evidence", "functions", "historic", "historically", "institutions", "maintain", "marketing", "modern", "network", "nonprofit", "objects", "operated", "organizations".... | EXACT TITLE in arts_culture: "Art gallery".
0.500
actagencybecomebuiltbureaudepartmentdevelopmentestablishedfarmersfederalgovernmentlawmanagementmillionoperationpowerprogramprojectsprovidingprovisions
SHARED TOKENS (28): "act", "agency", "become", "built", "bureau", "department", "development", "established", "farmers", "federal", "government", "law", "management", "million", "operation", "power", "program", "projects", "providing", "provisions".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
cannotdatadifferentformfuturegeneralhistoricalhistoryinformationlargeprimaryprofessionalrecordsourcesstudywhosework
SHARED TOKENS (17): "cannot", "data", "different", "form", "future", "general", "historical", "history", "information", "large", "primary", "professional", "record", "sources", "study", "whose", "work". | EXACT TITLE in arts_culture: "Oral history".
0.500
Nitrate ↗ Q49916468 EXACT TITLE
agriculturalapplicationsassociatedcomponentscreationdirectenvironmentfocusedhealthhistoricallymanufacturingmeansmillionmodernpreservationprocessesproducedproductionsignificantsources
SHARED TOKENS (21): "agricultural", "applications", "associated", "components", "creation", "direct", "environment", "focused", "health", "historically", "manufacturing", "means", "million", "modern", "preservation", "processes", "produced", "production", "significant", "sources".... | EXACT TITLE in water_rights: "Nitrate".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundbuildingbuiltclassifiedconstructioncreationdesignearlyengineeringfunctionsgoverninghealthincreaseindustriallandlargelongerloss
SHARED TOKENS (42): "additional", "application", "around", "building", "built", "classified", "construction", "creation", "design", "early", "engineering", "functions", "governing", "health", "increase", "industrial", "land", "large", "longer", "loss".... | EXACT TITLE in water_rights: "Dam".
0.500
Opera ↗ Q1344 EXACT TITLE
anotherbeyondcentralcompletecontemporarycontinuedcontinuouscreatingdistinctearlyestablishformmajormediamodernnationalperformanceperformingpointproduced
SHARED TOKENS (26): "another", "beyond", "central", "complete", "contemporary", "continued", "continuous", "creating", "distinct", "early", "establish", "form", "major", "media", "modern", "national", "performance", "performing", "point", "produced".... | EXACT TITLE in arts_culture: "Opera". | EXACT TITLE in water_rights: "Opera".
0.500
datedevelopmentdifferentearlyformformatsfunctionshistoryincreasinglyinvolvingobjectsopenperformanceperformingphysicalplaceprivatestreettimeswestern
SHARED TOKENS (20): "date", "development", "different", "early", "form", "formats", "functions", "history", "increasingly", "involving", "objects", "open", "performance", "performing", "physical", "place", "private", "street", "times", "western". | EXACT TITLE in arts_culture: "Performing arts".
0.500
agriculturalanotherbodycycledomesticenvironmentfacilityimpactindustrialmainmunicipalprocessprocessesresultingreusetreatmentuseswastewastewaterwater
SHARED TOKENS (20): "agricultural", "another", "body", "cycle", "domestic", "environment", "facility", "impact", "industrial", "main", "municipal", "process", "processes", "resulting", "reuse", "treatment", "uses", "waste", "wastewater", "water". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
Orchestra ↗ Q42998 EXACT TITLE
alonearoundcommonlycommunitydifferentearlylargelatermainmodernperformanceperformingpublicregionrolesectionuniversitywesternworkworks
SHARED TOKENS (20): "alone", "around", "commonly", "community", "different", "early", "large", "later", "main", "modern", "performance", "performing", "public", "region", "role", "section", "university", "western", "work", "works". | EXACT TITLE in arts_culture: "Orchestra".
0.500
associationbringconferenceconnectionscorporatedevelopmentdirectorshistorichistoryindividualinstituteinstitutionslibraryneedofficersprofessionalspublicrepresentsresourcesscience
SHARED TOKENS (24): "association", "bring", "conference", "connections", "corporate", "development", "directors", "historic", "history", "individual", "institute", "institutions", "library", "need", "officers", "professionals", "public", "represents", "resources", "science".... | EXACT TITLE in arts_culture: "American Alliance of Museums".
0.500
Theatre ↗ Q11635 EXACT TITLE
definesdevelopmentdistinctexperienceformgeneralgrouplargemeasuremodernperformingplaceplacesproducesrealspecifictechnicaluseswesternworking
SHARED TOKENS (20): "defines", "development", "distinct", "experience", "form", "general", "group", "large", "measure", "modern", "performing", "place", "places", "produces", "real", "specific", "technical", "uses", "western", "working". | EXACT TITLE in arts_culture: "Theatre".
0.500
accessaccessibleamongdistinctearlyformationgeneralinformationinstitutionlibrarymaterialsopenoperatedoutsidepopulationprofessionalsprovidepublicratherresearch
SHARED TOKENS (23): "access", "accessible", "among", "distinct", "early", "formation", "general", "information", "institution", "library", "materials", "open", "operated", "outside", "population", "professionals", "provide", "public", "rather", "research".... | EXACT TITLE in arts_culture: "Public library".
0.500
Water treatment ↗ EXACT TITLE
advancedcomponentsenvironmentenvironmentalhealthindustrialmaintenancematerialsprocessprocessesqualityrecreationresourceriverspecificsupplysystemstreatmentuseswater
SHARED TOKENS (20): "advanced", "components", "environment", "environmental", "health", "industrial", "maintenance", "materials", "process", "processes", "quality", "recreation", "resource", "river", "specific", "supply", "systems", "treatment", "uses", "water". | EXACT TITLE in water_rights: "Water treatment".
0.500
actagenciesamongcreatedfederalhistoricimpactlawlistnationalpdfpermittedplacespreservationpreserveprocessprojectspropertiesprovisionsregister
SHARED TOKENS (25): "act", "agencies", "among", "created", "federal", "historic", "impact", "law", "list", "national", "pdf", "permitted", "places", "preservation", "preserve", "process", "projects", "properties", "provisions", "register".... | EXACT TITLE in arts_culture: "National Historic Preservation Act".
0.500
administrationadministrativeassociationboisebuildingcontemporarydevelopmenteducationalexpandedfederalfunctionshomeidahoinstallationslargerlocalmajormodernpartnershippermanent
SHARED TOKENS (26): "administration", "administrative", "association", "boise", "building", "contemporary", "development", "educational", "expanded", "federal", "functions", "home", "idaho", "installations", "larger", "local", "major", "modern", "partnership", "permanent".... | EXACT TITLE in arts_culture: "Boise Art Museum".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscommunicationscomponentsconstructiondevelopmentdigitalengineeringenvironmentequipmentestablishgovernmenthistorylandlawlegalmapsownershipplanningprofessionalproperty
SHARED TOKENS (26): "analysis", "communications", "components", "construction", "development", "digital", "engineering", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "professional", "property".... | EXACT TITLE in water_rights: "Surveying".
0.500
Humanities ↗ Q80083 EXACT TITLE
analysisclassifiedcommonlycoursefieldsfrequentlygeneralhistoricalhistoricallyhistoryindividualobjectivesoutsideperformingpracticalprofessionalpublicrelatedresponsibilityscience
SHARED TOKENS (23): "analysis", "classified", "commonly", "course", "fields", "frequently", "general", "historical", "historically", "history", "individual", "objectives", "outside", "performing", "practical", "professional", "public", "related", "responsibility", "science".... | EXACT TITLE in arts_culture: "Humanities".
0.500
Archaeology ↗ Q23498 EXACT TITLE
analysisaroundbecomebehindchangesclassifiedcreatedatadevelopmentdifferentdistinctdocumentingearlyexplaininghistoryindependentmaterialsmeansmillionpublic
SHARED TOKENS (30): "analysis", "around", "become", "behind", "changes", "classified", "create", "data", "development", "different", "distinct", "documenting", "early", "explaining", "history", "independent", "materials", "means", "million", "public".... | EXACT TITLE in arts_culture: "Archaeology".
0.500
actaddressingadministeredagencychangesconservationcontrolcoordinationdirectlyengineersenvironmentalfederalformgoverninginvolvinglawmaintainmajormodernphysical
SHARED TOKENS (32): "act", "addressing", "administered", "agency", "changes", "conservation", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "maintain", "major", "modern", "physical".... | EXACT TITLE in water_rights: "Clean Water Act".
0.500
Museum ↗ Q33506 EXACT TITLE
associatedhistoryinstitutionitemslargelaterlocalobjectsoutsidepreservationpreservingprivatepublicresearcherssciencesignificantspecialiststimesuntil
SHARED TOKENS (19): "associated", "history", "institution", "items", "large", "later", "local", "objects", "outside", "preservation", "preserving", "private", "public", "researchers", "science", "significant", "specialists", "times", "until". | EXACT TITLE in arts_culture: "Museum".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddirectlydistributesdistributionenvironmentalfieldsformgrowthinstallationlandlandscapemaintain
SHARED TOKENS (46): "agricultural", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "directly", "distributes", "distribution", "environmental", "fields", "form", "growth", "installation", "land", "landscape", "maintain".... | EXACT TITLE in water_rights: "Irrigation".
0.500
actapproximatelybehindboisebureaucapacityconstructiondesignexperiencedhomeidaholaborlawmaterialsnationaloperatedpowerprimaryprojectsprovide
SHARED TOKENS (32): "act", "approximately", "behind", "boise", "bureau", "capacity", "construction", "design", "experienced", "home", "idaho", "labor", "law", "materials", "national", "operated", "power", "primary", "projects", "provide".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
amongapproximatelyboiseclassifiedconferencedivisionestablishedidaholatermainoperatesproductionprofessionalpublicresearchschoolsstatewideuniversityuntil
SHARED TOKENS (19): "among", "approximately", "boise", "classified", "conference", "division", "established", "idaho", "later", "main", "operates", "production", "professional", "public", "research", "schools", "statewide", "university", "until". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherconstructedconstructioncontainscreatecreateddatedevelopingenvironmentalhistoricallylakemodernpointproviderequireresourcessitesourcesstructure
SHARED TOKENS (25): "access", "another", "constructed", "construction", "contains", "create", "created", "date", "developing", "environmental", "historically", "lake", "modern", "point", "provide", "require", "resources", "site", "sources", "structure".... | EXACT TITLE in arts_culture: "Well". | EXACT TITLE in water_rights: "Well".
0.500
climatecontainscontinuedformindustriallandlargemajorpermanentproducedrecreationresultsurroundingtimestreatmentuseswastewaterwater
SHARED TOKENS (18): "climate", "contains", "continued", "form", "industrial", "land", "large", "major", "permanent", "produced", "recreation", "result", "surrounding", "times", "treatment", "uses", "wastewater", "water". | EXACT TITLE in water_rights: "Surface water".
0.500
billionclimateconditionsdependsdevelopingdirectlyenvironmentalfoodformhealthmaintainmajorphysicalsuppliedwaterwork
SHARED TOKENS (16): "billion", "climate", "conditions", "depends", "developing", "directly", "environmental", "food", "form", "health", "maintain", "major", "physical", "supplied", "water", "work". | EXACT TITLE in water_rights: "Drinking water".
0.500
additionalagriculturalapplicationsbuiltcapacityconditionscontinuedcostcostsdepartmentdistrictestimatedformationindustrialoccurspowerprocessesreduceresourcesspace
SHARED TOKENS (23): "additional", "agricultural", "applications", "built", "capacity", "conditions", "continued", "cost", "costs", "department", "district", "estimated", "formation", "industrial", "occurs", "power", "processes", "reduce", "resources", "space".... | EXACT TITLE in water_rights: "Geothermal energy".
0.500
anothercommonlyconnectedconservationconstructeddesigndesigneddevelopingdistributionengineeringgoverninginteractionlocalmainplacesqualitystudysuppliessystemsystems
SHARED TOKENS (21): "another", "commonly", "connected", "conservation", "constructed", "design", "designed", "developing", "distribution", "engineering", "governing", "interaction", "local", "main", "places", "quality", "study", "supplies", "system", "systems".... | EXACT TITLE in water_rights: "Hydrogeology".
0.500
amongassociationconservationcurrentdescriptioneducationalestablishedindividualinstitutionalinstitutionsmaterialsmembershiponlinepreservationprofessionalprogramsrealservesservingsupports
SHARED TOKENS (20): "among", "association", "conservation", "current", "description", "educational", "established", "individual", "institutional", "institutions", "materials", "membership", "online", "preservation", "professional", "programs", "real", "serves", "serving", "supports". | EXACT TITLE in arts_culture: "Society of American Archivists".
0.500
Wheat ↗ Q15645384 EXACT TITLE
arounddemandfoodgeneralgrouplandlargermajormakingmillionpopulationproductionqualityrecordrelativelysupplying
SHARED TOKENS (16): "around", "demand", "food", "general", "group", "land", "larger", "major", "making", "million", "population", "production", "quality", "record", "relatively", "supplying". | EXACT TITLE in water_rights: "Wheat".
0.500
Library ↗ Q7075 EXACT TITLE
accessaccessibleapplicablebeyondbodybuildingcommercialcommunitycreationdatabasesdifferentdigitalextendfacilitiesformatsgeneralgovernmentgrouphomeindividual
SHARED TOKENS (44): "access", "accessible", "applicable", "beyond", "body", "building", "commercial", "community", "creation", "databases", "different", "digital", "extend", "facilities", "formats", "general", "government", "group", "home", "individual".... | EXACT TITLE in arts_culture: "Library". | EXACT TITLE in water_rights: "Library".
0.500
Archive ↗ Q166118 EXACT TITLE
accessactadministrativearchivecommercialcoursecreateddistinctdocumentsfacilityfunctionfunctionsgenerallyhistoricalhistoryindividualinformationlegallibrarylong-term
SHARED TOKENS (39): "access", "act", "administrative", "archive", "commercial", "course", "created", "distinct", "documents", "facility", "function", "functions", "generally", "historical", "history", "individual", "information", "legal", "library", "long-term".... | EXACT TITLE in arts_culture: "Archive". | EXACT TITLE in water_rights: "Archive".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalbecomebillioncapacitycentralchangeclimatecommonlyconstructingcontainscycledistributionenvironmentalformformationindustriallandlossmajormunicipal
SHARED TOKENS (40): "agricultural", "become", "billion", "capacity", "central", "change", "climate", "commonly", "constructing", "contains", "cycle", "distribution", "environmental", "form", "formation", "industrial", "land", "loss", "major", "municipal".... | EXACT TITLE in water_rights: "Groundwater".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdeterminedevelopmentdifferentexceptionsformgoverngovernmentgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulationsregulatory
SHARED TOKENS (28): "allowing", "building", "determine", "development", "different", "exceptions", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "property", "regulations", "regulatory".... | EXACT TITLE in arts_culture: "Zoning". | EXACT TITLE in water_rights: "Zoning".
0.500
actagenciesapplyboundarycontroldepartmentdiscoveryestablishfederalimplementationincreaseinstitutioninstitutionsitemslawmajormakesobjectsorganizationsprivate
SHARED TOKENS (30): "act", "agencies", "apply", "boundary", "control", "department", "discovery", "establish", "federal", "implementation", "increase", "institution", "institutions", "items", "law", "major", "makes", "objects", "organizations", "private".... | EXACT TITLE in arts_culture: "Native American Graves Protection and Repatriation Act".
0.500
accurateagenciesagencyanalysisannualapproximatelybudgetbureaucorporatedatadepartmentdomesticeconomiceconomyfederalgovernmentinformationmillionnationalofficial
SHARED TOKENS (24): "accurate", "agencies", "agency", "analysis", "annual", "approximately", "budget", "bureau", "corporate", "data", "department", "domestic", "economic", "economy", "federal", "government", "information", "million", "national", "official".... | EXACT TITLE in arts_culture: "Bureau of Economic Analysis".
0.500
Tourism ↗ Q49389 EXACT TITLE
beyondbillionbusinesscommercialdefinesdevelopmentdomesticeconomicenvironmentenvironmentalestimatedgenerallygrowthincreaselocallossmarketsorganizationsoutsideplaces
SHARED TOKENS (30): "beyond", "billion", "business", "commercial", "defines", "development", "domestic", "economic", "environment", "environmental", "estimated", "generally", "growth", "increase", "local", "loss", "markets", "organizations", "outside", "places".... | EXACT TITLE in arts_culture: "Tourism".
0.500
Drought ↗ Q43059 EXACT TITLE
affectingannualbecomechangeclimateconditionscostsdatedevelopingdirectlyeconomiceconomyenvironmentalexperienceexperiencedfoodfuturehealthhistoryimpact
SHARED TOKENS (37): "affecting", "annual", "become", "change", "climate", "conditions", "costs", "date", "developing", "directly", "economic", "economy", "environmental", "experience", "experienced", "food", "future", "health", "history", "impact".... | EXACT TITLE in water_rights: "Drought".
0.500
addressingbusinessesconstructioneconomicfollowedgovernmentgrowthinfrastructurelandprivateprocessprojectspublicrenewalurban
SHARED TOKENS (15): "addressing", "businesses", "construction", "economic", "followed", "government", "growth", "infrastructure", "land", "private", "process", "projects", "public", "renewal", "urban". | EXACT TITLE in arts_culture: "Urban renewal".
0.500
activebusinessescapitalcommercialcommunityconnectiondevelopmentenvironmentfacilitiesidentifyinstitutionslargemembershipoutsideperformancepermanentphysicalplacesprocessproduction
SHARED TOKENS (27): "active", "businesses", "capital", "commercial", "community", "connection", "development", "environment", "facilities", "identify", "institutions", "large", "membership", "outside", "performance", "permanent", "physical", "places", "process", "production".... | EXACT TITLE in arts_culture: "Community theatre".
0.500
adaboisebuiltbureaucanyoncountiesengineersidahooperatedprimaryrivertreasurevalleywaterwestern
SHARED TOKENS (15): "ada", "boise", "built", "bureau", "canyon", "counties", "engineers", "idaho", "operated", "primary", "river", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.500
Municipality ↗ Q15284 EXACT TITLE
administrativebodycorporatedistrictdivisionearlygoverninggovernmentjurisdictionlocalmunicipalitiesnationalpermittingplaceplacesregionalretainsinglestatussupplied
SHARED TOKENS (21): "administrative", "body", "corporate", "district", "division", "early", "governing", "government", "jurisdiction", "local", "municipalities", "national", "permitting", "place", "places", "regional", "retain", "single", "status", "supplied".... | EXACT TITLE in water_rights: "Municipality".
0.500
administrativeapproximatelybecomebillionchangeclassifiedcreatecreatescurrentdescribesdevelopingdevelopmenteconomiceducationenvironmentalfollowedgrowthhealthhistoricimpact
SHARED TOKENS (48): "administrative", "approximately", "become", "billion", "change", "classified", "create", "creates", "current", "describes", "developing", "development", "economic", "education", "environmental", "followed", "growth", "health", "historic", "impact".... | EXACT TITLE in water_rights: "Urbanization".
0.500
communitydescribesdevelopmenteconomicfocusedfrequentlygrowthhistoricallyincreasinglyindividualinfrastructurelocallongermarketobjectivespoliciespolicyprocessqualityregion
SHARED TOKENS (21): "community", "describes", "development", "economic", "focused", "frequently", "growth", "historically", "increasingly", "individual", "infrastructure", "local", "longer", "market", "objectives", "policies", "policy", "process", "quality", "region".... | EXACT TITLE in arts_culture: "Economic development".
0.500
actagenciescannotconferencecontactcreatecreatedfederalfunctiongovernmenthistorichistoricalimpactlawlocalnationalofficeofficersorganizationsplaces
SHARED TOKENS (33): "act", "agencies", "cannot", "conference", "contact", "create", "created", "federal", "function", "government", "historic", "historical", "impact", "law", "local", "national", "office", "officers", "organizations", "places".... | EXACT TITLE in arts_culture: "State Historic Preservation Office".
0.500
Hydrology ↗ Q42250 EXACT TITLE
cycledatadistributionengineeringenvironmentalfieldsmanagementphysicalplanningpolicypractitionerpreservationqualityrelatedresearchresourcessciencestudywater
SHARED TOKENS (19): "cycle", "data", "distribution", "engineering", "environmental", "fields", "management", "physical", "planning", "policy", "practitioner", "preservation", "quality", "related", "research", "resources", "science", "study", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
agenciesagencybudgetbureaubusinessesconditionscoordinationcurrentdatadepartmenteconomicfederalgovernmentlaborlocalmaintainmajormanagementneedoffice
SHARED TOKENS (29): "agencies", "agency", "budget", "bureau", "businesses", "conditions", "coordination", "current", "data", "department", "economic", "federal", "government", "labor", "local", "maintain", "major", "management", "need", "office".... | EXACT TITLE in arts_culture: "Bureau of Labor Statistics".
0.500
becomedependdesigndevelopmentdifferenteconomiceconomyeducationfocusedincreasinglyinformationperformingprivateprotectionpublicregisterresourcesectortherefore
SHARED TOKENS (19): "become", "depend", "design", "development", "different", "economic", "economy", "education", "focused", "increasingly", "information", "performing", "private", "protection", "public", "register", "resource", "sector", "therefore". | EXACT TITLE in arts_culture: "Creative industries".
0.500
agriculturalchangesdifferentenvironmentalfoodformhomeimpactindustrialmakingphysicalpreservationprimaryreducingresultswaste
SHARED TOKENS (16): "agricultural", "changes", "different", "environmental", "food", "form", "home", "impact", "industrial", "making", "physical", "preservation", "primary", "reducing", "results", "waste". | EXACT TITLE in water_rights: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestategeneralgovernmentlandlawlegalmeansnonprofitownershipprivatepropertypublicrealresidentialresources
SHARED TOKENS (24): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "government", "land", "law", "legal", "means", "nonprofit", "ownership", "private", "property", "public", "real", "residential", "resources".... | EXACT TITLE in arts_culture: "Real estate". | EXACT TITLE in water_rights: "Real estate".
0.500
blackcollegedegreesdesigndesignedformmediametropolitanperformancepermanentpublicresearchsystemworkworks
SHARED TOKENS (15): "black", "college", "degrees", "design", "designed", "form", "media", "metropolitan", "performance", "permanent", "public", "research", "system", "work", "works". | EXACT TITLE in arts_culture: "Faith Ringgold".
0.500
Telemetry ↗ Q209867 EXACT TITLE
commonlycommunicationscontrolcostdatadigitalequipmentmeasuremechanismsmediamodernneednetworkoperatephysicalpowerreceiverequiresystemstransfer
SHARED TOKENS (20): "commonly", "communications", "control", "cost", "data", "digital", "equipment", "measure", "mechanisms", "media", "modern", "need", "network", "operate", "physical", "power", "receive", "require", "systems", "transfer". | EXACT TITLE in water_rights: "Telemetry".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciescanyoncentralcommercialconstructedconstructioncontrolcreatedfollowedhabitathistoryidaholakelargemajornationalnorthwestpolicyprivateprograms
SHARED TOKENS (34): "agencies", "canyon", "central", "commercial", "constructed", "construction", "control", "created", "followed", "habitat", "history", "idaho", "lake", "large", "major", "national", "northwest", "policy", "private", "programs".... | EXACT TITLE in water_rights: "Snake River".
0.500
categorycommercialdatedomesticestablishedmajoronlineorganizedproductionregionreleaseshowsinglespecificsubject
SHARED TOKENS (15): "category", "commercial", "date", "domestic", "established", "major", "online", "organized", "production", "region", "release", "show", "single", "specific", "subject". | EXACT TITLE in arts_culture: "Film festival".
0.500
Festival ↗ Q132241 EXACT TITLE
amongassociatedcommunityconnectioncreatingexperiencefoodintegratedlocalmeansnationalplacepracticeprovideresourcesignificantspecific
SHARED TOKENS (17): "among", "associated", "community", "connection", "creating", "experience", "food", "integrated", "local", "means", "national", "place", "practice", "provide", "resource", "significant", "specific". | EXACT TITLE in arts_culture: "Festival".
0.500
adaboisecommercialdepartmentfacilityfirefunctionsgeneralidahoincreasemillionnationaloperatedoperatesprotectionreceiverequiringrightsroughlysouth
SHARED TOKENS (24): "ada", "boise", "commercial", "department", "facility", "fire", "functions", "general", "idaho", "increase", "million", "national", "operated", "operates", "protection", "receive", "requiring", "rights", "roughly", "south".... | EXACT TITLE in arts_culture: "Boise Airport".
0.500
actagencycoveringcreateddepartmentdistrictfederalhistoricalmainmakingmanagementmillionnationalparksplacespreservingpropertiespublicrecreationalthem
SHARED TOKENS (21): "act", "agency", "covering", "created", "department", "district", "federal", "historical", "main", "making", "management", "million", "national", "parks", "places", "preserving", "properties", "public", "recreational", "them".... | EXACT TITLE in arts_culture: "National Park Service".
0.500
agencybecomechangecommunitycreatingdesigndevelopmentenvironmentalfieldshistoricalhistoryidentityintersectsissuelocalmakingplaceplacesplanningpower
SHARED TOKENS (23): "agency", "become", "change", "community", "creating", "design", "development", "environmental", "fields", "historical", "history", "identity", "intersects", "issue", "local", "making", "place", "places", "planning", "power".... | EXACT TITLE in arts_culture: "Place identity".
0.500
associationcontractorscontrolenvironmentequipmentevaluationmanagemodernobjectivesprocessproducedproducingprotectregulatedresourcesearchsourceswater
SHARED TOKENS (18): "association", "contractors", "control", "environment", "equipment", "evaluation", "manage", "modern", "objectives", "process", "produced", "producing", "protect", "regulated", "resource", "search", "sources", "water". | EXACT TITLE in water_rights: "Well drilling".
0.500
associationsbusinesscommunityconstraintentitiesentityexemptioninstitutionlocalnonprofitoperatedoperatesoperationsorganizationsownersprivateprogrampublicratherreceive
SHARED TOKENS (24): "associations", "business", "community", "constraint", "entities", "entity", "exemption", "institution", "local", "nonprofit", "operated", "operates", "operations", "organizations", "owners", "private", "program", "public", "rather", "receive".... | EXACT TITLE in arts_culture: "Nonprofit organization".
0.500
administrationbudgetcommunitydevelopmententitiesevaluationlong-termmanagemanagementmarketingoperationsorganizationsplanplanningprofessionalprogrampublicsectorstaff
SHARED TOKENS (19): "administration", "budget", "community", "development", "entities", "evaluation", "long-term", "manage", "management", "marketing", "operations", "organizations", "plan", "planning", "professional", "program", "public", "sector", "staff". | EXACT TITLE in arts_culture: "Arts administration".
0.500
accessibleadvancedaffectbecomedesignearlyentryexperiencefeesgeneralgenerallygovernmentlandscapelargerlegalopenownersownershippaidparks
SHARED TOKENS (34): "accessible", "advanced", "affect", "become", "design", "early", "entry", "experience", "fees", "general", "generally", "government", "landscape", "larger", "legal", "open", "owners", "ownership", "paid", "parks".... | EXACT TITLE in arts_culture: "Public space".
0.500
communitycomprehensivecurrentdevelopmentdocumentearlyestablishinggeneralgrowthindividuallandlargelong-termplanplanningpoliciespolicyprocessprovidepublic
SHARED TOKENS (28): "community", "comprehensive", "current", "development", "document", "early", "establishing", "general", "growth", "individual", "land", "large", "long-term", "plan", "planning", "policies", "policy", "process", "provide", "public".... | EXACT TITLE in arts_culture: "Comprehensive planning". | EXACT TITLE in water_rights: "Comprehensive planning".
0.500
aroundcapitalcommercialcommunitycostcostsdependdifferentinstitutionallargelargerpersonnelpolicypracticeproviderspublicqualityregulationresponsibilityseparate
SHARED TOKENS (28): "around", "capital", "commercial", "community", "cost", "costs", "depend", "different", "institutional", "large", "larger", "personnel", "policy", "practice", "providers", "public", "quality", "regulation", "responsibility", "separate".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectsagencyapplicationsclassifieddetermineenvironmentalformgrouphealthiiilargerlistoccursprimaryproductionpropertiesproposedprotectionresearchrole
SHARED TOKENS (23): "affects", "agency", "applications", "classified", "determine", "environmental", "form", "group", "health", "iii", "larger", "list", "occurs", "primary", "production", "properties", "proposed", "protection", "research", "role".... | EXACT TITLE in water_rights: "Arsenic".
0.480
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddirectlylandlargemajorpopulationreducerelatedresourcetreatmenturbanwater
SHARED TOKENS (14): "become", "create", "demand", "directly", "land", "large", "major", "population", "reduce", "related", "resource", "treatment", "urban", "water". | EXACT TITLE in water_rights: "Stormwater".
0.480
Aquifer ↗ Q208791 EXACT TITLE
beyondclassifiedenvironmentformationhomeindustriallandlayermajormaterialsregionrelatedstudywater
SHARED TOKENS (14): "beyond", "classified", "environment", "formation", "home", "industrial", "land", "layer", "major", "materials", "region", "related", "study", "water". | EXACT TITLE in water_rights: "Aquifer".
0.480
compliancecontactfrequentlygenerallyhealthimpactphysicalqualitysafetysignificantstandardssupplytreatmentwater
SHARED TOKENS (14): "compliance", "contact", "frequently", "generally", "health", "impact", "physical", "quality", "safety", "significant", "standards", "supply", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.480
actapplicationfarmersgenerallyneedpermitpointqualityrequirementssourcessuppliedsurroundinguseswater
SHARED TOKENS (14): "act", "application", "farmers", "generally", "need", "permit", "point", "quality", "requirements", "sources", "supplied", "surrounding", "uses", "water". | EXACT TITLE in water_rights: "Return flow".
0.480
adaagencyboisecanyonidahomainmetropolitanoperatesoperatorpublicregionalservingtreasurevalley
SHARED TOKENS (14): "ada", "agency", "boise", "canyon", "idaho", "main", "metropolitan", "operates", "operator", "public", "regional", "serving", "treasure", "valley". | EXACT TITLE in arts_culture: "Valley Regional Transit".
0.480
agriculturalapproximatelychangeclimateindustrialproducedresourceresourcesriversourcessouthsupplywastewaterwater
SHARED TOKENS (14): "agricultural", "approximately", "change", "climate", "industrial", "produced", "resource", "resources", "river", "sources", "south", "supply", "wastewater", "water". | EXACT TITLE in water_rights: "Water resources".
0.480
boisebureaucountiesengineeringengineershistoricidahonationaloperatedprimaryprovideriverwaterwestern
SHARED TOKENS (14): "boise", "bureau", "counties", "engineering", "engineers", "historic", "idaho", "national", "operated", "primary", "provide", "river", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.480
actagencyeducationestablishedfederalgovernmentindependentnationalofficepreservationprogramspublicresearchsupporting
SHARED TOKENS (14): "act", "agency", "education", "established", "federal", "government", "independent", "national", "office", "preservation", "programs", "public", "research", "supporting". | EXACT TITLE in arts_culture: "National Endowment for the Humanities".
0.460
Ballet ↗ Q41425 EXACT TITLE
aroundbecomedistinctformlatermodernperformanceproductionresultschoolstechnicaltrainedwork
SHARED TOKENS (13): "around", "become", "distinct", "form", "later", "modern", "performance", "production", "result", "schools", "technical", "trained", "work". | EXACT TITLE in arts_culture: "Ballet".
0.460
approximatelyboisedatadistrictdistrictsevengovernmentidaholegislaturepopulationresidentssinglesouth
SHARED TOKENS (13): "approximately", "boise", "data", "district", "districts", "even", "government", "idaho", "legislature", "population", "residents", "single", "south". | EXACT TITLE in water_rights: "Idaho Legislature".
0.460
Jazz ↗ Q8341 EXACT TITLE
aroundcommercialdifferentearlyformlocalmajornationalregionalshiftingsignificantsinglestructure
SHARED TOKENS (13): "around", "commercial", "different", "early", "form", "local", "major", "national", "regional", "shifting", "significant", "single", "structure". | EXACT TITLE in arts_culture: "Jazz".
0.460
communitycontemporarycreatedgenerallyidentitylargermaterialsmodernnationalresultingspecialiststhemwork
SHARED TOKENS (13): "community", "contemporary", "created", "generally", "identity", "larger", "materials", "modern", "national", "resulting", "specialists", "them", "work". | EXACT TITLE in arts_culture: "Contemporary art".
0.460
MODFLOW ↗ Q6716996 EXACT TITLE
beyondboundarycodecommercialconditionsmodeloperatingprogrampublicsimulationsurveysystemstext
SHARED TOKENS (13): "beyond", "boundary", "code", "commercial", "conditions", "model", "operating", "program", "public", "simulation", "survey", "systems", "text". | EXACT TITLE in water_rights: "MODFLOW".
0.460
adaapproximatelyboisecanyoncapacityidaholakeriversystemtreasurevalleywaterwestern
SHARED TOKENS (13): "ada", "approximately", "boise", "canyon", "capacity", "idaho", "lake", "river", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.460
Snowpack ↗ Q18575846 EXACT TITLE
annualchangeclimateconditionsdifferentformationimpactphysicalpropertiesprovideresourcestudywater
SHARED TOKENS (13): "annual", "change", "climate", "conditions", "different", "formation", "impact", "physical", "properties", "provide", "resource", "study", "water". | EXACT TITLE in water_rights: "Snowpack".
0.460
commercialdirectlyindustrialinfrastructuremunicipalitiesoccursseparateservingsystemsystemstreatmenturbanwastewater
SHARED TOKENS (13): "commercial", "directly", "industrial", "infrastructure", "municipalities", "occurs", "separate", "serving", "system", "systems", "treatment", "urban", "wastewater". | EXACT TITLE in water_rights: "Sanitary sewer".
0.450
blackboisehistoryidahonorthwest
SHARED TOKENS (5): "black", "boise", "history", "idaho", "northwest". | URL->A (1): https://www.ibhm.org/. | EXACT TITLE in arts_culture: "Idaho Black History Museum".
0.450
boisefocusedhistoryidahoinstitution
SHARED TOKENS (5): "boise", "focused", "history", "idaho", "institution". | URL->A (1): https://basquemuseum.eus/. | EXACT TITLE in arts_culture: "Basque Museum and Cultural Center".
0.440
businesschangeformgovernmentincreaselong-termpracticesprivateprovidingpublicqualityrather
SHARED TOKENS (12): "business", "change", "form", "government", "increase", "long-term", "practices", "private", "providing", "public", "quality", "rather". | EXACT TITLE in arts_culture: "Philanthropy".
0.440
Downtown ↗ Q1050303 EXACT TITLE
businesscentralcommercialconcentrateddistrictemploymentgeographichistoricaljobsofficepopulationpublic
SHARED TOKENS (12): "business", "central", "commercial", "concentrated", "district", "employment", "geographic", "historical", "jobs", "office", "population", "public". | EXACT TITLE in arts_culture: "Downtown".
0.440
builtconservationdevelopmentenvironmenthistorichistoricalitemslegacyobjectspreservationpreserveprotect
SHARED TOKENS (12): "built", "conservation", "development", "environment", "historic", "historical", "items", "legacy", "objects", "preservation", "preserve", "protect". | EXACT TITLE in arts_culture: "Historic preservation".
0.440
agencyboisedepartmentenvironmentalfederalgovernmentidahomainqualityregionalregulationsresponsible
SHARED TOKENS (12): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "main", "quality", "regional", "regulations", "responsible". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.440
annualapplicationapplicationsapproximatelyaroundcapacitycontainsconversiondirectevenformationprimary
SHARED TOKENS (12): "annual", "application", "applications", "approximately", "around", "capacity", "contains", "conversion", "direct", "even", "formation", "primary". | EXACT TITLE in water_rights: "Geothermal heating".
0.440
Art museum ↗ Q207694 EXACT TITLE
accessiblebuildingfrequentlyitemsownershipperformanceplaceprivatepublicrestrictionsspacetemporary
SHARED TOKENS (12): "accessible", "building", "frequently", "items", "ownership", "performance", "place", "private", "public", "restrictions", "space", "temporary". | EXACT TITLE in arts_culture: "Art museum".
0.420
Reservoir ↗ Q131681 EXACT TITLE
behindbodybuildingbuiltcreatedformlakepowerspacestoragewater
SHARED TOKENS (11): "behind", "body", "building", "built", "created", "form", "lake", "power", "space", "storage", "water". | EXACT TITLE in water_rights: "Reservoir".
0.420
aroundcommunitydesignedfacilityindividuallocalmakingplacepoolprivatesingle
SHARED TOKENS (11): "around", "community", "designed", "facility", "individual", "local", "making", "place", "pool", "private", "single". | EXACT TITLE in arts_culture: "Community foundation".
0.420
accessanotherestateevenlegalpropertyrightsspecifictitleviewwater
SHARED TOKENS (11): "access", "another", "estate", "even", "legal", "property", "rights", "specific", "title", "view", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.420
Easement ↗ Q448405 EXACT TITLE
accessamonganotherlandlawprivatelypropertyprovidingpublicrealrights
SHARED TOKENS (11): "access", "among", "another", "land", "law", "privately", "property", "providing", "public", "real", "rights". | EXACT TITLE in water_rights: "Easement".
0.400
Ditch ↗ Q2048319 EXACT TITLE
aroundcommonlyconditionscreatedfieldsmajorprovidethemwaterwhose
SHARED TOKENS (10): "around", "commonly", "conditions", "created", "fields", "major", "provide", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.400
adjudicationevidenceinvolvedlegalobligationsprocessprocessesreviewsrightsshows
SHARED TOKENS (10): "adjudication", "evidence", "involved", "legal", "obligations", "process", "processes", "reviews", "rights", "shows". | EXACT TITLE in arts_culture: "Adjudication". | EXACT TITLE in water_rights: "Adjudication".
0.400
Visual arts ↗ Q36649 EXACT TITLE
currentdesignindustrialinvolvingmediaperformingpractitionerschoolswesternworking
SHARED TOKENS (10): "current", "design", "industrial", "involving", "media", "performing", "practitioner", "schools", "western", "working". | EXACT TITLE in arts_culture: "Visual arts".
0.400
administrationagencyassociateddepartmenteconomicfederalnationalofficeresourcesresponsible
SHARED TOKENS (10): "administration", "agency", "associated", "department", "economic", "federal", "national", "office", "resources", "responsible". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.400
agriculturalclimatecyclelocalmanagementopenprocessesresourcerolewater
SHARED TOKENS (10): "agricultural", "climate", "cycle", "local", "management", "open", "processes", "resource", "role", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.380
anothercurrentdifferentevenlongermakingprocesssingletimes
SHARED TOKENS (9): "another", "current", "different", "even", "longer", "making", "process", "single", "times". | EXACT TITLE in water_rights: "Radionuclide".
0.380
capacityconservationfuturepracticerightssignificantstoragetransferswater
SHARED TOKENS (9): "capacity", "conservation", "future", "practice", "rights", "significant", "storage", "transfers", "water". | EXACT TITLE in water_rights: "Water banking".
0.380
Anthropology ↗ Q23404 EXACT TITLE
commonlygenerallyhistoryindependentphysicalrelatedremainsstudiesstudy
SHARED TOKENS (9): "commonly", "generally", "history", "independent", "physical", "related", "remains", "studies", "study". | EXACT TITLE in arts_culture: "Anthropology".
0.370
idahonampa
SHARED TOKENS (2): "idaho", "nampa". | URL->A (1): http://warhawkairmuseum.org/. | EXACT TITLE in arts_culture: "Warhawk Air Museum".
0.360
capacitycycleestimatedlandmajoroccursrecordwater
SHARED TOKENS (8): "capacity", "cycle", "estimated", "land", "major", "occurs", "record", "water". | EXACT TITLE in water_rights: "Streamflow".
0.360
differentgenerallylawlegalphysicalriversystemswater
SHARED TOKENS (8): "different", "generally", "law", "legal", "physical", "river", "systems", "water". | EXACT TITLE in water_rights: "Water right".
0.340
Sugar beet ↗ Q151964 EXACT TITLE
classifiedcontainsgroupmillionproducedproductionwhose
SHARED TOKENS (7): "classified", "contains", "group", "million", "produced", "production", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.340
cycleenvironmentaloccursprimaryprocessprocesseswater
SHARED TOKENS (7): "cycle", "environmental", "occurs", "primary", "process", "processes", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.340
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverurbanwestern
SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "urban", "western". | EXACT TITLE in water_rights: "Boise River".
0.320
educationmeansmediapointpreservationview
SHARED TOKENS (6): "education", "means", "media", "point", "preservation", "view". | EXACT TITLE in arts_culture: "Storytelling".
0.320
buildingdevelopmentestatelandlandscapereal
SHARED TOKENS (6): "building", "development", "estate", "land", "landscape", "real". | EXACT TITLE in water_rights: "Land development".
0.320
educationeducationalperformingpolicyresearchreview
SHARED TOKENS (6): "education", "educational", "performing", "policy", "research", "review". | EXACT TITLE in arts_culture: "Arts education".
0.300
Public history ↗ Q441989 KW CROSS HIGH
becomefieldsgenerallygovernmenthistorichistoricalhistoryincreasinglymediaoutsideparkspracticepreservationpublicrelatedsciencesitesspecializedtrainingworking
SHARED TOKENS (20): "become", "fields", "generally", "government", "historic", "historical", "history", "increasingly", "media", "outside", "parks", "practice", "preservation", "public", "related", "science", "sites", "specialized", "training", "working".
0.300
Music festival ↗ Q868557 KW CROSS HIGH
annualassociatedcommonlycommunityeducationfoodgenerallyinformationinstitutionsorganizationsorganizedperformanceproductionspecifictemporary
SHARED TOKENS (15): "annual", "associated", "commonly", "community", "education", "food", "generally", "information", "institutions", "organizations", "organized", "performance", "production", "specific", "temporary".
0.300
advancedapplicationscentralcomponentscontrolcreatecreatedenvironmentequipmentfabricationfacilitiesindividualindustrialinsideintegratedlargemaintainmanufacturingmaterialsmodern
SHARED TOKENS (31): "advanced", "applications", "central", "components", "control", "create", "created", "environment", "equipment", "fabrication", "facilities", "individual", "industrial", "inside", "integrated", "large", "maintain", "manufacturing", "materials", "modern"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothereconomicenforcementenvironmentalgenerallygoverninggovernsjurisdictionlandlawlegalmajorownershipprivatepropertypublicrealrelationshipsrights
SHARED TOKENS (24): "acquisition", "another", "economic", "enforcement", "environmental", "generally", "governing", "governs", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "property", "public", "real", "relationships", "rights"....
0.300
actadministeredagenciesauthoritycodecomprehensiveconservationdependdesigneddevelopmentdifferenteconomicfederalgrowthlawmeansmechanismsnationalpointpreservation
SHARED TOKENS (30): "act", "administered", "agencies", "authority", "code", "comprehensive", "conservation", "depend", "designed", "development", "different", "economic", "federal", "growth", "law", "means", "mechanisms", "national", "point", "preservation"....
0.300
adjudicationadministrationadministrativeagenciesanotherbuiltchangescontrolcreateddecisionsdivisioneconomiceducationenforcementenvironmentenvironmentalexpandedgenerallygoverninggovernment
SHARED TOKENS (35): "adjudication", "administration", "administrative", "agencies", "another", "built", "changes", "control", "created", "decisions", "division", "economic", "education", "enforcement", "environment", "environmental", "expanded", "generally", "governing", "government"....
0.300
accountadditionalannualboisechangechangesclimatecoursedatadegreesdifferentearlyestimatedexperienceextendgeneralgenerallyhistoryidahoincrease
SHARED TOKENS (33): "account", "additional", "annual", "boise", "change", "changes", "climate", "course", "data", "degrees", "different", "early", "estimated", "experience", "extend", "general", "generally", "history", "idaho", "increase"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
bodycontrolsdevelopmentenvironmentenvironmentalgeneralgrowthindustriallakemainoccurspointpoliciesprocessprogramreduceresultresultingriversources
SHARED TOKENS (22): "body", "controls", "development", "environment", "environmental", "general", "growth", "industrial", "lake", "main", "occurs", "point", "policies", "process", "program", "reduce", "result", "resulting", "river", "sources"....
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
commonlyconnecteddomesticenvironmentfacilityinvolvingprimaryprocessesreducesystemsystemsthereforetreatmentwastewastewater
SHARED TOKENS (15): "commonly", "connected", "domestic", "environment", "facility", "involving", "primary", "processes", "reduce", "system", "systems", "therefore", "treatment", "waste", "wastewater".
0.300
Ethnography ↗ Q132151 KW CROSS HIGH
analysisclimatedatadocumentdocumentsearlyformgrouphabitathistoryindividualinteractionlocalonlinephysicalpointresearchrolesciencestudy
SHARED TOKENS (22): "analysis", "climate", "data", "document", "documents", "early", "form", "group", "habitat", "history", "individual", "interaction", "local", "online", "physical", "point", "research", "role", "science", "study"....
0.300
affectsagriculturalbecomebodybuildingcategorychangesconstructioncontroldifferentgenerallylandlargelocalmakingmanagementoperationspointprincipalquality
SHARED TOKENS (31): "affects", "agricultural", "become", "body", "building", "category", "changes", "construction", "control", "different", "generally", "land", "large", "local", "making", "management", "operations", "point", "principal", "quality"....
0.300
additionalcommercialcomponentsconnectionsdevelopingdistributionfacilitiesfiregenerallyindustrialinstitutionlakelocallyneednetworkpointprivateprovideprovidingpublic
SHARED TOKENS (30): "additional", "commercial", "components", "connections", "developing", "distribution", "facilities", "fire", "generally", "industrial", "institution", "lake", "locally", "need", "network", "point", "private", "provide", "providing", "public"....
0.300
agenciesbureauchapterconservationconsolidatedcouncilcountiescreatedatadistrictdistrictsentitiesevenexceptionsfireformfunctionsgeneralgenerallygovernment
SHARED TOKENS (43): "agencies", "bureau", "chapter", "conservation", "consolidated", "council", "counties", "create", "data", "district", "districts", "entities", "even", "exceptions", "fire", "form", "functions", "general", "generally", "government"....
0.300
associationcategorychangescreatedcurrentdepartmentfebruarygovernmentissuelaterlocalmajorofficeparksperformanceproducedrecreationreviewsstaffsupporting
SHARED TOKENS (21): "association", "category", "changes", "created", "current", "department", "february", "government", "issue", "later", "local", "major", "office", "parks", "performance", "produced", "recreation", "reviews", "staff", "supporting"....
0.300
affectanalysisapplicationboundarydifferentedgehealthinteractionlandmakingmanagementmeansmechanismsmodeloccursproducesprotectionpublicqualityrather
SHARED TOKENS (29): "affect", "analysis", "application", "boundary", "different", "edge", "health", "interaction", "land", "making", "management", "means", "mechanisms", "model", "occurs", "produces", "protection", "public", "quality", "rather"....
0.300
affectingamongcapacityconstructedconstructioncreatingdemanddirectelectricalenvironmentalimpactinvolvedlandlargelossmakingpopulationpowerproducedproduces
SHARED TOKENS (32): "affecting", "among", "capacity", "constructed", "construction", "creating", "demand", "direct", "electrical", "environmental", "impact", "involved", "land", "large", "loss", "making", "population", "power", "produced", "produces"....
0.300
actadabusinesschangescostscouncilfinalidentitylaterlawnationalprotectionprovidepublicrequirementsrequiresrights
SHARED TOKENS (17): "act", "ada", "business", "changes", "costs", "council", "final", "identity", "later", "law", "national", "protection", "provide", "public", "requirements", "requires", "rights".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accountadministrationanalysisanotherbroaderbuiltbusinesscapitalcategorycodescommunicationscommunityconsiderationscreatingdesigndevelopingdevelopmentdifferentdistributionearly
SHARED TOKENS (67): "account", "administration", "analysis", "another", "broader", "built", "business", "capital", "category", "codes", "communications", "community", "considerations", "creating", "design", "developing", "development", "different", "distribution", "early"....
0.300
Baroque music ↗ Q8361 KW CROSS HIGH
continuedcreationdevelopingdominantestablishedexpandedfollowedformgroupindependentmajormodernperformanceprofessionalwestern
SHARED TOKENS (15): "continued", "creation", "developing", "dominant", "established", "expanded", "followed", "form", "group", "independent", "major", "modern", "performance", "professional", "western".
0.300
accesscannotcommunicationscontrolcostsdifferententityfederalfrequentlygovernmentinfrastructureinstitutionissuelargelocalmarketmodernoperatespointproduction
SHARED TOKENS (33): "access", "cannot", "communications", "control", "costs", "different", "entity", "federal", "frequently", "government", "infrastructure", "institution", "issue", "large", "local", "market", "modern", "operates", "point", "production"....
0.300
actactiveadministeredagenciesapproximatelyauthoritybillionbudgetbuildingbusinesscapacitycomponentsconductconfirmsconstructioncontrolcreationdepartmentdesigndirect
SHARED TOKENS (65): "act", "active", "administered", "agencies", "approximately", "authority", "billion", "budget", "building", "business", "capacity", "components", "conduct", "confirms", "construction", "control", "creation", "department", "design", "direct"....
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalallowinganotherapplicationscustomerdemanddesigndesigneddevelopmentdifferentenvironmentalequipmentfacilitieshistoricalinfrastructureinstallationlandmanagementmodernplace
SHARED TOKENS (37): "agricultural", "allowing", "another", "applications", "customer", "demand", "design", "designed", "development", "different", "environmental", "equipment", "facilities", "historical", "infrastructure", "installation", "land", "management", "modern", "place"....
0.300
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | EXACT TITLE in arts_culture: "Northwest Nazarene University".
0.300
agenciesbuiltcomponentsconstructiondepartmentsdesignengineeringenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalplaceprivateprofessional
SHARED TOKENS (25): "agencies", "built", "components", "construction", "departments", "design", "engineering", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "place", "private", "professional"....
0.300
agencycurrentdatadepartmentfederalgovernmentlandscapemajormakesmapspublicregulatoryresearchresourcesresponsibilitysciencespacestudysurveywhose
SHARED TOKENS (21): "agency", "current", "data", "department", "federal", "government", "landscape", "major", "makes", "maps", "public", "regulatory", "research", "resources", "responsibility", "science", "space", "study", "survey", "whose"....
0.300
accessagreementsaloneamongassociatedbecomechangesclimateconditionsconflictscontrolcorporateeconomicfarmersgovernmenthistoryindividualinstitutionslocalmakes
SHARED TOKENS (40): "access", "agreements", "alone", "among", "associated", "become", "changes", "climate", "conditions", "conflicts", "control", "corporate", "economic", "farmers", "government", "history", "individual", "institutions", "local", "makes"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscompleteconnectedcoursecurrentestablishedfarmersfootformhistoricidahoincreasinglymakingmodernorganizedownerspointriverseparatevalley
SHARED TOKENS (22): "business", "complete", "connected", "course", "current", "established", "farmers", "foot", "form", "historic", "idaho", "increasingly", "making", "modern", "organized", "owners", "point", "river", "separate", "valley"....
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalcreateddatedesignedfieldsformhealthhistoricalmanagementoperatedpracticeregionresourcesystemswater
SHARED TOKENS (15): "agricultural", "created", "date", "designed", "fields", "form", "health", "historical", "management", "operated", "practice", "region", "resource", "systems", "water".
0.300
agreementsappliesbecomeconnectionconservationdocumentseconomicfuturegrouphistoricalinvolvedlegacylegallocalmajornationalphysicalpreservationpropertyprotection
SHARED TOKENS (27): "agreements", "applies", "become", "connection", "conservation", "documents", "economic", "future", "group", "historical", "involved", "legacy", "legal", "local", "major", "national", "physical", "preservation", "property", "protection"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcommercialcorecostsdevelopmentenvironmentenvironmentalformgeographicgrowthindustrialinfrastructurejobslandlargelossmeasure
SHARED TOKENS (35): "agency", "associated", "become", "building", "commercial", "core", "costs", "development", "environment", "environmental", "form", "geographic", "growth", "industrial", "infrastructure", "jobs", "land", "large", "loss", "measure"....
0.300
advancedagriculturalbusinessescostcostsdirectdistributionenvironmentalfieldsindustrialmanagementmunicipalpracticeprocessreduceregionremainrequirereusestandards
SHARED TOKENS (26): "advanced", "agricultural", "businesses", "cost", "costs", "direct", "distribution", "environmental", "fields", "industrial", "management", "municipal", "practice", "process", "reduce", "region", "remain", "require", "reuse", "standards"....
0.300
analysiscreatecreationeconomicevenhistorichistoryidentitymakingmediaobjectsphysicalpracticepreservationrelationshipssciencespecificstudiessystems
SHARED TOKENS (19): "analysis", "create", "creation", "economic", "even", "historic", "history", "identity", "making", "media", "objects", "physical", "practice", "preservation", "relationships", "science", "specific", "studies", "systems".
0.300
becomebroadercallscentralchangescontemporarycontrolleddominantfocusedformidentitymodernperformanceplatformspracticespreviouslyprocessesrelatedresultsystem
SHARED TOKENS (25): "become", "broader", "calls", "central", "changes", "contemporary", "controlled", "dominant", "focused", "form", "identity", "modern", "performance", "platforms", "practices", "previously", "processes", "related", "result", "system"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycapableconservationcreatedcycledifferentestatefacilitygovernmentlandlegallocalmainoperateownershipphysicalprivaterealretainright-of-way
SHARED TOKENS (26): "authority", "capable", "conservation", "created", "cycle", "different", "estate", "facility", "government", "land", "legal", "local", "main", "operate", "ownership", "physical", "private", "real", "retain", "right-of-way"....
0.300
Arts district ↗ Q1797194 KW CROSS HIGH
anotherassociatedcommercialcreatedistrictdistrictseconomicfacilitieshomejobslargeoccursplacesplanningproductionpublicqualityratherresearchspace
SHARED TOKENS (21): "another", "associated", "commercial", "create", "district", "districts", "economic", "facilities", "home", "jobs", "large", "occurs", "places", "planning", "production", "public", "quality", "rather", "research", "space"....
0.300
actadministersassociateddevelopmentdivisionengineersenvironmentalindexinfrastructurenationalnetpdfprotectionpublicrequirementsresourcesstructuraltextwater
SHARED TOKENS (19): "act", "administers", "associated", "development", "division", "engineers", "environmental", "index", "infrastructure", "national", "net", "pdf", "protection", "public", "requirements", "resources", "structural", "text", "water".
0.300
amongapproximatelyassociationboisebureaucanyoncapacityconservationcontainscountiescreatedcreatesdirectlyedgefebruaryfederalflatformationidaholake
SHARED TOKENS (37): "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "conservation", "contains", "counties", "created", "creates", "directly", "edge", "february", "federal", "flat", "formation", "idaho", "lake"....
0.300
analysisbroaderbuildingchangechangesclimatecontrolengineeringimpactincreaseindividualinfrastructurelandscapemanagemanagementmeasurespracticepracticesprocessesproperties
SHARED TOKENS (29): "analysis", "broader", "building", "change", "changes", "climate", "control", "engineering", "impact", "increase", "individual", "infrastructure", "landscape", "manage", "management", "measures", "practice", "practices", "processes", "properties"....
0.300
addressingappliesconstructioncontrolcreatedesignengineeringengineersenvironmentenvironmentalfocusedhealthimpactindustriallawlicensinglocalmaintainmanagementmunicipal
SHARED TOKENS (40): "addressing", "applies", "construction", "control", "create", "design", "engineering", "engineers", "environment", "environmental", "focused", "health", "impact", "industrial", "law", "licensing", "local", "maintain", "management", "municipal"....
0.300
boiseidaholakeregionalshare
SHARED TOKENS (5): "boise", "idaho", "lake", "regional", "share". | EXACT TITLE in arts_culture: "Idaho Shakespeare Festival".
0.300
agencyaroundconservationdepartmenteducationenforcementengineersenvironmentalestablishingfederalgovernmentindependentinformationlegallocalmattersmeasuresnationaloperationpermitting
SHARED TOKENS (30): "agency", "around", "conservation", "department", "education", "enforcement", "engineers", "environmental", "establishing", "federal", "government", "independent", "information", "legal", "local", "matters", "measures", "national", "operation", "permitting"....
0.300
aroundbillioncapacitycentralchangechangesclimateconditionsconservationcooperationcurrentdemanddevelopmentdifferenteconomicenvironmentalexperiencefunctionfutureincrease
SHARED TOKENS (42): "around", "billion", "capacity", "central", "change", "changes", "climate", "conditions", "conservation", "cooperation", "current", "demand", "development", "different", "economic", "environmental", "experience", "function", "future", "increase"....
0.300
boisecontinuedearlyrecordsuntil
SHARED TOKENS (5): "boise", "continued", "early", "records", "until". | EXACT TITLE in arts_culture: "Gene Harris".
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeagriculturalbusinesscatalogcommercialconservationdateearlyfacilitiesgenerallygrowthhomeindependentlargelargerlibrarymaterialsmodernnationalolder
SHARED TOKENS (32): "active", "agricultural", "business", "catalog", "commercial", "conservation", "date", "early", "facilities", "generally", "growth", "home", "independent", "large", "larger", "library", "materials", "modern", "national", "older"....
0.300
actaddressingagenciesagreementagreementschangeclimatecomplianceconcerningconferenceconservationcontroldesigneddevelopmenteconomicenforcementenvironmentenvironmentalestablishgrowth
SHARED TOKENS (45): "act", "addressing", "agencies", "agreement", "agreements", "change", "climate", "compliance", "concerning", "conference", "conservation", "control", "designed", "development", "economic", "enforcement", "environment", "environmental", "establish", "growth"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcommercialdeterminemanufacturingmeasuremodernoutsidepracticeprocesspublicregisterrequirementsresidentialstandardssuppliedsupplysystemwaterworks
SHARED TOKENS (20): "association", "building", "commercial", "determine", "manufacturing", "measure", "modern", "outside", "practice", "process", "public", "register", "requirements", "residential", "standards", "supplied", "supply", "system", "water", "works".
0.300
actagenciesagencyapplyaroundauthoritycouncilcreateddecisionsdesignedenvironmentenvironmentalestablishedfederalfinalgovernmentimpactlawnationalpolicies
SHARED TOKENS (31): "act", "agencies", "agency", "apply", "around", "authority", "council", "created", "decisions", "designed", "environment", "environmental", "established", "federal", "final", "government", "impact", "law", "national", "policies"....
0.300
actaffectagriculturalanotherapplicationschangeclimatecommercialconservationcurrentdemanddevelopmentfuturegrowthinvolvedlocallossmakesmanagemanagement
SHARED TOKENS (37): "act", "affect", "agricultural", "another", "applications", "change", "climate", "commercial", "conservation", "current", "demand", "development", "future", "growth", "involved", "local", "loss", "makes", "manage", "management"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationbringcommonlyconnectdevelopmentevenexpandedfinalfunctionsgovernmentimpactlandlaterlegalmunicipalitiesownersownershippower
SHARED TOKENS (31): "acquisition", "another", "application", "bring", "commonly", "connect", "development", "even", "expanded", "final", "functions", "government", "impact", "land", "later", "legal", "municipalities", "owners", "ownership", "power"....
0.300
addressingaffectagriculturalcentralchangechangesclimateconcentrateddevelopmentdirecteconomicenvironmentenvironmentalfieldsfoodimpactlandlargelocalmajor
SHARED TOKENS (35): "addressing", "affect", "agricultural", "central", "change", "changes", "climate", "concentrated", "development", "direct", "economic", "environment", "environmental", "fields", "food", "impact", "land", "large", "local", "major"....
0.300
boisebureaucapacitycomponentsdesigneddistrictflathistoricidahonampanationalplaceplacesprogramprojectprovideregisterrivertreasurevalley
SHARED TOKENS (22): "boise", "bureau", "capacity", "components", "designed", "district", "flat", "historic", "idaho", "nampa", "national", "place", "places", "program", "project", "provide", "register", "river", "treasure", "valley"....
0.300
actadministrativearticlecodecreategenerallylawlibraryofficepowerprotectionpublicrightssciencesectionsubjecttimestitletransfersworks
SHARED TOKENS (20): "act", "administrative", "article", "code", "create", "generally", "law", "library", "office", "power", "protection", "public", "rights", "science", "section", "subject", "times", "title", "transfers", "works".
0.300
amongappliesapplyassociatedassociationcodecommunitycontinuedcorporateeducationalentitiesexemptionfederalformindividuallossnationalnonprofitoperatedoperation
SHARED TOKENS (30): "among", "applies", "apply", "associated", "association", "code", "community", "continued", "corporate", "educational", "entities", "exemption", "federal", "form", "individual", "loss", "national", "nonprofit", "operated", "operation"....
0.300
affectagencychangescontemporarycouncildecisionsdevelopmenteconomicemergencyfederalgovernmenthistoricindependentleadershipnationalpermittedpolicypreservationprogramsprojects
SHARED TOKENS (23): "affect", "agency", "changes", "contemporary", "council", "decisions", "development", "economic", "emergency", "federal", "government", "historic", "independent", "leadership", "national", "permitted", "policy", "preservation", "programs", "projects"....
0.300
amongappearsaroundearlyevenhistorieslatermajormattersnationalphysicalprivateproducedqualityrecordsremainstextthemuntilworks
SHARED TOKENS (20): "among", "appears", "around", "early", "even", "histories", "later", "major", "matters", "national", "physical", "private", "produced", "quality", "records", "remains", "text", "them", "until", "works".
0.300
actapprovalapprovalsbuildingcommercialconstructioncontractorscostscreatescreationdesigndeterminedevelopersdevelopmentdifferenteconomicengineersenvironmentalestategrowth
SHARED TOKENS (42): "act", "approval", "approvals", "building", "commercial", "construction", "contractors", "costs", "creates", "creation", "design", "determine", "developers", "development", "different", "economic", "engineers", "environmental", "estate", "growth"....
🫐 BERRY44 edges
0.280
agencyassociationidahointegrated
SHARED TOKENS (4): "agency", "association", "idaho", "integrated". | EXACT TITLE in water_rights: "Idaho State Bar".
0.280
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturaldifferenteconomyfoodidaholandmillionproducesproductionrepresentsrolesalesectorsignificant
SHARED TOKENS (14): "agricultural", "different", "economy", "food", "idaho", "land", "million", "produces", "production", "represents", "role", "sale", "sector", "significant".
0.280
adaboisecentralconnectedcontainshistoricidahometropolitannationalpopulationrecreationsectionvalleywestern
SHARED TOKENS (14): "ada", "boise", "central", "connected", "contains", "historic", "idaho", "metropolitan", "national", "population", "recreation", "section", "valley", "western".
0.280
contemporaryincreasinglyinstitutionsplacepracticeprogramsproviderelatedresourcesspacespecificsupportworkingworks
SHARED TOKENS (14): "contemporary", "increasingly", "institutions", "place", "practice", "programs", "provide", "related", "resources", "space", "specific", "support", "working", "works".
0.280
Maize ↗ Q11575 KW CROSS HIGH
annualbecomebillioncommercialcontainsfoodmainmajormodernproducedproducesproductiontreatmentuses
SHARED TOKENS (14): "annual", "become", "billion", "commercial", "contains", "food", "main", "major", "modern", "produced", "produces", "production", "treatment", "uses".
0.260
idahoprofessionaltitle
SHARED TOKENS (3): "idaho", "professional", "title". | EXACT TITLE in arts_culture: "James Castle".
0.260
Alfalfa ↗ Q156106 EXACT TITLE
aroundcommonlysouth
SHARED TOKENS (3): "around", "commonly", "south". | EXACT TITLE in water_rights: "Alfalfa".
0.260
Aquifer test ↗ Q446124 KW CROSS HIGH
applyaroundchangedataengineeringincreasemodelpointpropertiesrealresultssystemwater
SHARED TOKENS (13): "apply", "around", "change", "data", "engineering", "increase", "model", "point", "properties", "real", "results", "system", "water".
0.260
demanddistributionfiremainpreventsprotectsignificantsourcesstoragesuppliessystemsystemswater
SHARED TOKENS (13): "demand", "distribution", "fire", "main", "prevents", "protect", "significant", "sources", "storage", "supplies", "system", "systems", "water".
0.240
actchaptercodedevelopmentfederallawpowerprojectsregulationtimestitlewater
SHARED TOKENS (12): "act", "chapter", "code", "development", "federal", "law", "power", "projects", "regulation", "times", "title", "water".
0.240
amongconnectionsdifferentdistinctenvironmentfocusedlocalplacesrequiresresearchsitestudy
SHARED TOKENS (12): "among", "connections", "different", "distinct", "environment", "focused", "local", "places", "requires", "research", "site", "study".
0.240
conservationdecisionsdescribesdesignhistoricalhistoricallyindividualpreservationprocesspropertysignificantvalue
SHARED TOKENS (12): "conservation", "decisions", "describes", "design", "historical", "historically", "individual", "preservation", "process", "property", "significant", "value".
0.240
associationscategoriescontinuingcreateddesignedenvironmentfieldslandscapemainpropertiesstudiesworks
SHARED TOKENS (12): "associations", "categories", "continuing", "created", "designed", "environment", "fields", "landscape", "main", "properties", "studies", "works".
0.240
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturaldivisionidaholargermajornationalrecreationriversectionsouthvalleywest
SHARED TOKENS (12): "agricultural", "division", "idaho", "larger", "major", "national", "recreation", "river", "section", "south", "valley", "west".
0.240
controldistinctgoverninglawownershippropertyqualityregulationsrelatedresourceresourceswater
SHARED TOKENS (12): "control", "distinct", "governing", "law", "ownership", "property", "quality", "regulations", "related", "resource", "resources", "water".
0.220
frequentlyregion
SHARED TOKENS (2): "frequently", "region". | EXACT TITLE in arts_culture: "Basque Country".
0.220
Chamber music ↗ Q189201 KW CROSS HIGH
descriptionsevenformgrouphistoryhomelargeperformanceprofessionalrequiresworks
SHARED TOKENS (11): "descriptions", "even", "form", "group", "history", "home", "large", "performance", "professional", "requires", "works".
0.220
aroundbureaucontainsexpandedmajornorthwestriversouthsouthwestwestwestern
SHARED TOKENS (11): "around", "bureau", "contains", "expanded", "major", "northwest", "river", "south", "southwest", "west", "western".
0.200
amonglandlaworganizedownershippossesspropertyrightssystemwater
SHARED TOKENS (10): "among", "land", "law", "organized", "ownership", "possess", "property", "rights", "system", "water".
0.200
adaboisegovernmentidahomainmetropolitanmunicipalpopulationseparatestreet
SHARED TOKENS (10): "ada", "boise", "government", "idaho", "main", "metropolitan", "municipal", "population", "separate", "street".
0.200
Abandon ↗ Q397584 EXACT TITLE
EXACT TITLE in water_rights: "Abandon".
0.200
annualarounddesignedfocusedgenerallistobjectivesprimaryprovidepublic
SHARED TOKENS (10): "annual", "around", "designed", "focused", "general", "list", "objectives", "primary", "provide", "public".
0.200
associatedconditionscontinueddesigndevelopingindustriallatermaterialsmodernproduced
SHARED TOKENS (10): "associated", "conditions", "continued", "design", "developing", "industrial", "later", "materials", "modern", "produced".
0.200
EXACT TITLE in water_rights: "Subdivision".
0.200
allowingdesigneddirectlyfarmersnetworkoperatedplacesystemsystemswater
SHARED TOKENS (10): "allowing", "designed", "directly", "farmers", "network", "operated", "place", "system", "systems", "water".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
EXACT TITLE in water_rights: "Forfeit".
0.200
Folklore ↗ Q36192 KW CROSS HIGH
anotherbodybuildingformgroupindividualinstructionregionstudiesstudy
SHARED TOKENS (10): "another", "body", "building", "form", "group", "individual", "instruction", "region", "studies", "study".
0.200
Curation ↗ Q5194611 EXACT TITLE
curation
EXACT TITLE in arts_culture: "Curation".
0.180
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahometropolitanpopulationschoolswest
SHARED TOKENS (9): "ada", "boise", "canyon", "district", "idaho", "metropolitan", "population", "schools", "west".
0.180
aroundcreatingequipmentfieldslandlargesectionsystemswater
SHARED TOKENS (9): "around", "creating", "equipment", "fields", "land", "large", "section", "systems", "water".
0.180
conservationdocumentationeducationprocesspropertyprotectionresearchsciencetreatment
SHARED TOKENS (9): "conservation", "documentation", "education", "process", "property", "protection", "research", "science", "treatment".
0.180
agriculturaldoctrineindustriallegalmerelyownershiprightssystemwater
SHARED TOKENS (9): "agricultural", "doctrine", "industrial", "legal", "merely", "ownership", "rights", "system", "water".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
behindboisecaldwellcanyonidahometropolitannampapopulationwestern
SHARED TOKENS (9): "behind", "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "western".
0.180
agencycontinuingdepartmentfederalgovernmentmanagementprotectwildlifeworking
SHARED TOKENS (9): "agency", "continuing", "department", "federal", "government", "management", "protect", "wildlife", "working".
0.160
developmenteconomicinstitutemanagementproposedstudiesuniversityurban
SHARED TOKENS (8): "development", "economic", "institute", "management", "proposed", "studies", "university", "urban".
0.160
establishedfebruaryfoodidaholegislaturemakingpopulationregion
SHARED TOKENS (8): "established", "february", "food", "idaho", "legislature", "making", "population", "region".
0.160
Lateral canal ↗ Q6495566 KW CROSS HIGH
anotherbuiltconstructingcourseprovideright-of-wayriverwater
SHARED TOKENS (8): "another", "built", "constructing", "course", "provide", "right-of-way", "river", "water".
0.140
distributionformmanagementpracticessignificantthereforewater
SHARED TOKENS (7): "distribution", "form", "management", "practices", "significant", "therefore", "water".
0.140
conservationdemandenvironmentalphysicalpracticesupplieswater
SHARED TOKENS (7): "conservation", "demand", "environmental", "physical", "practice", "supplies", "water".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
Basques ↗ Q126756 KW CROSS HIGH
amongarounddirectgroupregionwestern
SHARED TOKENS (6): "among", "around", "direct", "group", "region", "western".
0.120
Water table ↗ Q3342272 KW CROSS HIGH
actualdependenthistoricmaterialsuntilwater
SHARED TOKENS (6): "actual", "dependent", "historic", "materials", "until", "water".
0.120
doctrineownershipprivatepropertypublicresources
SHARED TOKENS (6): "doctrine", "ownership", "private", "property", "public", "resources".
0.120
aroundexperiencehistoricalregionsystemsvalue
SHARED TOKENS (6): "around", "experience", "historical", "region", "systems", "value".
◈ Frequently Asked Questions
Arts Culture × Water Rights — Treasure Valley
HAIKU · HIGH GATE
How do water rights affect cultural institutions in Ada County?
Cultural venues in Ada County depend on stable water access for irrigation of public grounds and facility maintenance, directly linking water allocation decisions to the operational capacity of arts organizations. Boise State University's cultural programming and campus grounds require water security agreements that reflect broader Treasure Valley water rights frameworks.
What role do arts organizations play in water rights discussions across the Treasure Valley?
Arts and cultural groups in Boise, Nampa, Caldwell, and Eagle have increasingly documented local water history through exhibitions and public programs that educate residents about Idaho's water rights systems. These organizations amplify community dialogue about land use and water allocation in Ada and Canyon counties through storytelling and historical preservation.
How does Boise's population growth connect water scarcity to cultural planning?
As Boise's estimated metropolitan population continues expanding into Eagle, Meridian, and Kuna, cultural institutions must compete for water resources alongside residential and agricultural users governed by Idaho water rights law. The Treasure Valley's arts sector increasingly factors water availability into venue design and public space planning.
Why do Treasure Valley artists document water rights issues in their work?
Artists in Boise and Canyon County communities address water rights because land use decisions tied to water allocation directly shape the physical and cultural landscape they inhabit and represent. Regional cultural institutions have begun hosting exhibitions and discussions that examine the History of Idaho's water management in relation to contemporary settlement patterns in the western metropolitan area.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Arts Culture × Water Rights 12 QID bridges 239 edges 6,226 ext links 2026-07-17 19:26:46 UTC 5659593070f9ac1b
Arts Culture corridor ↗ Water Rights corridor ↗ Water Rights × Arts Culture ↗ boisestandard.org/standard ↗
Parent Corridors
Arts Culture × All Other Verticals