—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Arts Culture ↔ relates to ↔ Land Use Planning

17 Wikipedia bridge articles confirmed in both vertical ledgers. 229 deterministic cross-vertical edges. 5,877 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
229 Cross Edges
5,877 External Sources
255 Wikipedia Articles
25 🌲 Evergreen
171 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Arts Culture
× Land Use Planning
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
229
External Sources Harvested
5,877
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise, Idaho
score: 1.1500  ·  type: exact_title_cross  ·  20 shared tokens
QID Bridge Titles (17)
Boise, IdahoCollege of Western IdahoIdahoUrban renewalBoise State UniversityBoise AirportUrban planningComprehensive planningTreasure ValleyNampa, IdahoEagle, IdahoAda County, IdahoGarden City, IdahoCanyon County, IdahoMeridian, IdahoCaldwell, IdahoKuna, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadametropolitancapitalpublicwesternlandcanyoncollegedowntownhomerivertreasurevalleycommunitydevelopmentnampalargest
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:24:23 UTC
Content Hash
a391bfe29a9ef0e2
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Boise, Idaho
Q35775 EXACT TITLE 1.150
QID OVERLAP: Q35775 in arts_culture (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (20): "ada", "annual", "block", "boise", "capital", "counties", "downtown", "employers", "feet", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "river", "technology", "treasure", "valley". | URL->A (2): http://www.balletidaho.org/, http://www.operaidaho.org/. | EXACT TITLE in arts_culture: "Boise, Idaho".
adaannualblockboisecapitalcountiesdowntownemployersfeethomeidaholocallymajormanufacturingmetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
College of Western Idaho
Q5146875 EXACT TITLE 1.150
QID OVERLAP: Q5146875 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (30): "academic", "ada", "boise", "canyon", "classes", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in arts_culture: "College of Western Idaho". | EXACT TITLE in land_use_planning: "College of Western Idaho".
academicadaboisecanyonclassescollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedresidentssouthweststudentstudentstechnicaltransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (29): "agricultural", "approximately", "associated", "boise", "capital", "contains", "distinct", "economy", "geographic", "idaho", "isolated", "land", "largest", "linked", "manufacturing", "million", "national", "official", "population", "products".... | EXACT TITLE in arts_culture: "Idaho". | EXACT TITLE in land_use_planning: "Idaho".
agriculturalapproximatelyassociatedboisecapitalcontainsdistincteconomygeographicidahoisolatedlandlargestlinkedmanufacturingmillionnationalofficialpopulationproductsriverscienceseparatesignificantsouthsuppliestechnologyuseswestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Urban renewal
Q920600 EXACT TITLE 1.000
QID OVERLAP: Q920600 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (20): "addressing", "businesses", "cities", "communities", "construction", "economic", "government", "growth", "housing", "infrastructure", "land", "neighborhoods", "private", "process", "projects", "public", "redevelopment", "renewal", "spaces", "urban". | EXACT TITLE in arts_culture: "Urban renewal". | EXACT TITLE in land_use_planning: "Urban renewal".
addressingbusinessescitiescommunitiesconstructioneconomicgovernmentgrowthhousinginfrastructurelandneighborhoodsprivateprocessprojectspublicredevelopmentrenewalspacesurban
Urban renewal, also known as urban regeneration or urban redevelopment, is a set of government or private initiatives aimed at addressing urban decay, upgrading infrastructure, and revitalizing city neighborhoods. Typically, urban renewal involves clearing "blighted" areas, followed by new construction for housing, businesses, and public spaces.
21st century In the late 20th century and now in the 21st century, urban renewal initiatives have often pursued three key goals: economic revitalization, social or cultural regeneration, and environmental sustainability. These efforts frequently aim to transform underutilized urban areas into hubs of economic and cultural activity, leveraging policies that promote both sustainability and equitable development. For example, green infrastructure projects, such as urban parks and community gardens, not only enhance property values but also foster social cohesion and provide environmental benefits like improved water management and biodiversity conservation. In recent years, urban renewal programs have increasingly involved "culturepreneurs," individuals or organizations that blend cultural and economic strategies to reimagine urban spaces. These stakeholders often collaborate with governments and private entities to redevelop vacant land into dynamic public spaces, such as pop-up cultural venues or urban beaches. Culturepreneur initiatives are designed to bridge the gap between the needs of urban residents, local authorities, and property developers, fostering innovative, community-driven solutions. Moreover, urban renewal projects have drawn attention to the nuanced impacts of gentrification. While these efforts can bring economic and infrastructural improvements, they may also displace long-standing communities and erode cultural heritage.
Slum clearances are the strategy of demolishing low-income, poor-quality settlements and using the land for another type of housing. As well as being a tool for urban renewal, they have also been carried out for public health and social reform reasons. Slum clearances and other programmes focused mainly on the demolition of housing in disadvantaged areas have often been criticized as a means of urban renewal for not adequately addressing the social problems that caused the initial problems in the area.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (27): "activity", "among", "arts", "awards", "boise", "business", "church", "college", "division", "economics", "education", "engineering", "fiscal", "founded", "health", "idaho", "independent", "master", "million", "program".... | EXACT TITLE in arts_culture: "Boise State University". | EXACT TITLE in land_use_planning: "Boise State University".
activityamongartsawardsboisebusinesschurchcollegedivisioneconomicseducationengineeringfiscalfoundedhealthidahoindependentmastermillionprogramprogramspublicreportedresearchschooluniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (28): "ada", "airport", "boise", "center", "commercial", "commission", "department", "downtown", "fire", "functions", "general", "idaho", "increase", "international", "joint", "million", "national", "operated", "operates", "protection".... | EXACT TITLE in arts_culture: "Boise Airport". | EXACT TITLE in land_use_planning: "Boise Airport".
adaairportboisecentercommercialcommissiondepartmentdowntownfirefunctionsgeneralidahoincreaseinternationaljointmillionnationaloperatedoperatesprotectionreceiverequiringrightssouthsupporttimesuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Urban planning
Q69883 EXACT TITLE 1.000
QID OVERLAP: Q69883 in arts_culture (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (75): "accessibility", "activities", "administration", "adopted", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "codes", "communities", "community", "considerations", "creating", "design".... | EXACT TITLE in land_use_planning: "Urban planning".
accessibilityactivitiesadministrationadoptedanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescodescommunitiescommunityconsiderationscreatingdesigndevelopmentdifferentdistributioneconomicengineeringenvironmentalgeographygovernmentsgrowthhealth+45
for land use and the built environment, including air, water, and the infrastructure passing into and out of urban areas, such as transportation, communications, and distribution networks, and their accessibility. Traditionally, urban planning followed a top-down approach in master planning the physical layout of human settlements. The primary concern was the public welfare, which included considerations of efficiency, sanitation, protection and use of the environment, as well as taking account of effects of the master plans on the social and economic activities. Over time, urban planning has adopted a focus on the social and environmental "bottom lines" that focuses on using planning as a tool to improve the health and well-being of people and maintain sustainability standards. In the mid-20th century, urban planning experts such as Jane Jacobs called on urban planners to take resident experiences and needs more into consideration. Urban planning answers questions about how people will live, work, and play in a given area and thus, guides orderly development in urban, suburban and rural areas. Although predominantly concerned with the planning of settlements and communities, urban planners are also responsible for planning the efficient transportation of goods, resources, people, and waste. The distribution of basic necessities such as water and electricity; a sense of inclusion and opportunity for people of all kinds, culture and needs; economic growth or business development; improving health and conserving areas of natural environmental significance that actively contribute to reduction in CO2 emissions as well as protecting heritage structures and built environments. Since most urban planning teams consist of highly educated individuals that work for city governments, recent debates focus on how to involve more community members in city planning processes. Urban planning is an interdisciplinary field that includes civil engineering, architecture, human geography, social science and design sciences. Practitioners of urban planning use research and analysis, strategic thinking, engineering architecture, urban design, public consultation, policy recommendations, implementation and management. It is closely related to the field of urban design and some urban planners provide designs for streets, parks, buildings and other urban areas. Urban planners work with the cognate fields of civil engineering, landscape architecture, architecture, and public administration to achieve strategic, policy and sustainability goals. Early urban planners were often members of these cognate fields though in the 21st century, urban planning is a separate, independent professional discipline. The discipline of urban planning is the broader category that includes different sub-fields such as land-use planning, zoning, economic development, environmental planning, and transportation planning. Creating the plans requires a thorough understanding of penal codes and zonal codes of planning. Another important aspect of urban planning is that projects range from the large-scale planning of new towns and Greenfield projects to the transformation and renewal of existing cities, neighborhoods, and public spaces. Pierre Charles L'Enfant and Lúcio Costa are known for planning new capital cities, while Daniel Burnham's Plan of Chicago, Georges-Eugene Haussmann's renovation of Paris, and the urban renewal projects of Robert Moses exemplify the large-scale reshaping of existing urban environments.
the public welfare, which included considerations of efficiency, sanitation, protection and use of the environment, as well as taking account of effects of the master plans on the social and economic activities. Over time, urban planning has adopted a focus on the social and environmental "bottom lines" that focuses on using planning as a tool to improve the health and well-being of people and maintain sustainability standards. In the mid-20th century, urban planning experts such as Jane Jacobs called on urban planners to take resident experiences and needs more into consideration. Urban planning answers questions about how people will live, work, and play in a given area and thus, guides orderly development in urban, suburban and rural areas. Although predominantly concerned with the planning of settlements and communities, urban planners are also responsible for planning the efficient transportation of goods, resources, people, and waste. The distribution of basic necessities such as water and electricity; a sense of inclusion and opportunity for people of all kinds, culture and needs; economic growth or business development; improving health and conserving areas of natural environmental significance that actively contribute to reduction in CO2 emissions as well as protecting heritage structures and built environments. Since most urban planning teams consist of highly educated individuals that work for city governments, recent debates focus on how to involve more community members in city planning processes. Urban planning is an interdisciplinary field that includes civil engineering, architecture, human geography, social science and design sciences. Practitioners of urban planning use research and analysis, strategic thinking, engineering architecture, urban design, public consultation, policy recommendations, implementation and management. It is closely related to the field of urban design and some urban planners provide designs for streets, parks, buildings and other urban areas. Urban planners work with the cognate fields of civil engineering, landscape architecture, architecture, and public administration to achieve strategic, policy and sustainability goals. Early urban planners were often members of these cognate fields though in the 21st century, urban planning is a separate, independent professional discipline. The discipline of urban planning is the broader category that includes different sub-fields such as land-use planning, zoning, economic development, environmental planning, and transportation planning. Creating the plans requires a thorough understanding of penal codes and zonal codes of planning. Another important aspect of urban planning is that projects range from the large-scale planning of new towns and Greenfield projects to the transformation and renewal of existing cities, neighborhoods, and public spaces. Pierre Charles L'Enfant and Lúcio Costa are known for planning new capital cities, while Daniel Burnham's Plan of Chicago, Georges-Eugene Haussmann's renovation of Paris, and the urban renewal projects of Robert Moses exemplify the large-scale reshaping of existing urban environments.
urban planners provide designs for streets, parks, buildings and other urban areas. Urban planners work with the cognate fields of civil engineering, landscape architecture, architecture, and public administration to achieve strategic, policy and sustainability goals. Early urban planners were often members of these cognate fields though in the 21st century, urban planning is a separate, independent professional discipline. The discipline of urban planning is the broader category that includes different sub-fields such as land-use planning, zoning, economic development, environmental planning, and transportation planning. Creating the plans requires a thorough understanding of penal codes and zonal codes of planning. Another important aspect of urban planning is that projects range from the large-scale planning of new towns and Greenfield projects to the transformation and renewal of existing cities, neighborhoods, and public spaces. Pierre Charles L'Enfant and Lúcio Costa are known for planning new capital cities, while Daniel Burnham's Plan of Chicago, Georges-Eugene Haussmann's renovation of Paris, and the urban renewal projects of Robert Moses exemplify the large-scale reshaping of existing urban environments.
Comprehensive planning
Q1907895 EXACT TITLE 1.000
QID OVERLAP: Q1907895 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (34): "activities", "community", "compatibility", "comprehensive", "current", "development", "document", "establishing", "foundation", "general", "growth", "housing", "important", "individual", "land", "large", "long-term", "master", "neighborhood", "plan".... | EXACT TITLE in arts_culture: "Comprehensive planning". | EXACT TITLE in land_use_planning: "Comprehensive planning".
activitiescommunitycompatibilitycomprehensivecurrentdevelopmentdocumentestablishingfoundationgeneralgrowthhousingimportantindividuallandlargelong-termmasterneighborhoodplanplanningpoliciespolicyprocessprovidepublicpurposesrecreationregionalresulting+4
to guide the growth and land development of their community, for both the current period and the long term. This "serious document" is then the foundation for establishing goals, purposes, zoning and activities allowed on each land parcel to provide compatibility and continuity to the entire region as well as each individual neighborhood.
Comprehensive planning is an ordered process that determines community goals and aspirations in terms of community development. The end product is called a comprehensive plan, also known as a general plan, or master plan. This resulting document expresses and regulates public policies on transportation, utilities, land use, recreation, and housing. Comprehensive plans typically encompass large geographical areas, a broad range of topics, and cover a long-term time horizon. The term comprehensive plan is most often used by urban planners in the United States. Each city and county adopts and updates their plan to guide the growth and land development of their community, for both the current period and the long term. This "serious document" is then the foundation for establishing goals, purposes, zoning and activities allowed on each land parcel to provide compatibility and continuity to the entire region as well as each individual neighborhood.
me horizon. The term comprehensive plan is most often used by urban planners in the United States. Each city and county adopts and updates their plan to guide the growth and land development of their community, for both the current period and the long term. This "serious document" is then the foundation for establishing goals, purposes, zoning and activities allowed on each land parcel to provide compatibility and continuity to the entire region as well as each individual neighborhood.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (12): "agricultural", "association", "boise", "idaho", "land", "local", "metropolitan", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in arts_culture: "Treasure Valley". | EXACT TITLE in land_use_planning: "Treasure Valley".
agriculturalassociationboiseidaholandlocalmetropolitanresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Nampa, Idaho
Q622633 QID OVERLAP 0.930
QID OVERLAP: Q622633 in arts_culture (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "western". | URL->A (2): https://canyoncountyhistory.com/, https://nampaciviccenter.com/.
boisecanyoncollegehomeidahomeaningmeridianmetropolitannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Eagle, Idaho
Q1516870 QID OVERLAP 0.770
QID OVERLAP: Q1516870 in arts_culture (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "population". | URL->A (1): http://www.cityofeagle.org/.
adaboisedowntowneagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in arts_culture (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "population", "private", "streets".
adaboisecapitaldistricthomeidahojurisdictionlargestlocalmetropolitanpopulationprivatestreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
Q1516892 QID OVERLAP 0.700
QID OVERLAP: Q1516892 in arts_culture (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "population", "separate", "street".
adaboisegardengovernmentidahometropolitanmunicipalpopulationseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in arts_culture (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in arts_culture (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population".
adaamongboisecapitalcitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in arts_culture (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in arts_culture (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
212 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP212 edges
🌲 EVERGREEN8 edges
0.650
academicadministrationartscaldwellclassescollegecurriculumdegreeeducationfoundedidahomajorprivateprofessionalprogramssciencestudentsstudiesundergraduate
SHARED TOKENS (19): "academic", "administration", "arts", "caldwell", "classes", "college", "curriculum", "degree", "education", "founded", "idaho", "major", "private", "professional", "programs", "science", "students", "studies", "undergraduate". | URL->A (1): http://www.caldwellfinearts.org/. | EXACT TITLE in arts_culture: "College of Idaho".
0.650
accessagencyculturalestablishedfoundedhistorichistoricalidahomaterialofficeofficialplacespreservationprogrampublicrecordssitesstaff
SHARED TOKENS (18): "access", "agency", "cultural", "established", "founded", "historic", "historical", "idaho", "material", "office", "official", "places", "preservation", "program", "public", "records", "sites", "staff". | URL->A (1): http://www.history.idaho.gov/. | EXACT TITLE in arts_culture: "Idaho State Historical Society".
0.650
americanannualboisecompleteconductcontemporarydesigndevelopmentfrequentlyidaholocalparkperformanceproductionprofessionalstagework
SHARED TOKENS (17): "american", "annual", "boise", "complete", "conduct", "contemporary", "design", "development", "frequently", "idaho", "local", "park", "performance", "production", "professional", "stage", "work". | URL->A (1): http://bctheater.org/. | EXACT TITLE in arts_culture: "Boise Contemporary Theater".
0.650
annualboisebuiltconferencesculturaldowntowneventsidahointeractiveinternationallocalparkperformanceregionalservessmallertechnology
SHARED TOKENS (17): "annual", "boise", "built", "conferences", "cultural", "downtown", "events", "idaho", "interactive", "international", "local", "park", "performance", "regional", "serves", "smaller", "technology". | URL->A (1): http://treefortmusicfest.com/. | EXACT TITLE in arts_culture: "Treefort Music Fest".
0.650
acquisitionactadministrationagencyamericanartscategorycouncilcreatedfederalformfoundationfundinggovernmentgrantshistoricindependentinstitutelibrarymajor
SHARED TOKENS (31): "acquisition", "act", "administration", "agency", "american", "arts", "category", "council", "created", "federal", "form", "foundation", "funding", "government", "grants", "historic", "independent", "institute", "library", "major".... | URL->A (1): https://www.arts.gov/. | EXACT TITLE in arts_culture: "National Endowment for the Arts".
0.650
buildingscommunitycreationdesignmanagementmultiplenonprofitphysicalplacemakingplanningprojectpublicspacespacesstructuresurbanwork
SHARED TOKENS (17): "buildings", "community", "creation", "design", "management", "multiple", "nonprofit", "physical", "placemaking", "planning", "project", "public", "space", "spaces", "structures", "urban", "work". | URL->A (1): https://www.arts.gov/impact/creative-placemaking. | EXACT TITLE in arts_culture: "Placemaking". | EXACT TITLE in land_use_planning: "Placemaking".
0.650
accessboisecapitalconnectscontainscreateddepartmentdowntowngardenhistoricalhistoryidaholandmunicipaloperatedparkparksrecreationriversouth
SHARED TOKENS (23): "access", "boise", "capital", "connects", "contains", "created", "department", "downtown", "garden", "historical", "history", "idaho", "land", "municipal", "operated", "park", "parks", "recreation", "river", "south".... | URL->A (3): http://www.ibhm.org/, https://www.cityofboise.org/departments/parks-and-recreation/parks/julia-davis-park/. | EXACT TITLE in arts_culture: "Julia Davis Park".
0.650
buildingcatalogdocumentsgeneralgovernmentinformationlibraryofficeopenownershippublicrecordsroleservingtitleworks
SHARED TOKENS (16): "building", "catalog", "documents", "general", "government", "information", "library", "office", "open", "ownership", "public", "records", "role", "serving", "title", "works". | URL->A (1): https://www.copyright.gov/. | EXACT TITLE in arts_culture: "United States Copyright Office".
🌿 BRANCH171 edges
0.500
amongapproximatelyboisedivisionestablishedidaholaterofficesoperatesparkproductionprofessionalpublicrepresentedresearchschoolssolestatewidestudentsundergraduate
SHARED TOKENS (21): "among", "approximately", "boise", "division", "established", "idaho", "later", "offices", "operates", "park", "production", "professional", "public", "represented", "research", "schools", "sole", "statewide", "students", "undergraduate".... | EXACT TITLE in land_use_planning: "University of Idaho".
0.500
accessadministrativeaffordablearchitecturalartsbuildingscentercommercialcontainsdevelopmentdistrictdistrictsevenhistorichistoricalhomehousingincreaselargerlegal
SHARED TOKENS (31): "access", "administrative", "affordable", "architectural", "arts", "buildings", "center", "commercial", "contains", "development", "district", "districts", "even", "historic", "historical", "home", "housing", "increase", "larger", "legal".... | EXACT TITLE in arts_culture: "Historic district".
0.500
Cartography ↗ Q42515 EXACT TITLE
designgeographicinformationlandmakingmapmapsmediamodeledmodernobjectivesphysicalpracticalpracticereducesciencestudysystems
SHARED TOKENS (18): "design", "geographic", "information", "land", "making", "map", "maps", "media", "modeled", "modern", "objectives", "physical", "practical", "practice", "reduce", "science", "study", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.500
Land use ↗ Q1165944 EXACT TITLE
activityagriculturalanotherbuiltcategoriescategorychangechangescollectionconversiondatadirectlyenvironmentalimpactlandland-usemajormanagementresourcessignificant
SHARED TOKENS (25): "activity", "agricultural", "another", "built", "categories", "category", "change", "changes", "collection", "conversion", "data", "directly", "environmental", "impact", "land", "land-use", "major", "management", "resources", "significant".... | EXACT TITLE in arts_culture: "Land use". | EXACT TITLE in land_use_planning: "Land use".
0.500
activitiesactivityagenciesaggregatecommunitydistributioneconomicestimatesevenformalgeographicgrowthimportantinformationland-usemetropolitanmodelneedorganizationsplanning
SHARED TOKENS (36): "activities", "activity", "agencies", "aggregate", "community", "distribution", "economic", "estimates", "even", "formal", "geographic", "growth", "important", "information", "land-use", "metropolitan", "model", "need", "organizations", "planning".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
academicanalysisanotherapplicationsbroaderbusinesscoordinatesdataengineeringfoundationgeographicgeographyindexinformationinstitutionalinsuranceintegratedknowledgemanagementmultiple
SHARED TOKENS (37): "academic", "analysis", "another", "applications", "broader", "business", "coordinates", "data", "engineering", "foundation", "geographic", "geography", "index", "information", "institutional", "insurance", "integrated", "knowledge", "management", "multiple".... | EXACT TITLE in arts_culture: "Geographic information system". | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
americanamongassociationconservationcurrentdescriptionestablishedindividualinstitutionalinstitutionslargestmaterialsmeetingsorganizationpreservationprofessionalprogramsrealservesserving
SHARED TOKENS (21): "american", "among", "association", "conservation", "current", "description", "established", "individual", "institutional", "institutions", "largest", "materials", "meetings", "organization", "preservation", "professional", "programs", "real", "serves", "serving".... | EXACT TITLE in arts_culture: "Society of American Archivists".
0.500
Library ↗ Q7075 EXACT TITLE
academicaccessapplicablebeyondbuildingbuildingscollaborationcollectioncommercialcommunitycorporationcreationdifferentfacilitiesgeneralgovernmentgrouphomeindividualinformation
SHARED TOKENS (43): "academic", "access", "applicable", "beyond", "building", "buildings", "collaboration", "collection", "commercial", "community", "corporation", "creation", "different", "facilities", "general", "government", "group", "home", "individual", "information".... | EXACT TITLE in arts_culture: "Library". | EXACT TITLE in land_use_planning: "Library".
0.500
Archive ↗ Q166118 EXACT TITLE
accessactactivitiesadministrativearchivebuildingscommercialcoursecreatedculturaldistinctdocumentsfunctionfunctionsgenerallyhistoricalhistoryindividualinformationlegal
SHARED TOKENS (39): "access", "act", "activities", "administrative", "archive", "buildings", "commercial", "course", "created", "cultural", "distinct", "documents", "function", "functions", "generally", "historical", "history", "individual", "information", "legal".... | EXACT TITLE in arts_culture: "Archive". | EXACT TITLE in land_use_planning: "Archive".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalbecomecapacitycentralchangecitiesclimatecontainscycledistributionenvironmentalformformationindustrialinfluencelandlargestmajormovementmultiple
SHARED TOKENS (39): "agricultural", "become", "capacity", "central", "change", "cities", "climate", "contains", "cycle", "distribution", "environmental", "form", "formation", "industrial", "influence", "land", "largest", "major", "movement", "multiple".... | EXACT TITLE in land_use_planning: "Groundwater".
0.500
academicsactadministeredagencyapplicationbecomebuildingbuildingscriteriadepartmentdistrictdistrictsestablishedfederalfinancialgeneralgovernmenthistorichistoricalhistory
SHARED TOKENS (50): "academics", "act", "administered", "agency", "application", "become", "building", "buildings", "criteria", "department", "district", "districts", "established", "federal", "financial", "general", "government", "historic", "historical", "history".... | EXACT TITLE in arts_culture: "National Register of Historic Places".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowingbuildingbuildingscombinedeterminedevelopmentdifferentformgoverngovernmentgovernmentsgrowthindustriallandland-uselocalplacesplanningpolicy
SHARED TOKENS (33): "activities", "allowing", "building", "buildings", "combine", "determine", "development", "different", "form", "govern", "government", "governments", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy".... | EXACT TITLE in arts_culture: "Zoning". | EXACT TITLE in land_use_planning: "Zoning".
0.500
Public art ↗ Q557141 EXACT TITLE
commercialcreatedcreationdirectformfunctiongeneralindependentmeaningmediaofficialoutsideprivateprocessprofessionalpropertypublicratherspacespaces
SHARED TOKENS (23): "commercial", "created", "creation", "direct", "form", "function", "general", "independent", "meaning", "media", "official", "outside", "private", "process", "professional", "property", "public", "rather", "space", "spaces".... | EXACT TITLE in arts_culture: "Public art".
0.500
amongbuildingbuildingscollectioncommercialconnectionsdistincteconomiceducationevidencefunctionshistoricimportantinstitutionsmaintainmodernnetworknonprofitobjectsoperated
SHARED TOKENS (34): "among", "building", "buildings", "collection", "commercial", "connections", "distinct", "economic", "education", "evidence", "functions", "historic", "important", "institutions", "maintain", "modern", "network", "nonprofit", "objects", "operated".... | EXACT TITLE in arts_culture: "Art gallery".
0.500
actagencyappliedbecomebuiltbureaudepartmentdevelopmentestablishedfederalfundinggovernmentlargestlawmanagementmillionoperationpowerprogramprojects
SHARED TOKENS (28): "act", "agency", "applied", "become", "built", "bureau", "department", "development", "established", "federal", "funding", "government", "largest", "law", "management", "million", "operation", "power", "program", "projects".... | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
0.500
cannotcollectiondatadifferenteventsformfuturegeneralhistoricalhistoryimportantinformationknowledgelargeprofessionalrecordsourcesstudywhosework
SHARED TOKENS (20): "cannot", "collection", "data", "different", "events", "form", "future", "general", "historical", "history", "important", "information", "knowledge", "large", "professional", "record", "sources", "study", "whose", "work". | EXACT TITLE in arts_culture: "Oral history".
0.500
activitiesadministrativebroadercitiescomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindividualindustrialinfrastructurelandland-uselargermanagementnationalnetworkplacement
SHARED TOKENS (38): "activities", "administrative", "broader", "cities", "comprehensive", "covering", "development", "economic", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "management", "national", "network", "placement".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
accessagencieschangeclimatecommunitycomponentsconditionscontemporarycreatedculturaldevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentalfacilities
SHARED TOKENS (53): "access", "agencies", "change", "climate", "community", "components", "conditions", "contemporary", "created", "cultural", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environmental", "facilities".... | EXACT TITLE in arts_culture: "Infrastructure". | EXACT TITLE in land_use_planning: "Infrastructure".
0.500
actagenciesamericanapplyboundarycontrolculturaldepartmentdiscoverydispositionestablishfederalfundinggrantsimplementationincreaseinstitutionsknowledgelawmajor
SHARED TOKENS (36): "act", "agencies", "american", "apply", "boundary", "control", "cultural", "department", "discovery", "disposition", "establish", "federal", "funding", "grants", "implementation", "increase", "institutions", "knowledge", "law", "major".... | EXACT TITLE in arts_culture: "Native American Graves Protection and Repatriation Act".
0.500
agenciesagencyanalysisannualapproximatelybureaucorporatedatadepartmenteconomiceconomyfederalgovernmentinformationmillionnationalofficialprincipalprovidesystem
SHARED TOKENS (20): "agencies", "agency", "analysis", "annual", "approximately", "bureau", "corporate", "data", "department", "economic", "economy", "federal", "government", "information", "million", "national", "official", "principal", "provide", "system". | EXACT TITLE in arts_culture: "Bureau of Economic Analysis".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomicenvironmentalgenerallygrowthincreaseinternationallocalmarketsorganizationorganizationsoutsideplacesprograms
SHARED TOKENS (25): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "environmental", "generally", "growth", "increase", "international", "local", "markets", "organization", "organizations", "outside", "places", "programs".... | EXACT TITLE in arts_culture: "Tourism".
0.500
Opera ↗ Q1344 EXACT TITLE
anotherartsbeyondcentralcollaborationcompletecontemporarycreatingdistinctestablishformhouselivemajormediamodernnationalperformancepresentproduced
SHARED TOKENS (28): "another", "arts", "beyond", "central", "collaboration", "complete", "contemporary", "creating", "distinct", "establish", "form", "house", "live", "major", "media", "modern", "national", "performance", "present", "produced".... | EXACT TITLE in arts_culture: "Opera". | EXACT TITLE in land_use_planning: "Opera".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomebodiescitiescreatedemanddirectlyeventsimportantlandlargemajorpopulationreducerelatedresourcetreatmenturbanwater
SHARED TOKENS (18): "become", "bodies", "cities", "create", "demand", "directly", "events", "important", "land", "large", "major", "population", "reduce", "related", "resource", "treatment", "urban", "water". | EXACT TITLE in land_use_planning: "Stormwater".
0.500
activityanalysisanotherassociatedbuildingbuildingscentralchangescitiescontroldesigndevelopmentdifferentembeddedenvironmentalformformationfunctionsgeographyhistoric
SHARED TOKENS (47): "activity", "analysis", "another", "associated", "building", "buildings", "central", "changes", "cities", "control", "design", "development", "different", "embedded", "environmental", "form", "formation", "functions", "geography", "historic".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
artsbuildingsdevelopmentdifferentformfunctionshistoryincreasinglylivenarrativeobjectsopenperformancephysicalpresentprivatereligiousstreettimesvisual
SHARED TOKENS (21): "arts", "buildings", "development", "different", "form", "functions", "history", "increasingly", "live", "narrative", "objects", "open", "performance", "physical", "present", "private", "religious", "street", "times", "visual".... | EXACT TITLE in arts_culture: "Performing arts".
0.500
agenciesarchitectureconditionsconstructioncontroldesignengineeringenvironmentalestategeneralinfrastructurelandscapelicenselicensedlicensesmanagementmasterparksplanningpossess
SHARED TOKENS (32): "agencies", "architecture", "conditions", "construction", "control", "design", "engineering", "environmental", "estate", "general", "infrastructure", "landscape", "license", "licensed", "licenses", "management", "master", "parks", "planning", "possess".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
activeaffectedbusinessescapitalcollaborationcommercialcommunitiescommunityconnectiondevelopmentdevelopsfacilitiesidentifyinstitutionslargemeetingoutsideperformancephysicalplaces
SHARED TOKENS (31): "active", "affected", "businesses", "capital", "collaboration", "commercial", "communities", "community", "connection", "development", "develops", "facilities", "identify", "institutions", "large", "meeting", "outside", "performance", "physical", "places".... | EXACT TITLE in arts_culture: "Community theatre".
0.500
actamericanapplicableappliedassociationauthoritycentralchangechangescitiescommunitiescommunitycomparablecomprehensiveconditionsconflictsconservationcostscreatingdepend
SHARED TOKENS (56): "act", "american", "applicable", "applied", "association", "authority", "central", "change", "changes", "cities", "communities", "community", "comparable", "comprehensive", "conditions", "conflicts", "conservation", "costs", "creating", "depend".... | EXACT TITLE in land_use_planning: "Land-use planning".
0.500
Downtown ↗ Q1050303 EXACT TITLE
americanbusinesscentercentralcommercialculturaldistrictdowntownemploymentgeographichistoricalofficepopulationpublicsmallertransit
SHARED TOKENS (16): "american", "business", "center", "central", "commercial", "cultural", "district", "downtown", "employment", "geographic", "historical", "office", "population", "public", "smaller", "transit". | EXACT TITLE in arts_culture: "Downtown". | EXACT TITLE in land_use_planning: "Downtown".
0.500
communitydescribesdevelopmenteconomiceconomicsfocusedfrequentlygrowthincreasinglyindividualinfrastructurelocalmarketobjectivespoliciespolicyprocessquality
SHARED TOKENS (18): "community", "describes", "development", "economic", "economics", "focused", "frequently", "growth", "increasingly", "individual", "infrastructure", "local", "market", "objectives", "policies", "policy", "process", "quality". | EXACT TITLE in arts_culture: "Economic development". | EXACT TITLE in land_use_planning: "Economic development".
0.500
americancapacitycapitalcitiescombineconnectingconventionalcostdesigndesignedfullyintegratelargestmillionnetworkpublicqualityrapidreducesingle
SHARED TOKENS (25): "american", "capacity", "capital", "cities", "combine", "connecting", "conventional", "cost", "design", "designed", "fully", "integrate", "largest", "million", "network", "public", "quality", "rapid", "reduce", "single".... | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.500
actagenciescannotcreatecreatedfederalfunctiongovernmentgovernmentshistorichistoricalimpactlawlocalnationalofficeofficersorganizationsplacespreservation
SHARED TOKENS (28): "act", "agencies", "cannot", "create", "created", "federal", "function", "government", "governments", "historic", "historical", "impact", "law", "local", "national", "office", "officers", "organizations", "places", "preservation".... | EXACT TITLE in arts_culture: "State Historic Preservation Office".
0.500
activitiesagenciesagriculturalconversiondesigneddevelopmentdifferentdistrictseducationestablishingfuturegovernmentgovernmentshistoricjointlandlocalnationaloperatedoperational
SHARED TOKENS (35): "activities", "agencies", "agricultural", "conversion", "designed", "development", "different", "districts", "education", "establishing", "future", "government", "governments", "historic", "joint", "land", "local", "national", "operated", "operational".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
americanboisebrandconsumercreateddatademandfoundedidaholatestmajormarketmemorymultinationalproducedproductssouthtechnology
SHARED TOKENS (18): "american", "boise", "brand", "consumer", "created", "data", "demand", "founded", "idaho", "latest", "major", "market", "memory", "multinational", "produced", "products", "south", "technology". | EXACT TITLE in land_use_planning: "Micron Technology".
0.500
Orchestra ↗ Q42998 EXACT TITLE
alonecombinescommunitydifferentimportantlargelatermodernperformancepublicroleschoolshortsizesmallerstagestudentsuniversitywesternwork
SHARED TOKENS (21): "alone", "combines", "community", "different", "important", "large", "later", "modern", "performance", "public", "role", "school", "short", "size", "smaller", "stage", "students", "university", "western", "work".... | EXACT TITLE in arts_culture: "Orchestra".
0.500
americanassociationconnectionscorporatedesignersdevelopmentfoundedhistorichistoryindividualinstituteinstitutionsknowledgelibraryneedofficersorganizationprofessionalspublicrepresented
SHARED TOKENS (28): "american", "association", "connections", "corporate", "designers", "development", "founded", "historic", "history", "individual", "institute", "institutions", "knowledge", "library", "need", "officers", "organization", "professionals", "public", "represented".... | EXACT TITLE in arts_culture: "American Alliance of Museums".
0.500
analysisappliedcurrentdatadesigndifferentengineeringformformalgeographiclargeplacementpropertiesresearchscalestructuresstudiesstudyurban
SHARED TOKENS (19): "analysis", "applied", "current", "data", "design", "different", "engineering", "form", "formal", "geographic", "large", "placement", "properties", "research", "scale", "structures", "studies", "study", "urban". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.500
Theatre ↗ Q11635 EXACT TITLE
artsbuildingsdefinesdevelopmentdistincteventexperienceformgeneralgrouplargelightinglivemeasuremodernplacespresentproducesrealspecific
SHARED TOKENS (24): "arts", "buildings", "defines", "development", "distinct", "event", "experience", "form", "general", "group", "large", "lighting", "live", "measure", "modern", "places", "present", "produces", "real", "specific".... | EXACT TITLE in arts_culture: "Theatre".
0.500
academicaccessamongcollectiondistinctformationfundedgeneralinformationlearninglibrarymaterialsopenoperatedoutsidepopulationprofessionalsprovidepublicrather
SHARED TOKENS (28): "academic", "access", "among", "collection", "distinct", "formation", "funded", "general", "information", "learning", "library", "materials", "open", "operated", "outside", "population", "professionals", "provide", "public", "rather".... | EXACT TITLE in arts_culture: "Public library".
0.500
Jazz ↗ Q8341 EXACT TITLE
commercialcommunitiesdifferentearlierformformallocalmajornationalregionalscalesignificantsinglestagestructurestructurestoward
SHARED TOKENS (17): "commercial", "communities", "different", "earlier", "form", "formal", "local", "major", "national", "regional", "scale", "significant", "single", "stage", "structure", "structures", "toward". | EXACT TITLE in arts_culture: "Jazz".
0.500
Urban design ↗ Q63100 EXACT TITLE
architecturebuildingscitiescommunityconnectdependentdesigndesignerseconomicenvironmentalhistoricalimpactimportantinterdisciplinarylandscapelocalpagephysicalplanningprocesses
SHARED TOKENS (32): "architecture", "buildings", "cities", "community", "connect", "dependent", "design", "designers", "economic", "environmental", "historical", "impact", "important", "interdisciplinary", "landscape", "local", "page", "physical", "planning", "processes".... | EXACT TITLE in land_use_planning: "Urban design".
0.500
accessibilityagenciesagencyamericanbureaubusinessesconditionscoordinationcriteriacurrentdatadepartmenteconomiceconomicsfederalgovernmentgovernmentslocalmaintainmajor
SHARED TOKENS (32): "accessibility", "agencies", "agency", "american", "bureau", "businesses", "conditions", "coordination", "criteria", "current", "data", "department", "economic", "economics", "federal", "government", "governments", "local", "maintain", "major".... | EXACT TITLE in arts_culture: "Bureau of Labor Statistics".
0.500
administrationadministrativeagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentgrantslocalmaintainofficeofficesoperatorsprogramsproviderspublic
SHARED TOKENS (28): "administration", "administrative", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "grants", "local", "maintain", "office", "offices", "operators", "programs", "providers", "public".... | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
administrationagenciesagencyapplicationcoordinatesdesigneddevelopmentdistributedenvironmentalfederalfoundationfundedgrantslandmetropolitannationalopenorgplanningplatforms
SHARED TOKENS (32): "administration", "agencies", "agency", "application", "coordinates", "designed", "development", "distributed", "environmental", "federal", "foundation", "funded", "grants", "land", "metropolitan", "national", "open", "org", "planning", "platforms".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
activitiesarchitectureartsbecomeculturaldependdesigndevelopmentdifferenteconomiceconomyeducationfocusedimportantincreasinglyinformationknowledgeprivateprotectionpublic
SHARED TOKENS (23): "activities", "architecture", "arts", "become", "cultural", "depend", "design", "development", "different", "economic", "economy", "education", "focused", "important", "increasingly", "information", "knowledge", "private", "protection", "public".... | EXACT TITLE in arts_culture: "Creative industries".
0.500
americanartscentercollegedesigndesignedfaithformmastermediametropolitannarrativeperformancepublicresearchschoolsystemworkworks
SHARED TOKENS (19): "american", "arts", "center", "college", "design", "designed", "faith", "form", "master", "media", "metropolitan", "narrative", "performance", "public", "research", "school", "system", "work", "works". | EXACT TITLE in arts_culture: "Faith Ringgold".
0.500
actagenciesamongbuildingscreateddecemberfederalfederallyfundedhistoricimpactlawnationalofficespdfpermittedplacespresentpreservationpreserve
SHARED TOKENS (28): "act", "agencies", "among", "buildings", "created", "december", "federal", "federally", "funded", "historic", "impact", "law", "national", "offices", "pdf", "permitted", "places", "present", "preservation", "preserve".... | EXACT TITLE in arts_culture: "National Historic Preservation Act".
0.500
Wetland ↗ Q170321 EXACT TITLE
actamongbuildingchangeclimateconservationcontroldifferentdistinctenvironmentalformfunctionfunctionshealthidentifyinfrastructureinternationallargestprocessprocesses
SHARED TOKENS (34): "act", "among", "building", "change", "climate", "conservation", "control", "different", "distinct", "environmental", "form", "function", "functions", "health", "identify", "infrastructure", "international", "largest", "process", "processes".... | EXACT TITLE in land_use_planning: "Wetland".
0.500
administrationadministrativeartsassociationboisebuildingcentercollectioncontemporaryculturaldevelopmentfederalfunctionshomeidaholargerlargestlivinglocalmajor
SHARED TOKENS (30): "administration", "administrative", "arts", "association", "boise", "building", "center", "collection", "contemporary", "cultural", "development", "federal", "functions", "home", "idaho", "larger", "largest", "living", "local", "major".... | EXACT TITLE in arts_culture: "Boise Art Museum".
0.500
applicationsassociatedbeyondconnectionsdatadescriptionsdevelopmenteventsgraphincreasinglyknowledgelearninglinkedmodelnetworksobjectsopenprojectsrelationshipsresearch
SHARED TOKENS (24): "applications", "associated", "beyond", "connections", "data", "descriptions", "development", "events", "graph", "increasingly", "knowledge", "learning", "linked", "model", "networks", "objects", "open", "projects", "relationships", "research".... | EXACT TITLE in arts_culture: "Knowledge graph". | EXACT TITLE in land_use_planning: "Knowledge graph".
0.500
actagenciesagencyagriculturalassistancebroaderconservationdepartmentinvestmentlocalpartnershipprivateprogramsprojectprotectqualityresourcessupportedtechnicalwater
SHARED TOKENS (20): "act", "agencies", "agency", "agricultural", "assistance", "broader", "conservation", "department", "investment", "local", "partnership", "private", "programs", "project", "protect", "quality", "resources", "supported", "technical", "water". | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
administrativeagencyappliedblockbuildingcommercialconnectionsconstructionculturaldegreedesigndevelopmentfunctionsinstitutionalintegratedmultipleneighborhoodplanningpolicyprivate
SHARED TOKENS (29): "administrative", "agency", "applied", "block", "building", "commercial", "connections", "construction", "cultural", "degree", "design", "development", "functions", "institutional", "integrated", "multiple", "neighborhood", "planning", "policy", "private".... | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
categorycommercialcompetitiveestablishedeventfoundationinternationallargestmajororiginalproductionreleaseselectedshortshowsinglespecific
SHARED TOKENS (17): "category", "commercial", "competitive", "established", "event", "foundation", "international", "largest", "major", "original", "production", "release", "selected", "short", "show", "single", "specific". | EXACT TITLE in arts_culture: "Film festival".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscomponentsconstructiondevelopmentengineeringestablishgovernmenthistoryimportantlandlawlegalmapsownershipplanningprofessionalpropertypurposesresearchscience
SHARED TOKENS (25): "analysis", "components", "construction", "development", "engineering", "establish", "government", "history", "important", "land", "law", "legal", "maps", "ownership", "planning", "professional", "property", "purposes", "research", "science".... | EXACT TITLE in land_use_planning: "Surveying".
0.500
Humanities ↗ Q80083 EXACT TITLE
academicanalysisappliedartsciviccourseculturalcurriculumemphasizingformalfrequentlygeneralhistoricalhistoryindividuallearningmeaningnarrativeobjectivesoutside
SHARED TOKENS (32): "academic", "analysis", "applied", "arts", "civic", "course", "cultural", "curriculum", "emphasizing", "formal", "frequently", "general", "historical", "history", "individual", "learning", "meaning", "narrative", "objectives", "outside".... | EXACT TITLE in arts_culture: "Humanities".
0.500
Festival ↗ Q132241 EXACT TITLE
amongassociatedcommunitiescommunityconnectioncreatingculturaleventexperiencegivingimportantintegratedlocalmeansnationalpracticeprovidepurposesreligiousresource
SHARED TOKENS (22): "among", "associated", "communities", "community", "connection", "creating", "cultural", "event", "experience", "giving", "important", "integrated", "local", "means", "national", "practice", "provide", "purposes", "religious", "resource".... | EXACT TITLE in arts_culture: "Festival".
0.500
Archaeology ↗ Q23498 EXACT TITLE
academicactivityanalysisarchitecturebecomechangescreateculturaldatadevelopmentdifferentdistinctgeographyhistoryimportantindependentlearningmaterialmaterialsmeans
SHARED TOKENS (31): "academic", "activity", "analysis", "architecture", "become", "changes", "create", "cultural", "data", "development", "different", "distinct", "geography", "history", "important", "independent", "learning", "material", "materials", "means".... | EXACT TITLE in arts_culture: "Archaeology".
0.500
Annexation ↗ EXACT TITLE
acquisitionactanotherbodiescontrolcurrentdescribesdistinctgenerallyinternationallawlegalmeansphysicalsciencetitle
SHARED TOKENS (16): "acquisition", "act", "another", "bodies", "control", "current", "describes", "distinct", "generally", "international", "law", "legal", "means", "physical", "science", "title". | EXACT TITLE in land_use_planning: "Annexation".
0.500
actagenciesagencyapplyauthoritycouncilcreateddecemberdecisionsdesignedenvironmentalestablishedfederalfinalgovernmentimpactlawmodelednationalpolicies
SHARED TOKENS (30): "act", "agencies", "agency", "apply", "authority", "council", "created", "december", "decisions", "designed", "environmental", "established", "federal", "final", "government", "impact", "law", "modeled", "national", "policies".... | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
0.500
actaddressingadministeredagencyassistancechangesconservationcontrolcoordinationdirectlyengineersenvironmentalfederalformfundinggoverninggovernmentslawmaintainmajor
SHARED TOKENS (31): "act", "addressing", "administered", "agency", "assistance", "changes", "conservation", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "governments", "law", "maintain", "major".... | EXACT TITLE in land_use_planning: "Clean Water Act".
0.500
adoptedappliedapplyauthoritybodiesbuildingbuildingscodecodescomplianceconstructioncontrolcouncildepartmentsdesigndesignersdevelopersdistrictelectricalengineers
SHARED TOKENS (53): "adopted", "applied", "apply", "authority", "bodies", "building", "buildings", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "designers", "developers", "district", "electrical", "engineers".... | EXACT TITLE in land_use_planning: "Building code".
0.500
actadministeredadministrationagencyassistancebuildingscommunitiescommunityconstructioncontrolcostcostscreatedcreatingdecemberdesigneddevelopmentemergencyenforcementfederal
SHARED TOKENS (44): "act", "administered", "administration", "agency", "assistance", "buildings", "communities", "community", "construction", "control", "cost", "costs", "created", "creating", "december", "designed", "development", "emergency", "enforcement", "federal".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
Museum ↗ Q33506 EXACT TITLE
artsassociatedhistoryinteractivelargelaterlocalobjectsoutsidepreservationpreservingprivatepublicsciencesignificantspecialiststimes
SHARED TOKENS (17): "arts", "associated", "history", "interactive", "large", "later", "local", "objects", "outside", "preservation", "preserving", "private", "public", "science", "significant", "specialists", "times". | EXACT TITLE in arts_culture: "Museum".
0.500
affordabilityaffordableassociateddemandeconomicemergencyformalgenerallygovernmenthomehousingindexinformallocalmarketsnationalownershiprentalsupply
SHARED TOKENS (19): "affordability", "affordable", "associated", "demand", "economic", "emergency", "formal", "generally", "government", "home", "housing", "index", "informal", "local", "markets", "national", "ownership", "rental", "supply". | EXACT TITLE in land_use_planning: "Affordable housing".
0.500
actagencycoveringcreateddepartmentdesignationsdistrictfederalhistoricalmakingmanagementmillionnationalparkparksplacespreservingpropertiespublicthem
SHARED TOKENS (22): "act", "agency", "covering", "created", "department", "designations", "district", "federal", "historical", "making", "management", "million", "national", "park", "parks", "places", "preserving", "properties", "public", "them".... | EXACT TITLE in arts_culture: "National Park Service".
0.500
agencybecomechangecommunitiescommunitycreatingdesigndevelopmentenvironmentaleventsgeographyhistoricalhistorylocalmakingmeaningplacesplanningpowersignificant
SHARED TOKENS (23): "agency", "become", "change", "communities", "community", "creating", "design", "development", "environmental", "events", "geography", "historical", "history", "local", "making", "meaning", "places", "planning", "power", "significant".... | EXACT TITLE in arts_culture: "Place identity".
0.500
actagencyartscentereducationestablishedfederalfoundationgovernmentindependentnationalofficepreservationprogramspublicresearchsupporting
SHARED TOKENS (17): "act", "agency", "arts", "center", "education", "established", "federal", "foundation", "government", "independent", "national", "office", "preservation", "programs", "public", "research", "supporting". | EXACT TITLE in arts_culture: "National Endowment for the Humanities".
0.500
Art museum ↗ Q207694 EXACT TITLE
activitiesartsbuildingbuildingscollectionculturalfrequentlyorganizationownershipperformanceprivatepublicrestrictionsspacespacesvisual
SHARED TOKENS (16): "activities", "arts", "building", "buildings", "collection", "cultural", "frequently", "organization", "ownership", "performance", "private", "public", "restrictions", "space", "spaces", "visual". | EXACT TITLE in arts_culture: "Art museum".
0.500
Plat ↗ Q831939 EXACT TITLE
anotherbecomeblockcommissiondepartmentdescriptionsgeneralgoverningindividualinformationlandlegallegallylocalmapofficeplanningpublicratherreview
SHARED TOKENS (28): "another", "become", "block", "commission", "department", "descriptions", "general", "governing", "individual", "information", "land", "legal", "legally", "local", "map", "office", "planning", "public", "rather", "review".... | EXACT TITLE in arts_culture: "Plat". | EXACT TITLE in land_use_planning: "Plat".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalapplicationappliescentralchangescollectionconditionsconsolidationcontrolcontrolleddirectlydistributeddistributionenvironmentalformgrowthlandlandscapemaintainmanagement
SHARED TOKENS (41): "agricultural", "application", "applies", "central", "changes", "collection", "conditions", "consolidation", "control", "controlled", "directly", "distributed", "distribution", "environmental", "form", "growth", "land", "landscape", "maintain", "management".... | EXACT TITLE in land_use_planning: "Irrigation".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcasescontrolcreatecurrentdestinationgenerallyincreasemanagementmodernrequiringresourcesriversourcessupplyvalleywater
SHARED TOKENS (18): "building", "built", "cases", "control", "create", "current", "destination", "generally", "increase", "management", "modern", "requiring", "resources", "river", "sources", "supply", "valley", "water". | EXACT TITLE in land_use_planning: "Canal".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisarrangementbuildingbuildingscodesconditionsconsiderationsconstructioncontractorcountiescreatingdependentdesigndevelopmentengineersfacilitiesgardenhistoricalinfrastructureland
SHARED TOKENS (45): "analysis", "arrangement", "building", "buildings", "codes", "conditions", "considerations", "construction", "contractor", "counties", "creating", "dependent", "design", "development", "engineers", "facilities", "garden", "historical", "infrastructure", "land".... | EXACT TITLE in land_use_planning: "Site plan".
0.500
activitiesagriculturalannualapprovalcollectioncommissioncontrolleddevelopmentevengenerallylandmeansorganizationpermittedpresentproductionpurposesrequirerequiresrequiring
SHARED TOKENS (21): "activities", "agricultural", "annual", "approval", "collection", "commission", "controlled", "development", "even", "generally", "land", "means", "organization", "permitted", "present", "production", "purposes", "require", "requires", "requiring".... | EXACT TITLE in land_use_planning: "Agricultural land".
0.500
agenciesbuildingsbuiltcomponentsconstructiondepartmentsdesignengineeringfirmsfocusedgovernmentinfrastructurelocallymunicipalnationalphysicalpipelinesprivateprofessionalpublic
SHARED TOKENS (23): "agencies", "buildings", "built", "components", "construction", "departments", "design", "engineering", "firms", "focused", "government", "infrastructure", "locally", "municipal", "national", "physical", "pipelines", "private", "professional", "public".... | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
businesscommunityconstraintentityfaithlocalmeaningnonprofitoperatedoperatesoperationsorganizationorganizationsownersprivateprogrampublicratherreceiverecipients
SHARED TOKENS (24): "business", "community", "constraint", "entity", "faith", "local", "meaning", "nonprofit", "operated", "operates", "operations", "organization", "organizations", "owners", "private", "program", "public", "rather", "receive", "recipients".... | EXACT TITLE in arts_culture: "Nonprofit organization".
0.500
Light rail ↗ Q1268865 EXACT TITLE
broadercapacityconditionsdifferentequivalentformfullyindividualmeaningmultiplenetworksoperatesoperatingoperationsrapidright-of-wayrights-of-waystreetssystemsystems
SHARED TOKENS (26): "broader", "capacity", "conditions", "different", "equivalent", "form", "fully", "individual", "meaning", "multiple", "networks", "operates", "operating", "operations", "rapid", "right-of-way", "rights-of-way", "streets", "system", "systems".... | EXACT TITLE in land_use_planning: "Light rail".
0.500
administrationartscommunityculturaldevelopmentevaluationlong-termmanagementoperationsorganizationsplanplanningpresentprofessionalprogrampublicsmallerstaff
SHARED TOKENS (18): "administration", "arts", "community", "cultural", "development", "evaluation", "long-term", "management", "operations", "organizations", "plan", "planning", "present", "professional", "program", "public", "smaller", "staff". | EXACT TITLE in arts_culture: "Arts administration".
0.500
adaagencyboisecanyonidahometropolitanoperatesoperatorpublicregionalroutesschoolservingtransittreasurevalley
SHARED TOKENS (16): "ada", "agency", "boise", "canyon", "idaho", "metropolitan", "operates", "operator", "public", "regional", "routes", "school", "serving", "transit", "treasure", "valley". | EXACT TITLE in arts_culture: "Valley Regional Transit".
0.500
affectbecomebuildingsculturaldesignexperiencefeesgeneralgenerallygeographygovernmentlandscapelargerlegallimitsopenownersownershipparksparticipation
SHARED TOKENS (34): "affect", "become", "buildings", "cultural", "design", "experience", "fees", "general", "generally", "geography", "government", "landscape", "larger", "legal", "limits", "open", "owners", "ownership", "parks", "participation".... | EXACT TITLE in arts_culture: "Public space". | EXACT TITLE in land_use_planning: "Public space".
0.500
agenciesapplybusinessescomprehensivedesignevaluationfacilitiesfuturegenerallygovernmentinfluencemovementplanningpoliciesprepareprivateprocesspublicsitingstreets
SHARED TOKENS (22): "agencies", "apply", "businesses", "comprehensive", "design", "evaluation", "facilities", "future", "generally", "government", "influence", "movement", "planning", "policies", "prepare", "private", "process", "public", "siting", "streets".... | EXACT TITLE in land_use_planning: "Transportation planning".
0.500
authoritybuildingbuildingsbusinesscapitalcombinecommercialestatefunctionshousinginvestmentlandlocalmaintainmultipleofficeofficespropertypurposesreal
SHARED TOKENS (30): "authority", "building", "buildings", "business", "capital", "combine", "commercial", "estate", "functions", "housing", "investment", "land", "local", "maintain", "multiple", "office", "offices", "property", "purposes", "real".... | EXACT TITLE in arts_culture: "Commercial property".
0.490
boisecenterculturalfocusedfoundedhistoryidaho
SHARED TOKENS (7): "boise", "center", "cultural", "focused", "founded", "history", "idaho". | URL->A (1): https://basquemuseum.eus/. | EXACT TITLE in arts_culture: "Basque Museum and Cultural Center".
0.480
agenciescoordinatescouncildevelopmentdivisionenvironmentalfederalhouseofficeofficespoliciespolicyqualityworks
SHARED TOKENS (14): "agencies", "coordinates", "council", "development", "division", "environmental", "federal", "house", "office", "offices", "policies", "policy", "quality", "works". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.480
Aquifer ↗ Q208791 EXACT TITLE
beyondformationhomeindustriallandlayermajormaterialmaterialspresentpurposesrelatedstudywater
SHARED TOKENS (14): "beyond", "formation", "home", "industrial", "land", "layer", "major", "material", "materials", "present", "purposes", "related", "study", "water". | EXACT TITLE in land_use_planning: "Aquifer".
0.480
communitycontemporarycreatedculturalgenerallylargermaterialsmodernnationalpresentresultingspecialiststhemwork
SHARED TOKENS (14): "community", "contemporary", "created", "cultural", "generally", "larger", "materials", "modern", "national", "present", "resulting", "specialists", "them", "work". | EXACT TITLE in arts_culture: "Contemporary art".
0.480
Anthropology ↗ Q23404 EXACT TITLE
activityculturalgenerallyhistoryindependentmeaningpatternsphysicalpresentrelatedremainsstudiesstudyvalues
SHARED TOKENS (14): "activity", "cultural", "generally", "history", "independent", "meaning", "patterns", "physical", "present", "related", "remains", "studies", "study", "values". | EXACT TITLE in arts_culture: "Anthropology".
0.460
businesschangeformgovernmentincreaselong-termmaterialpresentprivatepublicqualityratherreligious
SHARED TOKENS (13): "business", "change", "form", "government", "increase", "long-term", "material", "present", "private", "public", "quality", "rather", "religious". | EXACT TITLE in arts_culture: "Philanthropy".
0.460
Visual arts ↗ Q36649 EXACT TITLE
appliedarchitectureartscurrentdegreedesignindustrialmediamovementpractitionerschoolsvisualwestern
SHARED TOKENS (13): "applied", "architecture", "arts", "current", "degree", "design", "industrial", "media", "movement", "practitioner", "schools", "visual", "western". | EXACT TITLE in arts_culture: "Visual arts".
0.460
commercialcommunitiesdevelopersdevelopmenthousingindependentlyindustriallandlargeparksretailsinglesmaller
SHARED TOKENS (13): "commercial", "communities", "developers", "development", "housing", "independently", "industrial", "land", "large", "parks", "retail", "single", "smaller". | EXACT TITLE in land_use_planning: "Subdivision (land)".
0.440
activitycategoriescontinuingcreatedculturaldesignedgeographylandscapepropertiesreligiousstudiesworks
SHARED TOKENS (12): "activity", "categories", "continuing", "created", "cultural", "designed", "geography", "landscape", "properties", "religious", "studies", "works". | EXACT TITLE in land_use_planning: "Cultural landscape".
0.440
agencydepartmentfederalfundingfutureidahoinfrastructureoperationsorganizationplanningprogramstransportation
SHARED TOKENS (12): "agency", "department", "federal", "funding", "future", "idaho", "infrastructure", "operations", "organization", "planning", "programs", "transportation". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.440
buildingsbuiltcitiesconservationdevelopmenthistorichistoricalobjectspreservationpreserveproductsprotect
SHARED TOKENS (12): "buildings", "built", "cities", "conservation", "development", "historic", "historical", "objects", "preservation", "preserve", "products", "protect". | EXACT TITLE in arts_culture: "Historic preservation".
0.440
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommunityindustrialmunicipalprocessesproducedwastewaterwater
SHARED TOKENS (12): "activities", "agricultural", "another", "applications", "commercial", "community", "industrial", "municipal", "processes", "produced", "wastewater", "water". | EXACT TITLE in arts_culture: "Wastewater". | EXACT TITLE in land_use_planning: "Wastewater".
0.440
applicablefederalgovernmentslawprivateprocesspropertyprovideregulationsregulatoryrightsvalue
SHARED TOKENS (12): "applicable", "federal", "governments", "law", "private", "process", "property", "provide", "regulations", "regulatory", "rights", "value". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.440
administrativeappliesbuildingcodedevelopmentlandmunicipalordinanceregulationsrulesstandardszoning
SHARED TOKENS (12): "administrative", "applies", "building", "code", "development", "land", "municipal", "ordinance", "regulations", "rules", "standards", "zoning". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.430
americanboisehistoryidaho
SHARED TOKENS (4): "american", "boise", "history", "idaho". | URL->A (1): https://www.ibhm.org/. | EXACT TITLE in arts_culture: "Idaho Black History Museum".
0.400
Ballet ↗ Q41425 EXACT TITLE
becomedistinctformlatermodernperformanceproductionschoolstechnicalwork
SHARED TOKENS (10): "become", "distinct", "form", "later", "modern", "performance", "production", "schools", "technical", "work". | EXACT TITLE in arts_culture: "Ballet".
0.400
Floodplain ↗ Q193110 EXACT TITLE
agriculturalcontrolexperiencefrequentlyimportantlandriverurbanvalleywater
SHARED TOKENS (10): "agricultural", "control", "experience", "frequently", "important", "land", "river", "urban", "valley", "water". | EXACT TITLE in land_use_planning: "Floodplain".
0.380
activityculturaleducationmeansmedianarrativepreservationvaluesview
SHARED TOKENS (9): "activity", "cultural", "education", "means", "media", "narrative", "preservation", "values", "view". | EXACT TITLE in arts_culture: "Storytelling".
0.380
communitydesignedfoundationindividualinvestmentlocalmakingprivatesingle
SHARED TOKENS (9): "community", "designed", "foundation", "individual", "investment", "local", "making", "private", "single". | EXACT TITLE in arts_culture: "Community foundation".
0.380
Drainage ↗ Q7481320 EXACT TITLE
agriculturalconditionsgrowthinternallandneedproductionsupplieswater
SHARED TOKENS (9): "agricultural", "conditions", "growth", "internal", "land", "need", "production", "supplies", "water". | EXACT TITLE in land_use_planning: "Drainage".
0.380
Easement ↗ Q448405 EXACT TITLE
accessamonganotherlandlawpropertypublicrealrights
SHARED TOKENS (9): "access", "among", "another", "land", "law", "property", "public", "real", "rights". | EXACT TITLE in land_use_planning: "Easement".
0.370
idahonampa
SHARED TOKENS (2): "idaho", "nampa". | URL->A (1): http://warhawkairmuseum.org/. | EXACT TITLE in arts_culture: "Warhawk Air Museum".
0.360
administrativeauthoritygovernmentpowerprocessreviewstatuteunusually
SHARED TOKENS (8): "administrative", "authority", "government", "power", "process", "review", "statute", "unusually". | EXACT TITLE in land_use_planning: "Judicial review".
0.360
applicableauthorizesdistrictlandordinancepermituseszoning
SHARED TOKENS (8): "applicable", "authorizes", "district", "land", "ordinance", "permit", "uses", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.360
differentgenerallylawlegalphysicalriversystemswater
SHARED TOKENS (8): "different", "generally", "law", "legal", "physical", "river", "systems", "water". | EXACT TITLE in land_use_planning: "Water right".
0.340
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverurbanwestern
SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "urban", "western". | EXACT TITLE in land_use_planning: "Boise River".
0.340
academicartseducationpolicyresearchreviewvisual
SHARED TOKENS (7): "academic", "arts", "education", "policy", "research", "review", "visual". | EXACT TITLE in arts_culture: "Arts education".
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycompleteconsiderationscostsculturaldevelopmentemploymentgovernmentgrowthhealthhousinglandneighborhoodplanningpoliciespreservepublicregionalresourcesschools
SHARED TOKENS (24): "community", "complete", "considerations", "costs", "cultural", "development", "employment", "government", "growth", "health", "housing", "land", "neighborhood", "planning", "policies", "preserve", "public", "regional", "resources", "schools"....
0.300
Public history ↗ Q441989 KW CROSS HIGH
academicactivitiesactivitybecomegenerallygovernmenthistorichistoricalhistoryincreasinglymediaoutsideparkspracticepreservationpublicrelatedsciencesitesspecialized
SHARED TOKENS (21): "academic", "activities", "activity", "become", "generally", "government", "historic", "historical", "history", "increasingly", "media", "outside", "parks", "practice", "preservation", "public", "related", "science", "sites", "specialized"....
0.300
agreementsamericanappliesbecomebuildingscommunitiesconnectionconservationculturaldocumentseconomicfuturegrouphistoricalintegrationinternationalknowledgelegallocalmajor
SHARED TOKENS (33): "agreements", "american", "applies", "become", "buildings", "communities", "connection", "conservation", "cultural", "documents", "economic", "future", "group", "historical", "integration", "international", "knowledge", "legal", "local", "major"....
0.300
Music festival ↗ Q868557 KW CROSS HIGH
activitiesannualassociatedcommunityculturaleducationeventgenerallyinformationinstitutionsnetworksorganizationsperformanceproductionspecific
SHARED TOKENS (15): "activities", "annual", "associated", "community", "cultural", "education", "event", "generally", "information", "institutions", "networks", "organizations", "performance", "production", "specific".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcitiescommercialcostsdevelopmentenvironmentalformgeographicgrowthhousingindustrialinfrastructurelandlargemeasuremodernplanning
SHARED TOKENS (37): "agency", "associated", "become", "building", "cities", "commercial", "costs", "development", "environmental", "form", "geographic", "growth", "housing", "industrial", "infrastructure", "land", "large", "measure", "modern", "planning"....
0.300
Street network ↗ Q358078 KW CROSS HIGH
affectanalysisbecomecitiesconnectedcreatingfoundationmovementnationalnetworknetworksnodessciencestreetstreetssystemtraffictransportation
SHARED TOKENS (18): "affect", "analysis", "become", "cities", "connected", "creating", "foundation", "movement", "national", "network", "networks", "nodes", "science", "street", "streets", "system", "traffic", "transportation".
0.300
adaboisecanyoncitiescountieshomeidaholargerlargestmeridianmetropolitannampapercentpopulationtreasurevalleywider
SHARED TOKENS (17): "ada", "boise", "canyon", "cities", "counties", "home", "idaho", "larger", "largest", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley", "wider".
0.300
actadministeredagenciesauthoritycodecomprehensiveconservationdecemberdependdesigneddevelopmentdifferenteconomicfederalgrowthinternationallawmeansnationalpreservation
SHARED TOKENS (30): "act", "administered", "agencies", "authority", "code", "comprehensive", "conservation", "december", "depend", "designed", "development", "different", "economic", "federal", "growth", "international", "law", "means", "national", "preservation"....
0.300
approvalbuildingcannotcodecodescomplianceconstructioncriteriadevelopmenteconomyemploymentgenerallygovernmentgovernmentshouselawlocalnationalpermitpermits
SHARED TOKENS (26): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "criteria", "development", "economy", "employment", "generally", "government", "governments", "house", "law", "local", "national", "permit", "permits"....
0.300
analysisarchitecturecommunitiescreatecreationculturaleconomiceveneventsgeographyhistorichistoryinterdisciplinarymakingmaterialmediaobjectsphysicalpracticepreservation
SHARED TOKENS (26): "analysis", "architecture", "communities", "create", "creation", "cultural", "economic", "even", "events", "geography", "historic", "history", "interdisciplinary", "making", "material", "media", "objects", "physical", "practice", "preservation"....
0.300
accessactapplicablebodiesbroadercostdatadesigneddevelopmentestablishformgeneralgovernmentinformationinstitutionslegalmakingmeanspolicypractice
SHARED TOKENS (28): "access", "act", "applicable", "bodies", "broader", "cost", "data", "designed", "development", "establish", "form", "general", "government", "information", "institutions", "legal", "making", "means", "policy", "practice"....
0.300
approximatelyboisedatadistrictdistrictsevengovernmenthouseidaholegislaturelimitspopulationrepresentativesresidentssinglesouth
SHARED TOKENS (16): "approximately", "boise", "data", "district", "districts", "even", "government", "house", "idaho", "legislature", "limits", "population", "representatives", "residents", "single", "south".
0.300
blockbuildingbusinesscentercentraldesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivatepublicreducingresidentialscaleserving
SHARED TOKENS (24): "block", "building", "business", "center", "central", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "reducing", "residential", "scale", "serving"....
0.300
anotherarrangementbecomecombineconsolidationcorporationdifferentdirectlyeconomyfinalintegratedintegrationinternationallargemakingmanagementmarketmeasuresneedopen
SHARED TOKENS (30): "another", "arrangement", "become", "combine", "consolidation", "corporation", "different", "directly", "economy", "final", "integrated", "integration", "international", "large", "making", "management", "market", "measures", "need", "open"....
0.300
activitiesactivityadministrationadministrativeagenciesanotherbodiesbuiltchangescontrolcreateddecisionsdivisioneconomiceducationenforcementenvironmentalgenerallygoverninggovernment
SHARED TOKENS (37): "activities", "activity", "administration", "administrative", "agencies", "another", "bodies", "built", "changes", "control", "created", "decisions", "division", "economic", "education", "enforcement", "environmental", "generally", "governing", "government"....
0.300
authoritycorporationcreateddistrictdistrictsentitygeographicgovernmentlargelegislaturelocalpowerprojectspublicstatutetaxwater
SHARED TOKENS (17): "authority", "corporation", "created", "district", "districts", "entity", "geographic", "government", "large", "legislature", "local", "power", "projects", "public", "statute", "tax", "water".
0.300
becomebroadercentralchangescombinecontemporarycontinuescontrolledculturalemphasizingfocusedformintegrateinterdisciplinarymodernmovementpatternsperformanceplatformsprocesses
SHARED TOKENS (28): "become", "broader", "central", "changes", "combine", "contemporary", "continues", "controlled", "cultural", "emphasizing", "focused", "form", "integrate", "interdisciplinary", "modern", "movement", "patterns", "performance", "platforms", "processes"....
0.300
amongcitiescontroldistinctgovernmentgovernmentsimpliesjurisdictionlawlocalmunicipalprocessunincorporatedurbanwork
SHARED TOKENS (15): "among", "cities", "control", "distinct", "government", "governments", "implies", "jurisdiction", "law", "local", "municipal", "process", "unincorporated", "urban", "work".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycasesconservationcreatedcycledifferentestategovernmentlandlegallocaloriginalownershippathphysicalprivaterealright-of-wayrightsrights-of-way
SHARED TOKENS (26): "authority", "cases", "conservation", "created", "cycle", "different", "estate", "government", "land", "legal", "local", "original", "ownership", "path", "physical", "private", "real", "right-of-way", "rights", "rights-of-way"....
0.300
Municipality ↗ Q15284 KW CROSS HIGH
administrativecommunitiescorporatedistrictdivisiongoverninggovernmentgovernmentsjurisdictionlocalmunicipalitiesnationalpermittingplacesregionalsinglestatus
SHARED TOKENS (17): "administrative", "communities", "corporate", "district", "division", "governing", "government", "governments", "jurisdiction", "local", "municipalities", "national", "permitting", "places", "regional", "single", "status".
0.300
actualagriculturalcommunityconservationcontrolledcreatedevelopmentdistrictsenvironmentalgrowthhistoriclandlandscapemanagementoccursopenplanningpreservationpreserveprivate
SHARED TOKENS (25): "actual", "agricultural", "community", "conservation", "controlled", "create", "development", "districts", "environmental", "growth", "historic", "land", "landscape", "management", "occurs", "open", "planning", "preservation", "preserve", "private"....
0.300
Ethnography ↗ Q132151 KW CROSS HIGH
analysisclimatecommunitiesculturaldatadocumentdocumentseventsformgrouphabitathistoryindividuallocalpatternsphysicalreligiousresearchrolescience
SHARED TOKENS (22): "analysis", "climate", "communities", "cultural", "data", "document", "documents", "events", "form", "group", "habitat", "history", "individual", "local", "patterns", "physical", "religious", "research", "role", "science"....
0.300
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
americanboisebureaucountiesengineeringengineersfeethistoricidahonationaloperatedprovideriverwaterwestern
SHARED TOKENS (15): "american", "boise", "bureau", "counties", "engineering", "engineers", "feet", "historic", "idaho", "national", "operated", "provide", "river", "water", "western".
0.300
Arts district ↗ Q1797194 KW CROSS HIGH
affordabilityanotherartsassociatedcitiescommercialconcentrationcreateculturaldistrictdistrictseconomicfacilitieshomehousinglargemultipleoccursplacesplanning
SHARED TOKENS (29): "affordability", "another", "arts", "associated", "cities", "commercial", "concentration", "create", "cultural", "district", "districts", "economic", "facilities", "home", "housing", "large", "multiple", "occurs", "places", "planning"....
0.300
activitiesauthoritycapacitycasesconductconflictsenforcementfederalgeneralgovernmentgovernmentshealthindividualjurisdictionlawlegalmeansmeasuresneedphysical
SHARED TOKENS (30): "activities", "authority", "capacity", "cases", "conduct", "conflicts", "enforcement", "federal", "general", "government", "governments", "health", "individual", "jurisdiction", "law", "legal", "means", "measures", "need", "physical"....
0.300
affordabilityaffordableamonganotherbuildingsbuiltcasescitiescodecommunitiesconstructedcontrolcontrolscostcreatedevelopersdevelopmentfeesfinancialfunctions
SHARED TOKENS (50): "affordability", "affordable", "among", "another", "buildings", "built", "cases", "cities", "code", "communities", "constructed", "control", "controls", "cost", "create", "developers", "development", "fees", "financial", "functions"....
0.300
foundedhouselargestmajorsupply
SHARED TOKENS (5): "founded", "house", "largest", "major", "supply". | EXACT TITLE in land_use_planning: "Sekisui House".
0.300
agenciesamericanbureaucaseschaptercitiescommunitiesconservationconsolidatedcouncilcountiescreatedatadistrictdistrictsevenfireformfunctionsgeneral
SHARED TOKENS (48): "agencies", "american", "bureau", "cases", "chapter", "cities", "communities", "conservation", "consolidated", "council", "counties", "create", "data", "district", "districts", "even", "fire", "form", "functions", "general"....
0.300
activityamongapproximatelyassociationboisebureaucanyoncapacitycenterconservationcontainscountiescreatedcreatesdirectlyedgefebruaryfederalfeetformation
SHARED TOKENS (39): "activity", "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "conservation", "contains", "counties", "created", "creates", "directly", "edge", "february", "federal", "feet", "formation"....
0.300
affectagenciesboundarycommunitiescreatingdistributionenvironmentalfunctionslandmanagementplanningprocessprogramsprojectsqualityresourcesrightsspecialistsstudysupply
SHARED TOKENS (21): "affect", "agencies", "boundary", "communities", "creating", "distribution", "environmental", "functions", "land", "management", "planning", "process", "programs", "projects", "quality", "resources", "rights", "specialists", "study", "supply"....
0.300
accessadministrationaffectsagencyassetbuildingbusinesscreateddepartmentdevelopmentemergencyfederalfundinggovernmentgovernmentshousinginfrastructurelocalmajormanagement
SHARED TOKENS (30): "access", "administration", "affects", "agency", "asset", "building", "business", "created", "department", "development", "emergency", "federal", "funding", "government", "governments", "housing", "infrastructure", "local", "major", "management"....
0.300
americanassociationawardsblockcategorychangescreatedcurrentdepartmenteventsfebruaryfinancialgovernmentlaterlistslocalmajorofficeparksperformance
SHARED TOKENS (27): "american", "association", "awards", "block", "category", "changes", "created", "current", "department", "events", "february", "financial", "government", "later", "lists", "local", "major", "office", "parks", "performance"....
0.300
actualadministrativeappliedappliesapprovalassociationdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactinternationalmajormakingmanagementparticipationplan
SHARED TOKENS (35): "actual", "administrative", "applied", "applies", "approval", "association", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "international", "major", "making", "management", "participation", "plan"....
0.300
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcombinecommissioncompetitiveconsolidatedconsolidationcontrolcorporatecreatedepartmentdirecteconomically
SHARED TOKENS (46): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "combine", "commission", "competitive", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "economically"....
0.300
americanbuildingcodescommercialcreationdesigneddevelopmentdistrictenvironmentalhousingindustriallandopenparksplanningpreservationprocessrecreationresidentialrights
SHARED TOKENS (28): "american", "building", "codes", "commercial", "creation", "designed", "development", "district", "environmental", "housing", "industrial", "land", "open", "parks", "planning", "preservation", "process", "recreation", "residential", "rights"....
0.300
agencyconservationdecemberdepartmenteducationenforcementengineersenvironmentalequivalentestablishingfederalfederallyfinancialgovernmentgovernmentshouseindependentinformationlegallocal
SHARED TOKENS (35): "agency", "conservation", "december", "department", "education", "enforcement", "engineers", "environmental", "equivalent", "establishing", "federal", "federally", "financial", "government", "governments", "house", "independent", "information", "legal", "local"....
0.300
affectagriculturalchangeclimatecommunitiesconnectconservationconstructioncontrolengineeringenvironmentalevenhabitathealthimportantinfluencelandland-uselandscapelarge
SHARED TOKENS (39): "affect", "agricultural", "change", "climate", "communities", "connect", "conservation", "construction", "control", "engineering", "environmental", "even", "habitat", "health", "important", "influence", "land", "land-use", "landscape", "large"....
0.300
boisecontainscoveringcreateddistrictsfacilitiesfeethomeidaholandmaintainmultiplenationalpercentrecreationresourcesriverunitswaterwildlife
SHARED TOKENS (20): "boise", "contains", "covering", "created", "districts", "facilities", "feet", "home", "idaho", "land", "maintain", "multiple", "national", "percent", "recreation", "resources", "river", "units", "water", "wildlife".
0.300
affordabilityamongappliedauthoritycasescitiesconstructiondistrictdistrictseconomiceconomyenvironmentalestimatesexplicitlygovernmentshousingincreasejurisdictionlandlimits
SHARED TOKENS (45): "affordability", "among", "applied", "authority", "cases", "cities", "construction", "district", "districts", "economic", "economy", "environmental", "estimates", "explicitly", "governments", "housing", "increase", "jurisdiction", "land", "limits"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfoundedgovernmenthomehousehousingpoliciesprogramurban
SHARED TOKENS (15): "administers", "agency", "department", "departments", "development", "directly", "federal", "founded", "government", "home", "house", "housing", "policies", "program", "urban".
0.300
adaboisebuiltbureauconstructioncontroldirectlyengineersfederalfeetidahomultipleoperatingoperationalparkpowerprivateproximityriverwestern
SHARED TOKENS (20): "ada", "boise", "built", "bureau", "construction", "control", "directly", "engineers", "federal", "feet", "idaho", "multiple", "operating", "operational", "park", "power", "private", "proximity", "river", "western".
0.300
accessibilityactadabusinesschangescostscouncilemployersfinalhouseimposeslaterlawnationalorientationprotectionprovidepublicrequirementsrequires
SHARED TOKENS (22): "accessibility", "act", "ada", "business", "changes", "costs", "council", "employers", "final", "house", "imposes", "later", "law", "national", "orientation", "protection", "provide", "public", "requirements", "requires"....
0.300
communitydevelopmentdirectlydistricteconomicfutureinfrastructureinvestmentmunicipalitiesneedoriginalprivateprogramprojectprojectspropertypublicredevelopmentrelatedrevenue
SHARED TOKENS (23): "community", "development", "directly", "district", "economic", "future", "infrastructure", "investment", "municipalities", "need", "original", "private", "program", "project", "projects", "property", "public", "redevelopment", "related", "revenue"....
0.300
Folklore ↗ Q36192 KW CROSS HIGH
academicanotherartsbuildingculturalcurriculumformformalgroupindividualinstructionmaterialschoolstudiesstudyundergraduate
SHARED TOKENS (16): "academic", "another", "arts", "building", "cultural", "curriculum", "form", "formal", "group", "individual", "instruction", "material", "school", "studies", "study", "undergraduate".
0.300
Baroque music ↗ Q8361 KW CROSS HIGH
continuescreationestablishedexpectedformgroupindependentmajormodernmultipleperformanceprofessionalshortsizewestern
SHARED TOKENS (15): "continues", "creation", "established", "expected", "form", "group", "independent", "major", "modern", "multiple", "performance", "professional", "short", "size", "western".
0.300
applicationapproximatelybusinessescitiesconnectedconstructioncontainscostscriteriademanddesigndifferentengineersevenexpectedindustriallandlargemanagementmunicipal
SHARED TOKENS (39): "application", "approximately", "businesses", "cities", "connected", "construction", "contains", "costs", "criteria", "demand", "design", "different", "engineers", "even", "expected", "industrial", "land", "large", "management", "municipal"....
0.300
accesscannotcommissioncontrolcostsdifferententityfederalfrequentlygovernmentinfrastructurelargelocalmarketmodernmultipleoperatesorganizationpipelinesproduction
SHARED TOKENS (33): "access", "cannot", "commission", "control", "costs", "different", "entity", "federal", "frequently", "government", "infrastructure", "large", "local", "market", "modern", "multiple", "operates", "organization", "pipelines", "production"....
0.300
airportanalysiscapacitycollectioncostcostscurrentdatademandemploymentengineeringenvironmentalestimatesfinancialfutureimpactinfrastructuremodelnoiseplanning
SHARED TOKENS (27): "airport", "analysis", "capacity", "collection", "cost", "costs", "current", "data", "demand", "employment", "engineering", "environmental", "estimates", "financial", "future", "impact", "infrastructure", "model", "noise", "planning"....
0.300
actactiveactivitiesadministeredagenciesapproximatelyauthoritybuildingbusinesscapacitycomponentsconductconstructioncontrolcreationdepartmentdesigndirectdirectlyeconomy
SHARED TOKENS (58): "act", "active", "activities", "administered", "agencies", "approximately", "authority", "building", "business", "capacity", "components", "conduct", "construction", "control", "creation", "department", "design", "direct", "directly", "economy"....
0.300
agriculturalbuildingcostdegreedesigndevelopmententitygeneralgovernmentlandlandscapelimitsopenoperatorprivatepropertiespublicratherrelatedsite
SHARED TOKENS (22): "agricultural", "building", "cost", "degree", "design", "development", "entity", "general", "government", "land", "landscape", "limits", "open", "operator", "private", "properties", "public", "rather", "related", "site"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationbuildingsconnectdevelopmentevenfinalfunctionsgovernmentimpactlandlaterlegalmunicipalitiesnetworksownersownershippaymentpower
SHARED TOKENS (32): "acquisition", "another", "application", "buildings", "connect", "development", "even", "final", "functions", "government", "impact", "land", "later", "legal", "municipalities", "networks", "owners", "ownership", "payment", "power"....
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
actallowinganotherapplicationauthoritybuildingchangecommercialcommissioncommunitycontrolcouncilcreatingcurrentdistrictdistrictsenablinggeneralgovernmenthistoric
SHARED TOKENS (52): "act", "allowing", "another", "application", "authority", "building", "change", "commercial", "commission", "community", "control", "council", "creating", "current", "district", "districts", "enabling", "general", "government", "historic"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangescontroldevelopmentfinancialfirmsgeneralinvestmentlong-termmanagementoperationalownershipprivateproductsprovidepublicrather
SHARED TOKENS (24): "active", "business", "capital", "category", "changes", "control", "development", "financial", "firms", "general", "investment", "long-term", "management", "operational", "ownership", "private", "products", "provide", "public", "rather"....
0.300
actamericanapproximatelyboisebureaucapacitycenterconstructiondecemberdesignfeethomeidaholawmaterialsnationaloperatedpowerprojectsprovide
SHARED TOKENS (28): "act", "american", "approximately", "boise", "bureau", "capacity", "center", "construction", "december", "design", "feet", "home", "idaho", "law", "materials", "national", "operated", "power", "projects", "provide"....
0.300
administrativeagreementapplicablearrangementcomplianceconservationcontinuescreatesdevelopmentdocumententityestablishedestatefederalfinancialfuturegenerallygovernmentgrantsgrowth
SHARED TOKENS (62): "administrative", "agreement", "applicable", "arrangement", "compliance", "conservation", "continues", "creates", "development", "document", "entity", "established", "estate", "federal", "financial", "future", "generally", "government", "grants", "growth"....
0.300
actadministrativearticleartscodecreateexplicitlygenerallygrantslawlibraryofficeoriginalpowerprotectionpublicrightssciencetimestitle
SHARED TOKENS (21): "act", "administrative", "article", "arts", "code", "create", "explicitly", "generally", "grants", "law", "library", "office", "original", "power", "protection", "public", "rights", "science", "times", "title"....
0.300
amongappliesapplyassociatedassociationcodecommunitycorporatecorporationfederalformfoundationindividualinternationalnationalnonprofitoperatedoperationorganizationorganizations
SHARED TOKENS (31): "among", "applies", "apply", "associated", "association", "code", "community", "corporate", "corporation", "federal", "form", "foundation", "individual", "international", "national", "nonprofit", "operated", "operation", "organization", "organizations"....
0.300
affectagencyamericanchangescommunitiescontemporarycouncildecisionsdevelopmenteconomicemergencyfederalgovernmenthistoricindependentinfluencenationalpermittedpolicypreservation
SHARED TOKENS (25): "affect", "agency", "american", "changes", "communities", "contemporary", "council", "decisions", "development", "economic", "emergency", "federal", "government", "historic", "independent", "influence", "national", "permitted", "policy", "preservation"....
0.300
amongappearseditionevenlaterlivingmajornarrativenationalphysicalprivateproducedqualityrecordsreligiousremainstextthemworks
SHARED TOKENS (19): "among", "appears", "edition", "even", "later", "living", "major", "narrative", "national", "physical", "private", "produced", "quality", "records", "religious", "remains", "text", "them", "works".
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
affordablearchitectureassociatedbuildingcommunitycontemporarycreatingdesigndevelopmentestatefacilitieshistorichousingincreaseinfrastructurelandland-usemovementmunicipalneighborhood
SHARED TOKENS (34): "affordable", "architecture", "associated", "building", "community", "contemporary", "creating", "design", "development", "estate", "facilities", "historic", "housing", "increase", "infrastructure", "land", "land-use", "movement", "municipal", "neighborhood"....
0.300
accesscommunitycompletedesigndesignedeconomicengineersenvironmentalhealthhomelivingoperatedpolicypractitionerspublicrelatedrequiressafetystreetstraffic
SHARED TOKENS (22): "access", "community", "complete", "design", "designed", "economic", "engineers", "environmental", "health", "home", "living", "operated", "policy", "practitioners", "public", "related", "requires", "safety", "streets", "traffic"....
0.300
architecturalbuildingscasesconservationculturaldecisionsdescribesdesignhistoricalindividualmaterialpreservationprocesspropertysignificantvaluevalues
SHARED TOKENS (17): "architectural", "buildings", "cases", "conservation", "cultural", "decisions", "describes", "design", "historical", "individual", "material", "preservation", "process", "property", "significant", "value", "values".
0.300
actapprovalapprovalsbuildingcommercialconstructioncontractorscostscreatescreationdesigndeterminedevelopersdevelopmentdifferenteconomicengineersenvironmentalestatefinancial
SHARED TOKENS (42): "act", "approval", "approvals", "building", "commercial", "construction", "contractors", "costs", "creates", "creation", "design", "determine", "developers", "development", "different", "economic", "engineers", "environmental", "estate", "financial"....
🫐 BERRY33 edges
0.280
Parcel ↗ EXACT TITLE
geographyindividuallandmodern
SHARED TOKENS (4): "geography", "individual", "land", "modern". | EXACT TITLE in land_use_planning: "Parcel".
0.280
americanidahoprofessionaltitle
SHARED TOKENS (4): "american", "idaho", "professional", "title". | EXACT TITLE in arts_culture: "James Castle".
0.280
informationprocesspropertiessurvey
SHARED TOKENS (4): "information", "process", "properties", "survey". | EXACT TITLE in land_use_planning: "Soil survey".
0.280
adaboisebuiltbureaucanyoncountiesengineersidahooperatedrivertreasurevalleywaterwestern
SHARED TOKENS (14): "ada", "boise", "built", "bureau", "canyon", "counties", "engineers", "idaho", "operated", "river", "treasure", "valley", "water", "western".
0.280
agencyformalgovernmentlaw
SHARED TOKENS (4): "agency", "formal", "government", "law". | EXACT TITLE in land_use_planning: "Hearing (law)".
0.280
arrangementboiseidahoregional
SHARED TOKENS (4): "arrangement", "boise", "idaho", "regional". | EXACT TITLE in arts_culture: "Idaho Shakespeare Festival".
0.280
Right to property ↗ KW CROSS HIGH
articleculturaleconomicgeneralindividualinternationallegalownershippaymentprivatepropertyprotectionrightssignificant
SHARED TOKENS (14): "article", "cultural", "economic", "general", "individual", "international", "legal", "ownership", "payment", "private", "property", "protection", "rights", "significant".
0.280
americanboisehotelrecords
SHARED TOKENS (4): "american", "boise", "hotel", "records". | EXACT TITLE in arts_culture: "Gene Harris".
0.280
idahonampaprivateuniversity
SHARED TOKENS (4): "idaho", "nampa", "private", "university". | EXACT TITLE in arts_culture: "Northwest Nazarene University".
0.280
collaborationcommunitiescontemporaryincreasinglyinstitutionspracticeprogramsproviderelatedresourcesspacespecificsupportworks
SHARED TOKENS (14): "collaboration", "communities", "contemporary", "increasingly", "institutions", "practice", "programs", "provide", "related", "resources", "space", "specific", "support", "works".
0.280
amongconnectionsculturaldifferentdistinctfocusedlivinglocalplacesrequiresresearchsitestudysurveys
SHARED TOKENS (14): "among", "connections", "cultural", "different", "distinct", "focused", "living", "local", "places", "requires", "research", "site", "study", "surveys".
0.260
Chamber music ↗ Q189201 KW CROSS HIGH
descriptionsevenformgrouphistoryhomelargeperformancepresentprofessionalrequiresspecialworks
SHARED TOKENS (13): "descriptions", "even", "form", "group", "history", "home", "large", "performance", "present", "professional", "requires", "special", "works".
0.260
artsassociatedconditionsdesignfullyindustrialinternationallatermaterialsmeetingmodernmovementproduced
SHARED TOKENS (13): "arts", "associated", "conditions", "design", "fully", "industrial", "international", "later", "materials", "meeting", "modern", "movement", "produced".
0.250
activityassociatedhistoryidahowestern
SHARED TOKENS (5): "activity", "associated", "history", "idaho", "western". | URL->A (1): http://www.ibhm.org/.
0.240
activitiesarchitectureconservationculturaldocumentationeducationprocesspropertyprotectionresearchsciencetreatment
SHARED TOKENS (12): "activities", "architecture", "conservation", "cultural", "documentation", "education", "process", "property", "protection", "research", "science", "treatment".
0.220
additionalcasesgardenhomeprincipalpropertyprovidereceiveresidentialseparatesupport
SHARED TOKENS (11): "additional", "cases", "garden", "home", "principal", "property", "provide", "receive", "residential", "separate", "support".
0.220
americancitiesdevelopmenteconomicinstitutemanagementproposedschoolstudiesuniversityurban
SHARED TOKENS (11): "american", "cities", "development", "economic", "institute", "management", "proposed", "school", "studies", "university", "urban".
0.220
culturalfrequently
SHARED TOKENS (2): "cultural", "frequently". | EXACT TITLE in arts_culture: "Basque Country".
0.200
academicannualconferencesdesignedeventsfocusedgeneralobjectivesprovidepublic
SHARED TOKENS (10): "academic", "annual", "conferences", "designed", "events", "focused", "general", "objectives", "provide", "public".
0.200
Septic tank ↗ Q386300 KW CROSS HIGH
connecteddevelopsprocessesreducesystemsystemsthereforetreatmentunitswastewater
SHARED TOKENS (10): "connected", "develops", "processes", "reduce", "system", "systems", "therefore", "treatment", "units", "wastewater".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahometropolitanpopulationschoolschools
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "house", "idaho", "metropolitan", "population", "school", "schools".
0.200
architectureartsculturaldestinationexperiencehistoricallivingproductssystemsvalue
SHARED TOKENS (10): "architecture", "arts", "cultural", "destination", "experience", "historical", "living", "products", "systems", "value".
0.200
Curation ↗ Q5194611 EXACT TITLE
curation
EXACT TITLE in arts_culture: "Curation".
0.200
boisecitiesdowntownhomeidahomajormetropolitanriverroutesserves
SHARED TOKENS (10): "boise", "cities", "downtown", "home", "idaho", "major", "metropolitan", "river", "routes", "serves".
0.180
agriculturalamericanindustriallegalmerelyownershiprightssystemwater
SHARED TOKENS (9): "agricultural", "american", "industrial", "legal", "merely", "ownership", "rights", "system", "water".
0.160
applicationsconstructionengineeringknowledgematerialsrelatedstudyuses
SHARED TOKENS (8): "applications", "construction", "engineering", "knowledge", "materials", "related", "study", "uses".
0.160
businessdevelopmentestateindustrialofficeofficesparkrather
SHARED TOKENS (8): "business", "development", "estate", "industrial", "office", "offices", "park", "rather".
0.140
actualcurrentestatemarketpropertyrealvalue
SHARED TOKENS (7): "actual", "current", "estate", "market", "property", "real", "value".
0.140
agriculturalcitiesidaholandlargestmajorriver
SHARED TOKENS (7): "agricultural", "cities", "idaho", "land", "largest", "major", "river".
0.140
changeenablingmakingratherrelationshipssystemsystems
SHARED TOKENS (7): "change", "enabling", "making", "rather", "relationships", "system", "systems".
0.140
activitybuiltenvironmentalhealthlandpublicurban
SHARED TOKENS (7): "activity", "built", "environmental", "health", "land", "public", "urban".
0.120
cannotconservationhabitatmanagementpracticeprotect
SHARED TOKENS (6): "cannot", "conservation", "habitat", "management", "practice", "protect".
0.120
constructionmaterialsmeaningpropertyrealtitle
SHARED TOKENS (6): "construction", "materials", "meaning", "property", "real", "title".
◈ Frequently Asked Questions
Arts Culture × Land Use Planning — Treasure Valley
HAIKU · HIGH GATE
How do Boise's urban renewal projects affect where arts organizations can locate downtown?
Boise's comprehensive planning process determines which downtown parcels become available for cultural institutions versus commercial development. Urban renewal districts in Boise directly influence property costs and zoning designations that arts organizations in Ada County must navigate when choosing performance or gallery spaces.
What role does the Treasure Valley's population growth play in land use decisions affecting cultural venues?
Ada County and Canyon County comprehensive plans must account for population increases when designating space for theaters, museums, and public art installations across the metropolitan area. As Nampa, Eagle, Garden City, and Meridian expand, their individual land use codes determine whether cultural facilities receive priority in new development zones.
How do Boise State University and College of Western Idaho influence arts and cultural land use in the Treasure Valley?
Boise State University's campus in Ada County and College of Western Idaho's locations serve as anchors for cultural programming that shape surrounding land use patterns and downtown revitalization. Both institutions' comprehensive planning commitments to public art and performance spaces affect how municipalities across the Treasure Valley zone for cultural infrastructure.
Why does Boise Airport's location matter for planning cultural districts in the Treasure Valley?
Boise Airport's position in Ada County creates noise overlay zones that comprehensive planners must consider when locating theaters, concert halls, and other sound-sensitive arts venues throughout the metropolitan area. The airport's land use footprint directly constrains where Boise and surrounding jurisdictions can designate cultural districts near the capital's downtown core.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Arts Culture × Land Use Planning 17 QID bridges 229 edges 5,877 ext links 2026-07-17 19:24:23 UTC ff7cfb9665220815
Arts Culture corridor ↗ Land Use Planning corridor ↗ Land Use Planning × Arts Culture ↗ boisestandard.org/standard ↗
Parent Corridors
Arts Culture × All Other Verticals