—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Aerospace Defense ↔ relates to ↔ Technology

16 Wikipedia bridge articles confirmed in both vertical ledgers. 203 deterministic cross-vertical edges. 5,447 external source links harvested. Every edge provenance-stamped. Every claim auditable.

16 QID Bridge Articles
203 Cross Edges
5,447 External Sources
236 Wikipedia Articles
16 🌲 Evergreen
133 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Aerospace Defense
× Technology
QID Bridge Articles
16
confirmed Wikipedia overlap
Total Cross Edges
203
External Sources Harvested
5,447
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise Airport
score: 1.1500  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (16)
Boise AirportTreasure ValleyGeographic information systemMechatronicsBoise State UniversityPrivate equityCollege of Western IdahoMachine learningIdaho PowerExport controlSemiconductor industryComputer securityBoise, IdahoNampa, IdahoAda County, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisetechnologyadafieldwesternbusinessdevelopmentlocaloregontreasurevalleycomputerdataengineeringsoftwaresystemstechnicalcontrolcollege
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 19:16:52 UTC
Content Hash
209bd09e2348fe72
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
16 BRIDGES
Boise Airport
Q1430971 EXACT TITLE 1.150
QID OVERLAP: Q1430971 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (19): "ada", "air", "airport", "base", "boise", "center", "commercial", "department", "facility", "field", "fire", "general", "idaho", "national", "operates", "south", "support", "uses", "western". | URL->B (1): http://www.iflyboise.com/. | EXACT TITLE in aerospace_defense: "Boise Airport". | EXACT TITLE in technology: "Boise Airport".
adaairairportbaseboisecentercommercialdepartmentfacilityfieldfiregeneralidahonationaloperatessouthsupportuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Treasure Valley
Q7836726 EXACT TITLE 1.090
QID OVERLAP: Q7836726 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (12): "boise", "commerce", "historically", "idaho", "land", "local", "oregon", "region", "rural", "treasure", "valley", "western". | URL->B (1): https://www.hpmuseum.net/divisions.php?did=9. | EXACT TITLE in aerospace_defense: "Treasure Valley". | EXACT TITLE in technology: "Treasure Valley".
boisecommercehistoricallyidaholandlocaloregonregionruraltreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Geographic information system
Q483130 EXACT TITLE 1.000
QID OVERLAP: Q483130 in aerospace_defense (tier:evergreen) and technology (tier:branch). | SHARED TOKENS (37): "ability", "academic", "analysis", "another", "broader", "business", "computer", "data", "engineering", "essential", "geography", "hardware", "human", "industry", "institutional", "insurance", "intelligence", "key", "knowledge", "logistics".... | EXACT TITLE in aerospace_defense: "Geographic information system".
abilityacademicanalysisanotherbroaderbusinesscomputerdataengineeringessentialgeographyhardwarehumanindustryinstitutionalinsuranceintelligencekeyknowledgelogisticsmanagemanagementmultipleoperationsphysicalplanningrealreasonrelevantscience+7
nd Earth science. For this reason, GIS and location intelligence applications are at the foundation of location-enabled services, which rely on geographic analysis and visualization. GIS provides the ability to relate previously unrelated information, through the use of location as the "key index variable". Locations and extents that are found in the Earth's spacetime are able to be recorded through the date and time of occurrence, along with x, y, and z coordinates; representing, longitude (x), latitude (y), and elevation (z). All Earth-based, spatial–temporal, location and extent references should be relatable to one another, and ultimately, to a "real" physical location or extent.
One of the first known instances in which spatial analysis was used came from the field of epidemiology in the Rapport sur la marche et les effets du choléra dans Paris et le département de la Seine (1832). French cartographer and geographer Charles Picquet created a map outlining the forty-eight districts in Paris, using halftone color gradients, to provide a visual representation for the number of reported deaths due to cholera per every 1,000 inhabitants. In 1854, John Snow, an epidemiologist and physician, was able to determine the source of a cholera outbreak in London through the use of spatial analysis. Snow achieved this through plotting the residence of each casualty on a map of the area, as well as the nearby water sources. Once these points were marked, he was able to identify the water source within the cluster that was responsible for the outbreak. This was one of the earliest successful uses of a geographic methodology in pinpointing the source of an outbreak in epidemiology. While the basic elements of topography and theme existed previously in cartography, Snow's map was unique due to his use of cartographic methods, not only to depict, but also to analyze clusters of geographically dependent phenomena. The early 20th century saw the development of photozincography, which allowed maps to be split into layers, for example one layer for vegetation and another for water. This was particularly used for printing contours – drawing these was a labour-intensive task but having them on a separate layer meant they could be worked on without the other layers to confuse the draughtsman. This work was initially drawn on glass plates, but later plastic film was introduced, with the advantages of being lighter, using less storage space and being less brittle, among others. When all the layers were finished, they were combined into one image using a large process camera. Once color printing came in, the layers idea was also used for creating separate printing plates for each color. While the use of layers much later became one of the typical features of a contemporary GIS, the photographic process just described is not considered a GIS in itself – as the maps were just images with no database to link them to. Two additional developments are notable in the early days of GIS: Ian McHarg's publication Design with Nature and its map overlay method and the introduction of a street network into the U.S. Census Bureau's DIME (Dual Independent Map Encoding) system. The first publication detailing the use of computers to facilitate cartography was written by Waldo Tobler in 1959. Further computer hardware development spurred by nuclear weapon research led to more widespread general-purpose computer "mapping" applications by the early 1960s. In 1963, the world's first true operational GIS was developed in Ottawa, Ontario, Canada, by the federal Department of Forestry and Rural Development. Developed by Roger Tomlinson, it was called the Canada Geographic Information System (CGIS) and was used to store, analyze, and manipulate data collected for the Canada Land Inventory, an effort to determine the land capability for rural Canada by mapping information about soils, agriculture, recreation, wildlife, waterfowl, forestry and land use at a scale of 1:50,000. A rating classification factor was also added to permit analysis. CGIS was an improvement over "computer mapping" applications as it provided capabilities for data storage, overlay, measurement, and digitizing/scanning. It supported a national coordinate system that spanned the continent, coded lines as arcs having a true embedded topology and it stored the attribute and locational information in separate files. As a result of this, Tomlinson has become known as the "father of GIS", particularly for his use of overlays in promoting the spatial analysis of convergent geographic data. CGIS lasted into the 1990s and built a large digital land resource database in Canada. It was developed as a mainframe-based system in support of federal and provincial resource planning and management. Its strength was continent-wide analysis of complex datasets. The CGIS was never available commercially. In 1964, Howard T. Fisher formed the Laboratory for Computer Graphics and Spatial Analysis at the Harvard Graduate School of Design (LCGSA 1965–1991), where a number of important theoretical concepts in spatial data handling were developed, and which by the 1970s had distributed seminal software code and systems, such as SYMAP, GRID, and ODYSSEY, to universities, research centers and corporations worldwide. These programs were the first examples of general-purpose GIS software that was not developed for a particular installation, and was very influential on future commercial software, such as Esri ARC/INFO, released in 1983. Working in the Harvard Lab, Tom Waugh developed his vector-based Geographic Information Mapping and Manipulation System (GIMMS) software from 1969. He returned to the University of Edinburgh and this software was sold commercially from 1973. By 1977 it was used at 300 sites worldwide. This can be considered the first globally used GIS which anticipated some key characteristics of the Harvard Odyssey system by nearly five years and ARC/INFO by a decade. By the late 1970s, two public domain GIS systems (MOSS and GRASS GIS) were in development, and by the early 1980s, M&S Computing (later Intergraph) along with Bentley Systems Incorporated for the CAD platform, Environmental Systems Research Institute (ESRI), CARIS (Computer Aided Resource Information System), and ERDAS (Earth Resource Data Analysis System) emerged as commercial vendors of GIS software, successfully incorporating many of the CGIS features, combining the first-generation approach to separation of spatial and attribute information with a second-generation approach to organizing attribute data into database structures. In 1986, Mapping Display and Analysis System (MIDAS), the first desktop GIS product, was released for MS-DOS. It was renamed in 1990 to MapInfo for Windows when it was ported to Windows. This began the process of moving GIS from the research department into the business environment. By the end of the 20th century, the rapid growth in various systems had been consolidated and standardized on relatively few platforms and users were beginning to explore viewing GIS data over the Internet, requiring data format and transfer standards. More recently, a growing number of free, open-source GIS packages run on a range of operating systems and can be customized to perform specific tasks.
Primary data capture Survey data can be directly entered into a GIS from digital data collection systems on survey instruments using a technique called coordinate geometry (COGO). Positions from a global navigation satellite system (GNSS) like the Global Positioning System can also be collected and then imported into a GIS. A current trend in data collection gives users the ability to use field computers with the ability to edit live data using wireless connections or disconnected editing sessions. The current trend is to use applications available on smartphones and PDAs in the form of mobile GIS. This has been enhanced by the availability of low-cost mapping-grade GPS units with decimeter accuracy in real time. This eliminates the need to post process, import, and update the data in the office after fieldwork has been collected. This includes the ability to incorporate positions collected using a laser rangefinder. New technologies also allow users to create maps as well as analysis directly in the field, making projects more efficient and mapping more accurate. Remotely sensed data also plays an important role in data collection and consist of sensors attached to a platform. Sensors include cameras, digital scanners and lidar, while platforms usually consist of aircraft and satellites. In England in the mid-1990s, hybrid kite/balloons called helikites first pioneered the use of compact airborne digital cameras as airborne geo-information systems. Aircraft measurement software, accurate to 0.4 mm, was used to link the photographs and measure the ground. Helikites are inexpensive and gather more accurate data than aircraft. Helikites can be used over roads, railways and towns where unmanned aerial vehicles (UAVs) are banned. Recently, aerial data collection has become more accessible with miniature UAVs and drones. For example, the Aeryon Scout was used to map a 50-acre area with a ground sample distance of 1 inch (2.54 cm) in only 12 minutes. The majority of digital data currently comes from photo interpretation of aerial photographs. Soft-copy workstations are used to digitize features directly from stereo pairs of digital photographs. These systems allow data to be captured in two and three dimensions, with elevations measured directly from a stereo pair using principles of photogrammetry. Analog aerial photos must be scanned before being entered into a soft-copy system, for high-quality digital cameras this step is skipped. Satellite remote sensing provides another important source of spatial data. Here satellites use different sensor packages to passively measure the reflectance from parts of the electromagnetic spectrum or radio waves that were sent out from an active sensor such as radar.
M
Q180165 EXACT TITLE 1.000
QID OVERLAP: Q180165 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (19): "automation", "computer", "control", "electrical", "electronics", "engineering", "field", "intended", "manufacturing", "mechanical", "mechatronics", "modern", "produce", "product", "science", "systems", "technical", "technology", "treat". | EXACT TITLE in aerospace_defense: "Mechatronics". | EXACT TITLE in technology: "Mechatronics".
automationcomputercontrolelectricalelectronicsengineeringfieldintendedmanufacturingmechanicalmechatronicsmodernproduceproductsciencesystemstechnicaltechnologytreat
nical engineering, electrical engineering, electronic engineering and computer science and engineering, and includes a combination of robotics, computer science, telecommunications, systems, control, automation and product engineering. As technology advances over time, various subfields of engineering have succeeded in both adapting and multiplying. The intention of mechatronics is to produce a design solution that unifies each of these various subfields.
ver, as the complexity of technical systems continued to evolve, the definition had been broadened to include more technical areas. Many people treat mechatronics as a modern buzzword synonymous with automation, robotics and electromechanical engineering. French standard NF E 01-010 gives the following definition: "approach aiming at the synergistic integration of mechanics, electronics, control theory, and computer science within product design and manufacturing, in order to improve and/or optimize its functionality".
Electronics and telecommunication engineering specializes in electronics devices and telecom devices of a mechatronics system. A mechatronics engineer specialized in electronics and telecommunications have knowledge of computer hardware devices. The transmission of signal is the main application of this subfield of mechatronics. Where digital and analog systems also forms an important part of mechatronics systems. Telecommunications engineering deals with the transmission of information across a medium. Electronics engineering is related to computer engineering and electrical engineering. Control engineering has a wide range of electronic applications from the flight and propulsion systems of commercial airplanes to the cruise control present in many modern cars (automobiles). VLSI designing is important for creating integrated circuits. Mechatronics engineers have deep knowledge of microprocessors, microcontrollers, microchips and semiconductors. The application of mechatronics in electronics manufacturing industry can conduct research and development on consumer electronic devices such as mobile phones, computers, cameras etc. For mechatronics engineers it is necessary to learn operating computer applications such as MATLAB and Simulink for designing and developing electronic products. Mechatronics engineering is an interdisciplinary course, it includes concepts of both electrical and mechanical systems. A mechatronics engineer engages in designing high power transformers or radio-frequency module transmitters. Industrial The branch of industrial engineer includes the design of machinery, assembly and process lines of various manufacturing industries. This branch can be said somewhat similar to automation and robotics. Mechatronics engineers who works as industrial engineers design and develop infrastructure of a manufacturing plant. Also it can be said that they are architect of machines.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (18): "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "founded", "idaho", "program", "programs", "public", "reported", "research", "school", "university", "west". | EXACT TITLE in aerospace_defense: "Boise State University".
boisebusinesscollegecompetedivisioneconomicseducationengineeringfoundedidahoprogramprogramspublicreportedresearchschooluniversitywest
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
A program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
CAA Division I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
P
Q476115 EXACT TITLE 1.000
QID OVERLAP: Q476115 in aerospace_defense (tier:branch) and technology (tier:evergreen). | SHARED TOKENS (23): "active", "business", "capital", "changes", "control", "development", "enterprise", "expansion", "finance", "financial", "firms", "general", "investment", "management", "operational", "press", "private", "product", "products", "public".... | EXACT TITLE in technology: "Private equity".
activebusinesscapitalchangescontroldevelopmententerpriseexpansionfinancefinancialfirmsgeneralinvestmentmanagementoperationalpressprivateproductproductspublicrolespecializedventure
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (23): "academic", "ada", "boise", "campus", "canyon", "college", "comprehensive", "cwi", "development", "education", "fall", "idaho", "large", "nampa", "programs", "public", "reported", "students", "technical", "treasure".... | EXACT TITLE in aerospace_defense: "College of Western Idaho". | EXACT TITLE in technology: "College of Western Idaho".
academicadaboisecampuscanyoncollegecomprehensivecwidevelopmenteducationfallidaholargenampaprogramspublicreportedstudentstechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
M
Q2539 EXACT TITLE 0.960
QID OVERLAP: Q2539 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (13): "analysis", "artificial", "data", "deep", "describing", "development", "field", "intelligence", "learning", "machine", "performance", "related", "risk". | EXACT TITLE in aerospace_defense: "Machine learning". | EXACT TITLE in technology: "Machine learning".
analysisartificialdatadeepdescribingdevelopmentfieldintelligencelearningmachineperformancerelatedrisk
learning approaches in performance. Statistics and mathematical optimisation methods compose the foundations of machine learning. Data mining is a related field of study, focusing on exploratory data analysis (EDA) through unsupervised learning. From a theoretical viewpoint, probably approximately correct learning provides a mathematical and statistical framework for describing machine learning.
Data mining Machine learning and data mining often employ the same methods and overlap significantly, but while machine learning focuses on prediction based on known properties learned from the training data, data mining focuses on the discovery of previously unknown properties in the data (this is the analysis step of knowledge discovery in databases). Data mining uses many machine learning methods, but with different goals; on the other hand, machine learning also employs data mining methods as "unsupervised learning" or as a preprocessing step to improve learner accuracy. Much of the confusion between these two research communities comes from the basic assumptions they work with: in machine learning, performance is usually evaluated with respect to the ability to reproduce known knowledge, while in knowledge discovery and data mining (KDD) the key task is the discovery of previously unknown knowledge. Evaluated with respect to known knowledge, an uninformed (unsupervised) method will easily be outperformed by other supervised methods, while in a typical KDD task, supervised methods cannot be used due to the unavailability of training data. Machine learning also has intimate ties to optimization: Many learning problems are formulated as minimisation of some loss function on a training set of examples.
Statistics Machine learning and statistics are closely related fields in terms of methods, but distinct in their principal goal: statistics draws population inferences from a sample, while machine learning finds generalisable predictive patterns. Conventional statistical analyses require the a priori selection of a model most suitable for the study data set. In addition, only significant or theoretically relevant variables based on previous experience are included for analysis. In contrast, machine learning is not built on a pre-structured model; rather, the data shape the model by detecting underlying patterns.
I
Q3147780 EXACT TITLE 0.940
QID OVERLAP: Q3147780 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (12): "around", "business", "distribution", "electrical", "idaho", "operates", "oregon", "power", "purchased", "sale", "transmission", "utility". | EXACT TITLE in aerospace_defense: "Idaho Power". | EXACT TITLE in technology: "Idaho Power".
aroundbusinessdistributionelectricalidahooperatesoregonpowerpurchasedsaletransmissionutility
mission and distribution of electricity in eastern Oregon and southern Idaho. It is a subsidiary of IDACORP, Inc. The company's 24,000-square-mile (62,000 km2) service area generally follows the area around the Snake River and its tributaries. Idaho Power owns and operates 17 hydroelectric dams and three natural gas power plants.
ricity sold by IPC was 36.8% hydroelectric, 15.4% natural gas, 13.0% coal, 9.8% wind, 5.4% solar, and, 2.3% geothermal, biomass & other, and 17.3% purchased from other generation companies. History Idaho Power Company originally filed for incorporation in Maine on May 6, 1915. It was reincorporated in Idaho as a subsidiary of IDACORP, Inc on October 1, 1998. This was followed by the purchase of the assets of five small southern Idaho power companies: Idaho-Oregon Light & Power; Great Shoshone and Twin Falls Water Power; Idaho Railway, Light & Power; Idaho Power & Light; and Southern Idaho Water Power Company. In 2018 Idaho Power sponsored the annual "Drive Electric Week" car show event at the state capitol. At the show people can learn about electric vehicles. Interest in electric vehicles has increased because of changing gas prices, improvements in battery technology, concerns for the environment and federal tax incentives for buying electric vehicles. To respond to customer interest, Idaho Power added tools to its website to guide customers investigating purchasing an electric vehicle. In 2019, Idaho Power set a goal to provide 100-percent clean energy by 2045. In addition to its hydropower facilities, which typically meet almost half its customers’ energy demands, Idaho Power plans additional investments in wind, solar and other clean sources. Clean energy resources are becoming more affordable, which could help Idaho Power accomplish its goal while keeping prices fair. Grid upgrades and battery-storage technology should help maintain Idaho Power's impressive reliability while moving the company closer to its goal. Continued energy efficiency efforts will help. Clean energy initiatives are not new to Idaho Power. In 2009, the company adopted a resolution to reduce carbon emissions. Idaho Power has reduced its carbon emissions intensity — measured in pounds of carbon dioxide (CO2) per megawatt-hour — by almost 50 percent since 2005.
3% geothermal, biomass & other, and 17.3% purchased from other generation companies. History Idaho Power Company originally filed for incorporation in Maine on May 6, 1915. It was reincorporated in Idaho as a subsidiary of IDACORP, Inc on October 1, 1998. This was followed by the purchase of the assets of five small southern Idaho power companies: Idaho-Oregon Light & Power; Great Shoshone and Twin Falls Water Power; Idaho Railway, Light & Power; Idaho Power & Light; and Southern Idaho Water Power Company. In 2018 Idaho Power sponsored the annual "Drive Electric Week" car show event at the state capitol. At the show people can learn about electric vehicles. Interest in electric vehicles has increased because of changing gas prices, improvements in battery technology, concerns for the environment and federal tax incentives for buying electric vehicles. To respond to customer interest, Idaho Power added tools to its website to guide customers investigating purchasing an electric vehicle. In 2019, Idaho Power set a goal to provide 100-percent clean energy by 2045. In addition to its hydropower facilities, which typically meet almost half its customers’ energy demands, Idaho Power plans additional investments in wind, solar and other clean sources. Clean energy resources are becoming more affordable, which could help Idaho Power accomplish its goal while keeping prices fair. Grid upgrades and battery-storage technology should help maintain Idaho Power's impressive reliability while moving the company closer to its goal. Continued energy efficiency efforts will help. Clean energy initiatives are not new to Idaho Power. In 2009, the company adopted a resolution to reduce carbon emissions. Idaho Power has reduced its carbon emissions intensity — measured in pounds of carbon dioxide (CO2) per megawatt-hour — by almost 50 percent since 2005.
E
Q96377540 EXACT TITLE 0.940
QID OVERLAP: Q96377540 in aerospace_defense (tier:evergreen) and technology (tier:evergreen). | SHARED TOKENS (12): "control", "controls", "department", "destinations", "export", "government", "governments", "local", "potentially", "requires", "software", "technology". | EXACT TITLE in aerospace_defense: "Export control". | EXACT TITLE in technology: "Export control".
controlcontrolsdepartmentdestinationsexportgovernmentgovernmentslocalpotentiallyrequiressoftwaretechnology
Export control is legislation that regulates the export of goods, software and technology. Some items could potentially be useful for purposes that are contrary to the interest of the exporting country. These items are considered to be controlled. The export of controlled item is regulated to restrict the harmful use of those items. Many governments implement export controls.
d to be controlled. The export of controlled item is regulated to restrict the harmful use of those items. Many governments implement export controls. Typically, legislation lists and classifies the controlled items, classifies the destinations, and requires exporters to apply for a licence to a local government department. History The United States has had export controls since the American Revolution, although the modern export control regimes can be traced back to the Trading with the Enemy Act of 1917. A significant piece of legislation was the Export Control Act of 1940 which inter alia aimed to restrict shipments of material to pre-war Japan. In the United Kingdom, the Import, Export and Customs Power (Defence) Act of 1939 was the main legislation prior to World War II. Post WWII, the Coordinating Committee for Multilateral Export Controls (CoCom) was founded in 1948, and continued until 1994.
inations, and requires exporters to apply for a licence to a local government department. History The United States has had export controls since the American Revolution, although the modern export control regimes can be traced back to the Trading with the Enemy Act of 1917. A significant piece of legislation was the Export Control Act of 1940 which inter alia aimed to restrict shipments of material to pre-war Japan. In the United Kingdom, the Import, Export and Customs Power (Defence) Act of 1939 was the main legislation prior to World War II. Post WWII, the Coordinating Committee for Multilateral Export Controls (CoCom) was founded in 1948, and continued until 1994.
S
Q2986369 QID OVERLAP 0.800
QID OVERLAP: Q2986369 in aerospace_defense (tier:branch) and technology (tier:branch). | SHARED TOKENS (21): "annual", "communications", "consumer", "development", "electronics", "expected", "growth", "industry", "law", "market", "multiple", "power", "producing", "production", "reach", "research", "sales", "second", "semiconductor", "single"....
annualcommunicationsconsumerdevelopmentelectronicsexpectedgrowthindustrylawmarketmultiplepowerproducingproductionreachresearchsalessecondsemiconductorsingletechnology
rapid advances in fabrication technology leading to the exponential growth in semiconductor device production, known as Moore's law that has persisted over the past six or so decades. The industry's annual semiconductor sales revenue has since grown to over $481 billion, as of 2018. In 2010, the semiconductor industry had the highest intensity of Research & Development in the EU and ranked second after Biotechnology in the EU, United States and Japan combined. The semiconductor industry is in turn the driving force behind the wider electronics industry, with annual power electronics sales of £135 billion ($216 billion) as of 2011, annual consumer electronics sales expected to reach $2.9 trillion by 2020, tech industry sales expected to reach $5 trillion in 2019, and e-commerce with over $29 trillion in 2017. In 2019, 32.4% of the semiconductor market segment was for networks and communications devices. In 2021, the sales of semiconductors reached a record $555.9 billion, up 26.2%, with sales in China reaching $192.5 billion, according to the Semiconductor Industry Association. A record 1.15 trillion semiconductor units were shipped in the calendar year.
pment in the EU and ranked second after Biotechnology in the EU, United States and Japan combined. The semiconductor industry is in turn the driving force behind the wider electronics industry, with annual power electronics sales of £135 billion ($216 billion) as of 2011, annual consumer electronics sales expected to reach $2.9 trillion by 2020, tech industry sales expected to reach $5 trillion in 2019, and e-commerce with over $29 trillion in 2017. In 2019, 32.4% of the semiconductor market segment was for networks and communications devices. In 2021, the sales of semiconductors reached a record $555.9 billion, up 26.2%, with sales in China reaching $192.5 billion, according to the Semiconductor Industry Association. A record 1.15 trillion semiconductor units were shipped in the calendar year.
Industry structure The global semiconductor industry is dominated by companies from the United States, Taiwan, South Korea, Japan and the Netherlands, with Israel and Germany having significant presence in the field. Unique features of the industry include continuous growth but in a cyclical pattern with high market fluctuation over the short run. While the current 20-year annual average growth of the semiconductor industry is on the order of 13%, this has been accompanied by equally above-average market volatility, which can lead to significant if not dramatic cyclical swings. This has required the need for high degrees of flexibility and innovation in order to constantly adjust to the rapid pace of change in the market as many products embedding semiconductor devices often have a very short life cycle. At the same time, the rate of constant price-performance improvement in the semiconductor industry is staggering. As a consequence, changes in the semiconductor market not only occur extremely rapidly but also anticipate changes in industries evolving at a slower pace. The semiconductor industry is widely recognized as a key driver and technology enabler for the whole electronics value chain. Prior to the 1980s, the semiconductor industry was vertically integrated. Semiconductor companies both designed and manufactured chips in their own facilities. In many cases, this included inventing new processes, refining and purifying source chemicals and silicon wafers, and even manufacturing equipment, like furnaces, lithography tools and etchers. These companies also carried out the assembly and testing of their chips. Over time, many of these functions were outsourced, such that today semiconductor manufacturers rely on a complex supply chain to provide wafers, high-purity source chemicals, and processing equipment. Further, starting with LSI in 1969, the industry has seen the emergence of Fabless Semiconductor Companies that focus solely on chip design and rely on other companies to manufacture their designs. Initially, these other companies were integrated device manufacturers (IDMs), companies that also designed and manufactured their own products, and thus were often competitors of the Fabless companies. But, by the mid-1980's TSMC and UMC emerged as foundries, specializing solely in the manufacture of other companies' designs. Today, much of the industry is based on the foundry model, which consists of semiconductor fabrication plants (foundries) and integrated circuit design operations, each belonging to separate companies or subsidiaries. Some companies, known as integrated device manufacturers, both design and manufacture semiconductors. The foundry model has resulted in consolidation among foundries. As of 2021, only three firms are able to manufacture the most advanced semiconductors: TSMC of Taiwan, Samsung of South Korea, and Intel of the United States. Part of this is due to the high capital costs of building foundries. TSMC's latest factory, capable of fabricating 3 nm process semiconductors and completed in 2020, cost $19.5 billion. Intel is considering outsourcing some production to TSMC. It currently can only produce 10 nm semiconductors, while TSMC and Samsung can both produce 5 nm.
Computer security
Q3510521 QID OVERLAP 0.800
QID OVERLAP: Q3510521 in aerospace_defense (tier:branch) and technology (tier:branch). | SHARED TOKENS (21): "computer", "critical", "cybersecurity", "data", "essential", "field", "finance", "hardware", "infrastructure", "manage", "modern", "network", "physical", "power", "security", "significance", "software", "systems", "technology", "therefore"....
computercriticalcybersecuritydataessentialfieldfinancehardwareinfrastructuremanagemodernnetworkphysicalpowersecuritysignificancesoftwaresystemstechnologythereforewireless
Computer security (also cybersecurity, digital security, or information technology (IT) security) is a subdiscipline within the field of information security. It focuses on protecting computer software, systems, and networks from threats that can lead to unauthorized information disclosure, theft, or damage to hardware, software, or data, as well as to the disruption or misdirection of the services they provide. The growing significance of computer security reflects the increasing dependence on computer systems, the Internet, and evolving wireless network standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
an lead to unauthorized information disclosure, theft, or damage to hardware, software, or data, as well as to the disruption or misdirection of the services they provide. The growing significance of computer security reflects the increasing dependence on computer systems, the Internet, and evolving wireless network standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
ntroduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in aerospace_defense (tier:branch) and technology (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "employers", "feet", "idaho", "major", "manufacturing", "micron", "oregon", "technology", "treasure", "valley".
adaannualboisecapitalemployersfeetidahomajormanufacturingmicronoregontechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in aerospace_defense (tier:branch) and technology (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "footprint", "idaho", "interstate", "meridian", "nampa", "northwest", "second", "university", "west", "western".
boisecanyoncollegefootprintidahointerstatemeridiannampanorthwestseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in aerospace_defense (tier:branch) and technology (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "idaho", "interior", "largest", "local", "northwest", "pacific", "private", "range", "second".
adaboisecapitalidahointeriorlargestlocalnorthwestpacificprivaterangesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in aerospace_defense (tier:branch) and technology (tier:evergreen). | SHARED TOKENS (5): "boise", "canyon", "idaho", "largest", "nampa".
boisecanyonidaholargestnampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
187 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP187 edges
🌿 BRANCH133 edges
0.570
actfederalformerlyidaholocalnationalorganizationorganizedsupportsystemtrained
SHARED TOKENS (11): "act", "federal", "formerly", "idaho", "local", "national", "organization", "organized", "support", "system", "trained". | URL->A (1): https://www.imd.idaho.gov/204th-regional-training-institute/. | EXACT TITLE in aerospace_defense: "Idaho Army National Guard".
0.570
aircontrolmechanicalneedpowerproducestructuressystemusesvehicleswater
SHARED TOKENS (11): "air", "control", "mechanical", "need", "power", "produce", "structures", "system", "uses", "vehicles", "water". | URL->A (1): https://www.pitchaero.com/. | EXACT TITLE in aerospace_defense: "Cyclorotor".
0.570
boisecompliancefinancialheadquarteredidahoinvestmentofficesperformancereportingrisktechnology
SHARED TOKENS (11): "boise", "compliance", "financial", "headquartered", "idaho", "investment", "offices", "performance", "reporting", "risk", "technology". | URL->B (1): https://clearwateranalytics.com/. | EXACT TITLE in technology: "Clearwater Analytics".
0.530
airbaseboisefederalfieldidahonationaloperatessupport
SHARED TOKENS (9): "air", "base", "boise", "federal", "field", "idaho", "national", "operates", "support". | URL->A (1): https://www.imd.idaho.gov/f-16-mission-coming-to-gowen-starting-in-2027/. | EXACT TITLE in aerospace_defense: "124th Fighter Wing".
0.500
advancedairbasecapabilitiescontractorscontrolsdefensedemanddepartmentdevelopmentdiscoveryemphasizesengineeringentirefacefacilitiesfuturenationalnearoffice
SHARED TOKENS (31): "advanced", "air", "base", "capabilities", "contractors", "controls", "defense", "demand", "department", "development", "discovery", "emphasizes", "engineering", "entire", "face", "facilities", "future", "national", "near", "office".... | EXACT TITLE in aerospace_defense: "Air Force Research Laboratory".
0.500
businesschaincomplexcomputercustomerdepartmentsdevelopedenterpriseexamplehandlinglargermanagementofficeoperationsprocessproductionprogramsreportingsoftwaresupply
SHARED TOKENS (25): "business", "chain", "complex", "computer", "customer", "departments", "developed", "enterprise", "example", "handling", "larger", "management", "office", "operations", "process", "production", "programs", "reporting", "software", "supply".... | EXACT TITLE in technology: "Enterprise software".
0.500
airportbecomebusinesscorporatefacilityflightfuelgeneralglobalindustryitselflandmaintenanceoperateoperatorsorganizationparkingproviderremotesafety
SHARED TOKENS (25): "airport", "become", "business", "corporate", "facility", "flight", "fuel", "general", "global", "industry", "itself", "land", "maintenance", "operate", "operators", "organization", "parking", "provider", "remote", "safety".... | EXACT TITLE in aerospace_defense: "Fixed-base operator".
0.500
Intuit ↗ Q1318848 EXACT TITLE
businesscreatedevelopedenginefinancefinancialheadquarteredlongermarketmonitoringoperationsplatformproductssmallsoftwaresystemsystemstax
SHARED TOKENS (18): "business", "create", "developed", "engine", "finance", "financial", "headquartered", "longer", "market", "monitoring", "operations", "platform", "products", "small", "software", "system", "systems", "tax". | EXACT TITLE in technology: "Intuit".
0.500
Radar ↗ Q47528 EXACT TITLE
aircontroldetectiondevelopeddevelopmententeredexampleexpectedflighthighlykeylearningmachinemodernmonitoringplatformprocessingproducingremotesite
SHARED TOKENS (27): "air", "control", "detection", "developed", "development", "entered", "example", "expected", "flight", "highly", "key", "learning", "machine", "modern", "monitoring", "platform", "processing", "producing", "remote", "site".... | EXACT TITLE in aerospace_defense: "Radar".
0.500
airairportcanyonconstructionemergencyflightformerlygeneralheadquarteredidahoindustrialmunicipalnampanationalplanprivatepublicsystemstraining
SHARED TOKENS (19): "air", "airport", "canyon", "construction", "emergency", "flight", "formerly", "general", "headquartered", "idaho", "industrial", "municipal", "nampa", "national", "plan", "private", "public", "systems", "training". | EXACT TITLE in aerospace_defense: "Nampa Municipal Airport".
0.500
World War II ↗ EXACT TITLE
advancedearlyestablishedeventsexpansionfallfutureglobalhistoryindustrieskeymajorpacificpoliticalsecondsecurityseptembersocialstructureswestern
SHARED TOKENS (20): "advanced", "early", "established", "events", "expansion", "fall", "future", "global", "history", "industries", "key", "major", "pacific", "political", "second", "security", "september", "social", "structures", "western". | EXACT TITLE in aerospace_defense: "World War II".
0.500
Robotics ↗ Q170978 EXACT TITLE
activeagricultureartificialbusinessconstructioncontrolcreatecreatesdevelopmentdomesticelectricalfieldfoodintelligenceitselfmanagementmanufacturingmechanicalpowerprocessing
SHARED TOKENS (29): "active", "agriculture", "artificial", "business", "construction", "control", "create", "creates", "development", "domestic", "electrical", "field", "food", "intelligence", "itself", "management", "manufacturing", "mechanical", "power", "processing".... | EXACT TITLE in aerospace_defense: "Robotics".
0.500
actagenciesboisebuildingcentercomplexexecutivefacilityfederalfirefoundedgovernmentgroupidaholargemanagemanagementnationalphysicalpolicy
SHARED TOKENS (23): "act", "agencies", "boise", "building", "center", "complex", "executive", "facility", "federal", "fire", "founded", "government", "group", "idaho", "large", "manage", "management", "national", "physical", "policy".... | EXACT TITLE in aerospace_defense: "National Interagency Fire Center".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingbuildingsdevelopeddevelopmentdifferentgovernmentgovernmentsgrowthindustriallandland-uselocalplacesplanningpolicyregulatoryresidentialsinglesystemsuses
SHARED TOKENS (21): "building", "buildings", "developed", "development", "different", "government", "governments", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "regulatory", "residential", "single", "systems", "uses".... | EXACT TITLE in aerospace_defense: "Zoning".
0.500
5G ↗ Q1363408 EXACT TITLE
accessairbasebegancapabilitiescapacitycommercialcommunicationscomputingconnectionscorecurrentdatadesigneddevelopedearlieredgeeffectsexpectedindustrial
SHARED TOKENS (40): "access", "air", "base", "began", "capabilities", "capacity", "commercial", "communications", "computing", "connections", "core", "current", "data", "designed", "developed", "earlier", "edge", "effects", "expected", "industrial".... | EXACT TITLE in technology: "5G".
0.500
Tech hub ↗ Q137582815 EXACT TITLE
broaderbusinessescomputerdevelopmentdistinctentireestablishedfirmsgovernmenthousinginstitutionslargeprivaterelatedresearchsciencetechnologyuniversity
SHARED TOKENS (18): "broader", "businesses", "computer", "development", "distinct", "entire", "established", "firms", "government", "housing", "institutions", "large", "private", "related", "research", "science", "technology", "university". | EXACT TITLE in technology: "Tech hub".
0.500
automationcontractendengineeringhumanjoblaborlargemanufacturingmaterialsprocessproductproductsstructureswork
SHARED TOKENS (15): "automation", "contract", "end", "engineering", "human", "job", "labor", "large", "manufacturing", "materials", "process", "product", "products", "structures", "work". | EXACT TITLE in aerospace_defense: "Metal fabrication".
0.500
Skydio ↗ Q97321374 EXACT TITLE
awarenessbusinesscommercialconsumercustomersdefensedepartmentdesignedheadquarteredmanufacturermarketpurchasedreportedseptembershare
SHARED TOKENS (15): "awareness", "business", "commercial", "consumer", "customers", "defense", "department", "designed", "headquartered", "manufacturer", "market", "purchased", "reported", "september", "share". | EXACT TITLE in aerospace_defense: "Skydio".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
aircontainsdesignedfacilitiesindustrialinsidemanufacturingmaterialspermitsproductionrangeresearchsemiconductorsmallerspacework
SHARED TOKENS (16): "air", "contains", "designed", "facilities", "industrial", "inside", "manufacturing", "materials", "permits", "production", "range", "research", "semiconductor", "smaller", "space", "work". | EXACT TITLE in technology: "Cleanroom".
0.500
annualanotherbecomebuildbusinesscapitalcontroldevelopmentearlyfacefinancefinancialfirmsfundinggrowthhistoryindustriesinstitutionalinvestmentinvestors
SHARED TOKENS (41): "annual", "another", "become", "build", "business", "capital", "control", "development", "early", "face", "finance", "financial", "firms", "funding", "growth", "history", "industries", "institutional", "investment", "investors".... | EXACT TITLE in aerospace_defense: "Venture capital". | EXACT TITLE in technology: "Venture capital".
0.500
analysisanotherappliedbeginningcomplexdataexamplefeedingmaterialsphysicalphysicallypointsprocessrangeremotesciencetechnologyuses
SHARED TOKENS (18): "analysis", "another", "applied", "beginning", "complex", "data", "example", "feeding", "materials", "physical", "physically", "points", "process", "range", "remote", "science", "technology", "uses". | EXACT TITLE in aerospace_defense: "Photogrammetry".
0.500
agricultureairbusinesscommercialdistinctionestablishflightgenerallargermajoroperationsorganizationpolicepracticesprivateregulatoryspecializedwork
SHARED TOKENS (18): "agriculture", "air", "business", "commercial", "distinction", "establish", "flight", "general", "larger", "major", "operations", "organization", "police", "practices", "private", "regulatory", "specialized", "work". | EXACT TITLE in aerospace_defense: "Civil aviation".
0.500
actcommunicationscompliancedatadevelopeddifferentfinancialgeneralglobalgovernmentshandlinghighlyhumanlawmedicalphysicalplatformpoliticalrangerecords
SHARED TOKENS (23): "act", "communications", "compliance", "data", "developed", "different", "financial", "general", "global", "governments", "handling", "highly", "human", "law", "medical", "physical", "platform", "political", "range", "records".... | EXACT TITLE in aerospace_defense: "Privacy law".
0.500
Ericsson ↗ Q52618 EXACT TITLE
acquiredaroundcommunicationscontroldevelopmentearlyequipmentfallfoundedheadquarteredindustryinfrastructureinvestmentmajoroperatesproviderssoftwaresystemstechnology
SHARED TOKENS (19): "acquired", "around", "communications", "control", "development", "early", "equipment", "fall", "founded", "headquartered", "industry", "infrastructure", "investment", "major", "operates", "providers", "software", "systems", "technology". | EXACT TITLE in technology: "Ericsson".
0.500
boisebroaderestablishedhistoricalhistoryidahointeriorlargestmerelynorthwestoregonpacificreachregionsouthwestwestern
SHARED TOKENS (17): "boise", "broader", "established", "historical", "history", "idaho", "interior", "largest", "merely", "northwest", "oregon", "pacific", "reach", "region", "south", "west", "western". | EXACT TITLE in aerospace_defense: "Pacific Northwest". | EXACT TITLE in technology: "Pacific Northwest".
0.500
chaincomplexconsumercustomersdirectdirectlydistributionendfacilitieslogisticsmanagementmaterialsnetworkorganizedpointproductproductsstructuresupplierssupply
SHARED TOKENS (23): "chain", "complex", "consumer", "customers", "direct", "directly", "distribution", "end", "facilities", "logistics", "management", "materials", "network", "organized", "point", "product", "products", "structure", "suppliers", "supply".... | EXACT TITLE in aerospace_defense: "Supply chain". | EXACT TITLE in technology: "Supply chain".
0.500
activeagenciescapabilitiesdesigneddifferentenvironmentalequipmentglobalhousinglawmarketoperatesperformancereachsystemtechnologyvisible
SHARED TOKENS (17): "active", "agencies", "capabilities", "designed", "different", "environmental", "equipment", "global", "housing", "law", "market", "operates", "performance", "reach", "system", "technology", "visible". | EXACT TITLE in aerospace_defense: "Night-vision device".
0.500
eventsfinancefinancialfundinghighlylargemedicalmodelmodernorganizationplatformprojectrangerolesocialsupporttravelventure
SHARED TOKENS (18): "events", "finance", "financial", "funding", "highly", "large", "medical", "model", "modern", "organization", "platform", "project", "range", "role", "social", "support", "travel", "venture". | EXACT TITLE in aerospace_defense: "Crowdfunding".
0.500
buildingbusinesscomputerconnectedconnectionconnectionsdataequipmentlayerlocalmodelnetworknodesphysicalplaceprocessstructureuseswireless
SHARED TOKENS (19): "building", "business", "computer", "connected", "connection", "connections", "data", "equipment", "layer", "local", "model", "network", "nodes", "physical", "place", "process", "structure", "uses", "wireless". | EXACT TITLE in technology: "Wireless network".
0.500
Airport ↗ Q1248784 EXACT TITLE
activeairairportbuildingscommercialcomplexcontainedcontroleffectsemergencyemployersenvironmentalfacilitiesfacilitygeneralimportantinfrastructurelandlargelarger
SHARED TOKENS (34): "active", "air", "airport", "buildings", "commercial", "complex", "contained", "control", "effects", "emergency", "employers", "environmental", "facilities", "facility", "general", "important", "infrastructure", "land", "large", "larger".... | EXACT TITLE in aerospace_defense: "Airport". | EXACT TITLE in technology: "Airport".
0.500
Exyte ↗ Q100531288 EXACT TITLE
acquireacquiredacquiringbuildingbusinessbusinessescapitalcenterschemicalconstructioncontractcoredatadeliverydevelopmentdivisionengineeringenvironmentsequipmentestablished
SHARED TOKENS (45): "acquire", "acquired", "acquiring", "building", "business", "businesses", "capital", "centers", "chemical", "construction", "contract", "core", "data", "delivery", "development", "division", "engineering", "environments", "equipment", "established".... | EXACT TITLE in technology: "Exyte".
0.500
analysisaroundchemicalcoredevelopmentelectricalelectronicsengineeringengineersequipmentfieldindustrialmaintainmanagementmanufacturingmaterialsmechanicalmechatronicsmedicalphysical
SHARED TOKENS (28): "analysis", "around", "chemical", "core", "development", "electrical", "electronics", "engineering", "engineers", "equipment", "field", "industrial", "maintain", "management", "manufacturing", "materials", "mechanical", "mechatronics", "medical", "physical".... | EXACT TITLE in aerospace_defense: "Mechanical engineering".
0.500
businesscommercecreatedepartmentsdevelopmentdifferentecosystemfinancialfundingglobalgovernmentgovernmentsimportantindustrylargelegallocalphysicalproviderresearch
SHARED TOKENS (25): "business", "commerce", "create", "departments", "development", "different", "ecosystem", "financial", "funding", "global", "government", "governments", "important", "industry", "large", "legal", "local", "physical", "provider", "research".... | EXACT TITLE in technology: "Startup ecosystem".
0.500
academicadvancedanalysisarchitectureartificialbecomebegancapabilitycomputerconcernscreatedeepeconomicseffectsengineeringenginesfieldformalfoundedfunding
SHARED TOKENS (41): "academic", "advanced", "analysis", "architecture", "artificial", "become", "began", "capability", "computer", "concerns", "create", "deep", "economics", "effects", "engineering", "engines", "field", "formal", "founded", "funding".... | EXACT TITLE in aerospace_defense: "Artificial intelligence". | EXACT TITLE in technology: "Artificial intelligence".
0.500
capacitycarrierscomputercontrolconversioncriticalcurrentdevelopmentdifferentearlyelectricalelectronicsgrouphavingmaterialsmodernnearphysicalpracticalprocess
SHARED TOKENS (27): "capacity", "carriers", "computer", "control", "conversion", "critical", "current", "development", "different", "early", "electrical", "electronics", "group", "having", "materials", "modern", "near", "physical", "practical", "process".... | EXACT TITLE in aerospace_defense: "Semiconductor". | EXACT TITLE in technology: "Semiconductor".
0.500
actactiveaircontrolcoredefensedepartmentdepartmentsestablishedexecutivefieldglobalheadquartersintelligencelandlargestnationaloperatesoperationaloperations
SHARED TOKENS (26): "act", "active", "air", "control", "core", "defense", "department", "departments", "established", "executive", "field", "global", "headquarters", "intelligence", "land", "largest", "national", "operates", "operational", "operations".... | EXACT TITLE in aerospace_defense: "United States Air Force".
0.500
architectureartificialcomputercomputingelectricalelectronicsengineeringengineersfieldhardwareintelligencelargeroperatingrequiresciencesoftwarespecializedsystemstrainingwork
SHARED TOKENS (20): "architecture", "artificial", "computer", "computing", "electrical", "electronics", "engineering", "engineers", "field", "hardware", "intelligence", "larger", "operating", "require", "science", "software", "specialized", "systems", "training", "work". | EXACT TITLE in aerospace_defense: "Computer engineering".
0.500
appliedarchitectureartificialautomationcannotcomplexcomputerconcernsconstructiondatadescribesdifferentdistinctionengineeringenvironmentalequipmentfieldgeneralhardwarehuman
SHARED TOKENS (37): "applied", "architecture", "artificial", "automation", "cannot", "complex", "computer", "concerns", "construction", "data", "describes", "different", "distinction", "engineering", "environmental", "equipment", "field", "general", "hardware", "human".... | EXACT TITLE in technology: "Computer science".
0.500
advancedagenciesaircollegecontractcontractsdefensedepartmentdepartmentsdevelopmentdirectlyexecutivefederalgovernmentheadquarteredintelligencelogisticsmanagementnationaloffice
SHARED TOKENS (31): "advanced", "agencies", "air", "college", "contract", "contracts", "defense", "department", "departments", "development", "directly", "executive", "federal", "government", "headquartered", "intelligence", "logistics", "management", "national", "office".... | EXACT TITLE in aerospace_defense: "United States Department of Defense".
0.500
academicanalystsaroundbeganbeginningcontrolcriticaldistinctelectricalengineeringengineersfieldhelpshistoryinstitutionsknowledgemajormaterialsmechanicalperformance
SHARED TOKENS (30): "academic", "analysts", "around", "began", "beginning", "control", "critical", "distinct", "electrical", "engineering", "engineers", "field", "helps", "history", "institutions", "knowledge", "major", "materials", "mechanical", "performance".... | EXACT TITLE in aerospace_defense: "Materials science". | EXACT TITLE in technology: "Materials science".
0.500
abilitybusinessesconstructioncontractsdirecteconomyenterpriseglobalgovernmentgovernmentsgroupgrowthkeylocalorganizationpracticesprivateprocessprocurementproduce
SHARED TOKENS (29): "ability", "businesses", "construction", "contracts", "direct", "economy", "enterprise", "global", "government", "governments", "group", "growth", "key", "local", "organization", "practices", "private", "process", "procurement", "produce".... | EXACT TITLE in aerospace_defense: "Government procurement".
0.500
aroundbecomebusinessbusinessescomcomputercomputingcontractcustomersdatadevelopeddirectlydistributionenterpriseequipmentestablishformerfoundedgovernmenthardware
SHARED TOKENS (44): "around", "become", "business", "businesses", "com", "computer", "computing", "contract", "customers", "data", "developed", "directly", "distribution", "enterprise", "equipment", "establish", "former", "founded", "government", "hardware".... | EXACT TITLE in technology: "Hewlett-Packard".
0.500
accessbegancommunicationsdatadevelopersdevelopmentearlyelectricalglobalmeansphysicalpowersingletechnologytransmissionwireless
SHARED TOKENS (16): "access", "began", "communications", "data", "developers", "development", "early", "electrical", "global", "means", "physical", "power", "single", "technology", "transmission", "wireless". | EXACT TITLE in technology: "Telecommunications".
0.500
Airspace ↗ Q272730 EXACT TITLE
aircontroldefenseestablishedflightlegalmanagementnationaloperationsorganizationregulatoryspacetechnicaltrafficvertical
SHARED TOKENS (15): "air", "control", "defense", "established", "flight", "legal", "management", "national", "operations", "organization", "regulatory", "space", "technical", "traffic", "vertical". | EXACT TITLE in aerospace_defense: "Airspace".
0.500
accesscomprehensivecomputerdatadifferentessentialidentitymanageonlineorganizationplatformsprofilepublicrangerecordssecuritysocialsystems
SHARED TOKENS (18): "access", "comprehensive", "computer", "data", "different", "essential", "identity", "manage", "online", "organization", "platforms", "profile", "public", "range", "records", "security", "social", "systems". | EXACT TITLE in technology: "Digital identity".
0.500
businessescloudcomputingconsumerdevelopmentelectronicsgloballylargestmanufacturingproductsresearchsoftwarestoragesupporttechnologyvalley
SHARED TOKENS (16): "businesses", "cloud", "computing", "consumer", "development", "electronics", "globally", "largest", "manufacturing", "products", "research", "software", "storage", "support", "technology", "valley". | EXACT TITLE in technology: "Technology company".
0.500
analysisappliedassetbecomecriticaldesignedeffectsengineeringenvironmentalequipmentexampleexecutivehardwarehumanmajormanagementmodelmultipleprocessproduction
SHARED TOKENS (27): "analysis", "applied", "asset", "become", "critical", "designed", "effects", "engineering", "environmental", "equipment", "example", "executive", "hardware", "human", "major", "management", "model", "multiple", "process", "production".... | EXACT TITLE in aerospace_defense: "Safety-critical system".
0.500
capitalestatefinancialfirmsgrowthindustriallargestmanagementmanufacturingofficesprivaterangerealsolutionstechnology
SHARED TOKENS (15): "capital", "estate", "financial", "firms", "growth", "industrial", "largest", "management", "manufacturing", "offices", "private", "range", "real", "solutions", "technology". | EXACT TITLE in technology: "Warburg Pincus".
0.500
becomecentercomplexcomputercontrolcreatescriticaldatadesigneddirectelectricalengineeringexamplehumanimportantindustrymeansperformancepoliticalpower
SHARED TOKENS (28): "become", "center", "complex", "computer", "control", "creates", "critical", "data", "designed", "direct", "electrical", "engineering", "example", "human", "important", "industry", "means", "performance", "political", "power".... | EXACT TITLE in technology: "Redundancy (engineering)".
0.500
Data center ↗ Q671224 EXACT TITLE
aroundartificialbusinesscentercenterscloudcomputercontrolscriticaldatademandedgeendenterpriseenvironmentalfacilitiesfacilityfinancialfireglobal
SHARED TOKENS (54): "around", "artificial", "business", "center", "centers", "cloud", "computer", "controls", "critical", "data", "demand", "edge", "end", "enterprise", "environmental", "facilities", "facility", "financial", "fire", "global".... | EXACT TITLE in technology: "Data center".
0.500
academicanalysisanothercapacitycommercialcomprehensiveconnectingcontrolcoredevelopmentfundingglobalgovernmentimportantindustrialinstitutionsknowledgemarketmeansorganization
SHARED TOKENS (29): "academic", "analysis", "another", "capacity", "commercial", "comprehensive", "connecting", "control", "core", "development", "funding", "global", "government", "important", "industrial", "institutions", "knowledge", "market", "means", "organization".... | EXACT TITLE in aerospace_defense: "Technology transfer".
0.500
Evidence ↗ Q1347572 EXACT TITLE
accessconnectiondescribesdifferentestablisheventsexamplegeneralknowledgelawmakesphysicalprivateproblemsrelevantrolesciencesupportingunderstand
SHARED TOKENS (19): "access", "connection", "describes", "different", "establish", "events", "example", "general", "knowledge", "law", "makes", "physical", "private", "problems", "relevant", "role", "science", "supporting", "understand". | EXACT TITLE in aerospace_defense: "Evidence".
0.480
acquisitionactiveairengineflightfoundedlearningprivateschoolschoolsskillsstudentsthereforetraining
SHARED TOKENS (14): "acquisition", "active", "air", "engine", "flight", "founded", "learning", "private", "school", "schools", "skills", "students", "therefore", "training". | EXACT TITLE in aerospace_defense: "Flight training".
0.480
automationbecomeeffectselectronicsequipmentlargermaterialsmeansrequiressemiconductorsmallsmallersoftwarespecialized
SHARED TOKENS (14): "automation", "become", "effects", "electronics", "equipment", "larger", "materials", "means", "requires", "semiconductor", "small", "smaller", "software", "specialized". | EXACT TITLE in technology: "Microelectronics".
0.480
commercialdesignedfederalflightgeneralmaintenancemodeloperationspublicriskspacestructuresystemstraining
SHARED TOKENS (14): "commercial", "designed", "federal", "flight", "general", "maintenance", "model", "operations", "public", "risk", "space", "structure", "systems", "training". | EXACT TITLE in aerospace_defense: "Federal Aviation Regulations".
0.460
capitalestatefinancefinancialheadquarteredinvestmentmanagementofficeprivaterealspecializedtechnologyventure
SHARED TOKENS (13): "capital", "estate", "finance", "financial", "headquartered", "investment", "management", "office", "private", "real", "specialized", "technology", "venture". | EXACT TITLE in technology: "Iconiq Capital".
0.460
actairbasecontroldefensedepartmentdifferentdirectdistinctheadquarteredneedoperationswork
SHARED TOKENS (13): "act", "air", "base", "control", "defense", "department", "different", "direct", "distinct", "headquartered", "need", "operations", "work". | EXACT TITLE in aerospace_defense: "United States Special Operations Command".
0.460
Equifax ↗ Q5384453 EXACT TITLE
agenciesannualbusinessbusinessesconsumerdatadirectlyheadquarteredlargestmonitoringoperatespacificreporting
SHARED TOKENS (13): "agencies", "annual", "business", "businesses", "consumer", "data", "directly", "headquartered", "largest", "monitoring", "operates", "pacific", "reporting". | EXACT TITLE in technology: "Equifax".
0.460
HP Inc. ↗ Q21404084 EXACT TITLE
businesscomputerenterprisefoundedheadquartersitselflegalproductrelatedsalesservingsuppliestechnology
SHARED TOKENS (13): "business", "computer", "enterprise", "founded", "headquarters", "itself", "legal", "product", "related", "sales", "serving", "supplies", "technology". | EXACT TITLE in technology: "HP Inc.".
0.440
academicadvancedconnectsdepartmentemployersindustryjoblaborlearningprogramskillsworkers
SHARED TOKENS (12): "academic", "advanced", "connects", "department", "employers", "industry", "job", "labor", "learning", "program", "skills", "workers". | EXACT TITLE in technology: "Registered apprenticeship".
0.440
departmentfederalfundingfutureidahoinfrastructuremaintenanceoperationsorganizationplanningprogramstransportation
SHARED TOKENS (12): "department", "federal", "funding", "future", "idaho", "infrastructure", "maintenance", "operations", "organization", "planning", "programs", "transportation". | EXACT TITLE in aerospace_defense: "Idaho Transportation Department".
0.440
buildingbusinessequipmentindustrialinfrastructuremaintenanceoperationalpracticesresidentialsupportingtechnicalutilities
SHARED TOKENS (12): "building", "business", "equipment", "industrial", "infrastructure", "maintenance", "operational", "practices", "residential", "supporting", "technical", "utilities". | EXACT TITLE in aerospace_defense: "Maintenance". | EXACT TITLE in technology: "Maintenance".
0.440
dependdesigneddevelopmentdifferentfuelhumanlargerisksmallertoolsvehicleswork
SHARED TOKENS (12): "depend", "designed", "development", "different", "fuel", "human", "large", "risk", "smaller", "tools", "vehicles", "work". | EXACT TITLE in aerospace_defense: "Wildfire suppression".
0.440
airaroundcommercialcomplianceestablishedgeneralintendedlawmanufacturingnationalproductionprogram
SHARED TOKENS (12): "air", "around", "commercial", "compliance", "established", "general", "intended", "law", "manufacturing", "national", "production", "program". | EXACT TITLE in aerospace_defense: "Type certificate".
0.420
apprenticeshipsfieldformalhelpsjoblaboroutsidereachsystemtradestraining
SHARED TOKENS (11): "apprenticeships", "field", "formal", "helps", "job", "labor", "outside", "reach", "system", "trades", "training". | EXACT TITLE in aerospace_defense: "Apprenticeship". | EXACT TITLE in technology: "Apprenticeship".
0.420
businessfinancialinvestmentorganizationprocessingrecordsrelationshipsreportingsoftwaresystemtransaction
SHARED TOKENS (11): "business", "financial", "investment", "organization", "processing", "records", "relationships", "reporting", "software", "system", "transaction". | EXACT TITLE in technology: "Financial software".
0.420
departmentdivisionfederalmajorofficeprogramprogramspublicroadroletransportation
SHARED TOKENS (11): "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in aerospace_defense: "Federal Highway Administration".
0.400
Colocation ↗ Q2983522 EXACT TITLE
businesscentercomputingdataequipmentofficesinglespacestructuresystem
SHARED TOKENS (10): "business", "center", "computing", "data", "equipment", "office", "single", "space", "structure", "system". | EXACT TITLE in technology: "Colocation".
0.400
aircommercialgeneraloperationsorganizationprivatespecializedtransportationuseswork
SHARED TOKENS (10): "air", "commercial", "general", "operations", "organization", "private", "specialized", "transportation", "uses", "work". | EXACT TITLE in aerospace_defense: "General aviation".
0.400
Hangar ↗ Q192375 EXACT TITLE
aroundbuildingcloseddesigneddirectgroupmaintenancenearstoragestructure
SHARED TOKENS (10): "around", "building", "closed", "designed", "direct", "group", "maintenance", "near", "storage", "structure". | EXACT TITLE in aerospace_defense: "Hangar".
0.400
Multirotor ↗ Q3772377 EXACT TITLE
advantagecomplexconstructioncontrolflightpowerrangesinglesmallvertical
SHARED TOKENS (10): "advantage", "complex", "construction", "control", "flight", "power", "range", "single", "small", "vertical". | EXACT TITLE in aerospace_defense: "Multirotor".
0.400
Ransomware ↗ Q926331 EXACT TITLE
centerdataearlyexamplefederalgloballylawsecurityshowingsoftware
SHARED TOKENS (10): "center", "data", "early", "example", "federal", "globally", "law", "security", "showing", "software". | EXACT TITLE in technology: "Ransomware".
0.400
buildingdefensegovernmentindustrymaintenancemanufacturermanufacturingproductionsupportingtechnology
SHARED TOKENS (10): "building", "defense", "government", "industry", "maintenance", "manufacturer", "manufacturing", "production", "supporting", "technology". | EXACT TITLE in aerospace_defense: "Aerospace manufacturer".
0.400
approvalchangescomplianceengineexamplefederallocalmajorpowerusa
SHARED TOKENS (10): "approval", "changes", "compliance", "engine", "example", "federal", "local", "major", "power", "usa". | EXACT TITLE in aerospace_defense: "Supplemental type certificate".
0.400
Permira ↗ Q662030 EXACT TITLE
capitalfirmsfoundedglobalinvestmentlargestofficesoperatingprivatespecialists
SHARED TOKENS (10): "capital", "firms", "founded", "global", "investment", "largest", "offices", "operating", "private", "specialists". | EXACT TITLE in technology: "Permira".
0.400
airportcanyonexecutivefacilityformerlyidahopublicsmallertreasurevalley
SHARED TOKENS (10): "airport", "canyon", "executive", "facility", "formerly", "idaho", "public", "smaller", "treasure", "valley". | EXACT TITLE in aerospace_defense: "Caldwell Executive Airport".
0.380
Bell 206 ↗ Q660969 EXACT TITLE
conversiondevelopedflightlatermodelplansprogramsingleutility
SHARED TOKENS (9): "conversion", "developed", "flight", "later", "model", "plans", "program", "single", "utility". | EXACT TITLE in aerospace_defense: "Bell 206".
0.380
begandepartmentidaholawmunicipalorganizationpolicepublicstatewide
SHARED TOKENS (9): "began", "department", "idaho", "law", "municipal", "organization", "police", "public", "statewide". | EXACT TITLE in aerospace_defense: "Idaho State Police".
0.380
campusfoundedidahomeridianprogramspublicresearchstudentsuniversity
SHARED TOKENS (9): "campus", "founded", "idaho", "meridian", "programs", "public", "research", "students", "university". | EXACT TITLE in aerospace_defense: "Idaho State University".
0.380
Avionics ↗ Q221329 EXACT TITLE
communicationsearlyelectronicsmanagementmultipleplatformpolicesystemsystems
SHARED TOKENS (9): "communications", "early", "electronics", "management", "multiple", "platform", "police", "system", "systems". | EXACT TITLE in aerospace_defense: "Avionics".
0.360
airboisechaingeneralheadquarteredidahonationaloffice
SHARED TOKENS (8): "air", "boise", "chain", "general", "headquartered", "idaho", "national", "office". | EXACT TITLE in aerospace_defense: "Idaho Air National Guard".
0.360
activeairbecomefederalmakesnationalregionrole
SHARED TOKENS (8): "active", "air", "become", "federal", "makes", "national", "region", "role". | EXACT TITLE in aerospace_defense: "Air National Guard".
0.360
airbegandesignedfoundedfoundermanufacturermanufacturingmodel
SHARED TOKENS (8): "air", "began", "designed", "founded", "founder", "manufacturer", "manufacturing", "model". | EXACT TITLE in aerospace_defense: "Air Tractor".
0.360
acquisitionbusinessfinancialgrouplargersmallertaxtreatment
SHARED TOKENS (8): "acquisition", "business", "financial", "group", "larger", "smaller", "tax", "treatment". | EXACT TITLE in aerospace_defense: "Consolidation (business)".
0.350
airboisedepartmentformerlygovernmentheadquartersidahonationalsecuritystaff
SHARED TOKENS (10): "air", "boise", "department", "formerly", "government", "headquarters", "idaho", "national", "security", "staff". | URL->A (2): https://www.imd.idaho.gov/idaho-air-national-guard/, https://www.imd.idaho.gov/idaho-national-guard/our-history/.
0.340
aircapacitydevelopmentintersectionmeansnationalsupply
SHARED TOKENS (7): "air", "capacity", "development", "intersection", "means", "national", "supply". | EXACT TITLE in aerospace_defense: "Military aviation".
0.340
commercedepartmentdevelopmentgrowthidahopublictax
SHARED TOKENS (7): "commerce", "department", "development", "growth", "idaho", "public", "tax". | EXACT TITLE in aerospace_defense: "Idaho Department of Commerce". | EXACT TITLE in technology: "Idaho Department of Commerce".
0.340
departmentdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (7): "department", "development", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in technology: "Idaho Department of Labor".
0.320
conversionmaterialsoperatesourcessystemvisible
SHARED TOKENS (6): "conversion", "materials", "operate", "sources", "system", "visible". | EXACT TITLE in aerospace_defense: "Image intensifier".
0.300
abilityarchitecturebuildcenterscloudcomputercomputingdatademanddistributedenvironmentsinfrastructurelargelargermanagementmapnodenodesoperatingprocessing
SHARED TOKENS (25): "ability", "architecture", "build", "centers", "cloud", "computer", "computing", "data", "demand", "distributed", "environments", "infrastructure", "large", "larger", "management", "map", "node", "nodes", "operating", "processing"....
0.300
Meta Platforms ↗ Q380 KW CROSS HIGH
businessdevelopmentecosystemestablishedglobalheadquarteredlargestmarketnetworkoperatesplatformspublicrebrandedresearchsitessocialstrategictechnology
SHARED TOKENS (18): "business", "development", "ecosystem", "established", "global", "headquartered", "largest", "market", "network", "operates", "platforms", "public", "rebranded", "research", "sites", "social", "strategic", "technology".
0.300
Moore's law ↗ Q178655 KW CROSS HIGH
annualanotheraroundbecomecapacitychangesdescribesdevelopmentelectronicsevenexecutiveformergrowthhistoricalindustrylawplanningproductionreportresearch
SHARED TOKENS (23): "annual", "another", "around", "become", "capacity", "changes", "describes", "development", "electronics", "even", "executive", "former", "growth", "historical", "industry", "law", "planning", "production", "report", "research"....
0.300
acquisitionartificialchaincommercialcreatedirectearlyfuturehavingintelligencelargelargermedicalmodernmultipleoperateoperationaloperationsorganizedplatforms
SHARED TOKENS (29): "acquisition", "artificial", "chain", "commercial", "create", "direct", "early", "future", "having", "intelligence", "large", "larger", "medical", "modern", "multiple", "operate", "operational", "operations", "organized", "platforms"....
0.300
accesscentercenterschemicaldepartmentemergencyfirelinelocalmedicalnetworkoperatorspointpolicepublicsafetysystemtrained
SHARED TOKENS (18): "access", "center", "centers", "chemical", "department", "emergency", "fire", "line", "local", "medical", "network", "operators", "point", "police", "public", "safety", "system", "trained".
0.300
airaroundcommercialcontroldirectemergencyflightmaintainneedoperationsprivatesafetyspacesupporttraffic
SHARED TOKENS (15): "air", "around", "commercial", "control", "direct", "emergency", "flight", "maintain", "need", "operations", "private", "safety", "space", "support", "traffic".
0.300
academicdistincteducationintendedjobslargestlearninglongeroperatespracticalprogramprogramsschoolstudentstransitionuniversityworkworkforce
SHARED TOKENS (18): "academic", "distinct", "education", "intended", "jobs", "largest", "learning", "longer", "operates", "practical", "program", "programs", "school", "students", "transition", "university", "work", "workforce".
0.300
E-government ↗ Q211017 KW CROSS HIGH
accessagenciesbuildbusinessbusinesseschangesdeliverydirectdirectlyeducationestablishedgovernmentgovernmentsintroductionitselfmanagementmeansnationalorganizationparticipation
SHARED TOKENS (27): "access", "agencies", "build", "business", "businesses", "changes", "delivery", "direct", "directly", "education", "established", "government", "governments", "introduction", "itself", "management", "means", "national", "organization", "participation"....
0.300
advancedairappliedcontrolcreateendenvironmentsequipmentfacilitieshandlinghelpshighlyindustrialindustryinsidelargemachinemaintainmanufacturingmaterials
SHARED TOKENS (31): "advanced", "air", "applied", "control", "create", "end", "environments", "equipment", "facilities", "handling", "helps", "highly", "industrial", "industry", "inside", "large", "machine", "maintain", "manufacturing", "materials"....
0.300
compliancemaintainmaintenanceperformancereplacement
SHARED TOKENS (5): "compliance", "maintain", "maintenance", "performance", "replacement". | EXACT TITLE in aerospace_defense: "Aircraft maintenance".
0.300
Network security ↗ KW CROSS HIGH
accessagenciesbusinessescommunicationscomputercontrolcontrolsdatagovernmentinstitutionsjobsnetworkoperationspracticesprivateprogramspublicsecurity
SHARED TOKENS (18): "access", "agencies", "businesses", "communications", "computer", "control", "controls", "data", "government", "institutions", "jobs", "network", "operations", "practices", "private", "programs", "public", "security".
0.300
Arms industry ↗ Q392933 KW CROSS HIGH
academicbasecommercialcommunicationscustomersdefensedevelopmentelectronicsengineeringequipmentfacilitiesfirmsglobalgovernmentsindustrialindustryinstitutionslegalmaintainmatter
SHARED TOKENS (37): "academic", "base", "commercial", "communications", "customers", "defense", "development", "electronics", "engineering", "equipment", "facilities", "firms", "global", "governments", "industrial", "industry", "institutions", "legal", "maintain", "matter"....
0.300
aroundbegancloudcomputingcustomersdeliverydevelopmenteconomyhardwareinfrastructuremodeloperatingphysicalplatformpracticesproductsprovidersharesoftwaresystems
SHARED TOKENS (20): "around", "began", "cloud", "computing", "customers", "delivery", "development", "economy", "hardware", "infrastructure", "model", "operating", "physical", "platform", "practices", "products", "provider", "share", "software", "systems".
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
buildconcernscustomersdifferentdistributionelectricalequipmentlargelinepowerpublicrelatedresidentialsafetysouthstreetsupportsystemsystemstransmission
SHARED TOKENS (24): "build", "concerns", "customers", "different", "distribution", "electrical", "equipment", "large", "line", "power", "public", "related", "residential", "safety", "south", "street", "support", "system", "systems", "transmission"....
0.300
actbusinessesemployersfederalgrouphealthcareindustriesinsurancejobslawmedicalnationalplansprovidersrequirerequiresworkers
SHARED TOKENS (17): "act", "businesses", "employers", "federal", "group", "healthcare", "industries", "insurance", "jobs", "law", "medical", "national", "plans", "providers", "require", "requires", "workers".
0.300
capacitycomputerconversiondatadefiningdemanddifferentdirectlyearlyelectronicskeylargestmajormanagemanufacturersmarketmicronmodernneedoperate
SHARED TOKENS (33): "capacity", "computer", "conversion", "data", "defining", "demand", "different", "directly", "early", "electronics", "key", "largest", "major", "manage", "manufacturers", "market", "micron", "modern", "need", "operate"....
0.300
acquireacquiringadvancedbecomebeganbeginningchaindefensedevelopeddevelopmentlatermodelmultipleproductionprogramsecurityseptembersingaporespacesystems
SHARED TOKENS (20): "acquire", "acquiring", "advanced", "become", "began", "beginning", "chain", "defense", "developed", "development", "later", "model", "multiple", "production", "program", "security", "september", "singapore", "space", "systems".
0.300
activeairbusinesscontroldesigneddevelopedengineexportfacilityflightgeneralhelpsintroductionkeylongermanufacturingmultiplenationaloperationaloperators
SHARED TOKENS (27): "active", "air", "business", "control", "designed", "developed", "engine", "export", "facility", "flight", "general", "helps", "introduction", "key", "longer", "manufacturing", "multiple", "national", "operational", "operators"....
0.300
Flash memory ↗ Q174077 KW CROSS HIGH
accessadvantagearchitecturebecomebegancapabilitiescomputerdatadifferentdirectdirectlyelectronicsentiregeneralindustrialinsidekeylargelinemachine
SHARED TOKENS (35): "access", "advantage", "architecture", "become", "began", "capabilities", "computer", "data", "different", "direct", "directly", "electronics", "entire", "general", "industrial", "inside", "key", "large", "line", "machine"....
0.300
actanalystschaincomputingdevelopmentdivisiondomesticecosystemequipmentfederalformerfundinghumanindustryinvestmentjobslawmanufacturingmaterialsproduce
SHARED TOKENS (34): "act", "analysts", "chain", "computing", "development", "division", "domestic", "ecosystem", "equipment", "federal", "former", "funding", "human", "industry", "investment", "jobs", "law", "manufacturing", "materials", "produce"....
0.300
boisecomputerconsumerdatademandelectronicsfoundedidahomajormanufacturermanufacturersmarketmicronproductsreachsemiconductorsouthstoragetechnology
SHARED TOKENS (19): "boise", "computer", "consumer", "data", "demand", "electronics", "founded", "idaho", "major", "manufacturer", "manufacturers", "market", "micron", "products", "reach", "semiconductor", "south", "storage", "technology".
0.300
Smart city ↗ Q1231558 KW CROSS HIGH
buildingsbusinessescapitalconnecteddataeducationfuturegovernmentgovernmentshealthcarehumaninfrastructurelargestlocalmanagemodelmovenetworkoperateperformance
SHARED TOKENS (34): "buildings", "businesses", "capital", "connected", "data", "education", "future", "government", "governments", "healthcare", "human", "infrastructure", "largest", "local", "manage", "model", "move", "network", "operate", "performance"....
0.300
Aviation law ↗ Q1761534 KW CROSS HIGH
airairportbeyondbusinesscannotconcernsdirectlyexamplefallfederalfieldflightgenerallawlegalmanufacturersmattermattersorganizationproducts
SHARED TOKENS (26): "air", "airport", "beyond", "business", "cannot", "concerns", "directly", "example", "fall", "federal", "field", "flight", "general", "law", "legal", "manufacturers", "matter", "matters", "organization", "products"....
0.300
actcontroldefensedevelopmentexportgovernmentsindustrylawmanufacturersplacesprogramprojectreportrequiressalestrategicsupporttechnologytrades
SHARED TOKENS (19): "act", "control", "defense", "development", "export", "governments", "industry", "law", "manufacturers", "places", "program", "project", "report", "requires", "sale", "strategic", "support", "technology", "trades".
0.300
Remote work ↗ Q1135326 KW CROSS HIGH
accessadvantagesanotheraroundbeganbridgecloudcomputingcontrolsdevelopeddistributedemployersenvironmentalevenjoblargenetworkofficeofficespool
SHARED TOKENS (30): "access", "advantages", "another", "around", "began", "bridge", "cloud", "computing", "controls", "developed", "distributed", "employers", "environmental", "even", "job", "large", "network", "office", "offices", "pool"....
0.300
begancentercomputingconnecteddatadeliverydistributedearlyedgemanagemodelnearphysicallyplacesourcesstoragesystems
SHARED TOKENS (17): "began", "center", "computing", "connected", "data", "delivery", "distributed", "early", "edge", "manage", "model", "near", "physically", "place", "sources", "storage", "systems".
0.300
advancedanalysisanotherapplieddetectiondirectelectricalengineeringequipmentfieldgrouphandlinghighlyindustryinfrastructurematerialsmechanicalmedicalproductremote
SHARED TOKENS (31): "advanced", "analysis", "another", "applied", "detection", "direct", "electrical", "engineering", "equipment", "field", "group", "handling", "highly", "industry", "infrastructure", "materials", "mechanical", "medical", "product", "remote"....
0.300
fieldgeneralgroupnationalwater
SHARED TOKENS (5): "field", "general", "group", "national", "water". | EXACT TITLE in aerospace_defense: "Search and rescue".
0.300
Help desk ↗ Q2055062 KW CROSS HIGH
analystscomputercustomersdepartmentdevelopmentdifferentknowledgelargeorganizationplanningpositionproblemsproductproductsresearchspecializedstructuresupportsystemstechnical
SHARED TOKENS (24): "analysts", "computer", "customers", "department", "development", "different", "knowledge", "large", "organization", "planning", "position", "problems", "product", "products", "research", "specialized", "structure", "support", "systems", "technical"....
0.300
anotherconcernscriticalcurriculumdepartmentdevelopmenteconomicseconomyeducationengineeringgroupjoblabornationalnetonlinepolicypoliticalrebrandedrelated
SHARED TOKENS (32): "another", "concerns", "critical", "curriculum", "department", "development", "economics", "economy", "education", "engineering", "group", "job", "labor", "national", "net", "online", "policy", "political", "rebranded", "related"....
0.300
connectscurrentcustomersdeliverydirectdirectlydistinctdistributionelectricalevenhandlinghistoricallyindustrylinelocalmajormarketnetworkpowersite
SHARED TOKENS (22): "connects", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "electrical", "even", "handling", "historically", "industry", "line", "local", "major", "market", "network", "power", "site"....
0.300
acquirecentercreatefoundedfreightheadquartereditselflaternetworkoperatesoperatingpacificplansprojectreachreportingroadsystemtransportationwest
SHARED TOKENS (21): "acquire", "center", "create", "founded", "freight", "headquartered", "itself", "later", "network", "operates", "operating", "pacific", "plans", "project", "reach", "reporting", "road", "system", "transportation", "west"....
0.300
Fraud ↗ Q28813 EXACT TITLE
anotheritselflawlegaltravel
SHARED TOKENS (5): "another", "itself", "law", "legal", "travel". | EXACT TITLE in technology: "Fraud".
0.300
airdefensedepartmentdepartmentsendfieldfoundedkeylandlargestmajormaterialsnationaloperatesstaffsystemstrainingvehicleswestern
SHARED TOKENS (19): "air", "defense", "department", "departments", "end", "field", "founded", "key", "land", "largest", "major", "materials", "national", "operates", "staff", "systems", "training", "vehicles", "western".
0.300
buildbusinesscontrolcustomercustomersmanagementnetworkoperateorganizationprocessqualityreportsupportsystemstechnologyuses
SHARED TOKENS (16): "build", "business", "control", "customer", "customers", "management", "network", "operate", "organization", "process", "quality", "report", "support", "systems", "technology", "uses".
0.300
computercontroldegreedevelopeddifferentdistributionelectricalelectronicsengineeringengineersequipmentformerlyhardwarehistoricallyindustrieslearningmachinemanagementmanufacturingmaterials
SHARED TOKENS (35): "computer", "control", "degree", "developed", "different", "distribution", "electrical", "electronics", "engineering", "engineers", "equipment", "formerly", "hardware", "historically", "industries", "learning", "machine", "management", "manufacturing", "materials"....
0.300
airappliedcommercialengineenginesenvironmentalfarmshighlyproductproductspublicsinglespecializedusawater
SHARED TOKENS (15): "air", "applied", "commercial", "engine", "engines", "environmental", "farms", "highly", "product", "products", "public", "single", "specialized", "usa", "water".
0.300
airdifferentfederalnationalorganized
SHARED TOKENS (5): "air", "different", "federal", "national", "organized". | EXACT TITLE in aerospace_defense: "Army National Guard".
0.300
annualcapacitychemicaleconomyelectronicsfacilityfactoryfoodgroupidahoimportantindustrieslandlargestmajormanufacturingprocessingproductproducts
SHARED TOKENS (19): "annual", "capacity", "chemical", "economy", "electronics", "facility", "factory", "food", "group", "idaho", "important", "industries", "land", "largest", "major", "manufacturing", "processing", "product", "products".
0.300
businesscustomerearlyindustrylaborlinemaintainmanagementmodelorganizationproblemsproductproductionqualitystrategicsystemsystems
SHARED TOKENS (17): "business", "customer", "early", "industry", "labor", "line", "maintain", "management", "model", "organization", "problems", "product", "production", "quality", "strategic", "system", "systems".
0.300
earlyestablishedfederalgovernmentgovernmentshistoryimportantlaterlawlegallocalmeansphysicalplaceprocessruleseptember
SHARED TOKENS (17): "early", "established", "federal", "government", "governments", "history", "important", "later", "law", "legal", "local", "means", "physical", "place", "process", "rule", "september".
0.300
buildingbuildingscampuscapacityclustercomputerconnectedconnectionsconnectscoredepartmentsdifferentexamplelargenetworkwireless
SHARED TOKENS (16): "building", "buildings", "campus", "capacity", "cluster", "computer", "connected", "connections", "connects", "core", "departments", "different", "example", "large", "network", "wireless".
0.300
appliedautomationcommercecontrolcontrolsdesigneddirectendequipmentexportgeneralindustrymanufacturingproductssecuritysoftwaretechnology
SHARED TOKENS (17): "applied", "automation", "commerce", "control", "controls", "designed", "direct", "end", "equipment", "export", "general", "industry", "manufacturing", "products", "security", "software", "technology".
0.300
abilityairaroundcapabilitiesdesigneddevelopeddirectenteredfacilitieshighlyintendedlandmaintenancemodernperformancepermitspoliticalprogramrolesupport
SHARED TOKENS (22): "ability", "air", "around", "capabilities", "designed", "developed", "direct", "entered", "facilities", "highly", "intended", "land", "maintenance", "modern", "performance", "permits", "political", "program", "role", "support"....
🫐 BERRY54 edges
0.280
acquiringacquisitionagenciesdefensedescribesexecutivefederalgovernmentmultipleprocurementproductssupplierssystemvalue
SHARED TOKENS (14): "acquiring", "acquisition", "agencies", "defense", "describes", "executive", "federal", "government", "multiple", "procurement", "products", "suppliers", "system", "value".
0.280
HP LaserJet ↗ Q4040290 KW CROSS HIGH
basedifferentearlyengineshistorylargerlaterlinemodelofficesreportedservingsuppliestechnology
SHARED TOKENS (14): "base", "different", "early", "engines", "history", "larger", "later", "line", "model", "offices", "reported", "serving", "supplies", "technology".
0.280
activeaircenterdefensedevelopmentengineeringexpectedhighlyonlinepracticalresearchsystemstechnologyvehicles
SHARED TOKENS (14): "active", "air", "center", "defense", "development", "engineering", "expected", "highly", "online", "practical", "research", "systems", "technology", "vehicles".
0.280
acquiredaroundbroaderdevelopedengineenteredintroductionmanufacturermarketmarketsoperatingproductiontrainingwork
SHARED TOKENS (14): "acquired", "around", "broader", "developed", "engine", "entered", "introduction", "manufacturer", "market", "markets", "operating", "production", "training", "work".
0.280
customerdesigneddevelopedmanagementorganizationprocessproductqualityregulatoryrelatedsupportingsystemsystemstools
SHARED TOKENS (14): "customer", "designed", "developed", "management", "organization", "process", "product", "quality", "regulatory", "related", "supporting", "system", "systems", "tools".
0.280
aircomputerdesigneddevelopmenthardwaremodernoperatingpowerprocessprocessingsinglesmallsystemsystems
SHARED TOKENS (14): "air", "computer", "designed", "development", "hardware", "modern", "operating", "power", "process", "processing", "single", "small", "system", "systems".
0.280
Angel investor ↗ Q778274 KW CROSS HIGH
businessbusinessescapitalearlyinvestmentinvestorsonlineportfolioprivaterisksharesmallsupportventure
SHARED TOKENS (14): "business", "businesses", "capital", "early", "investment", "investors", "online", "portfolio", "private", "risk", "share", "small", "support", "venture".
0.280
businessbusinessesgeneralrelated
SHARED TOKENS (4): "business", "businesses", "general", "related". | EXACT TITLE in aerospace_defense: "Business aircraft".
0.280
Remote sensing ↗ Q199687 KW CROSS HIGH
acquiringacquisitionactiveappliedcommercialcurrentgeographyintelligencelandon-sitephysicalplanningremotescience
SHARED TOKENS (14): "acquiring", "acquisition", "active", "applied", "commercial", "current", "geography", "intelligence", "land", "on-site", "physical", "planning", "remote", "science".
0.260
airengineengines
SHARED TOKENS (3): "air", "engine", "engines". | EXACT TITLE in aerospace_defense: "Agricultural aircraft".
0.260
Runway ↗ Q184590 EXACT TITLE
designedfeetwater
SHARED TOKENS (3): "designed", "feet", "water". | EXACT TITLE in aerospace_defense: "Runway".
0.260
appearrelevantsingle
SHARED TOKENS (3): "appear", "relevant", "single". | EXACT TITLE in aerospace_defense: "Aircraft registration".
0.260
centercenterscomputercomputingdatadescribesdevelopedequipmentfacilityglobalinfrastructurepoweruses
SHARED TOKENS (13): "center", "centers", "computer", "computing", "data", "describes", "developed", "equipment", "facility", "global", "infrastructure", "power", "uses".
0.260
Pilatus PC-12 ↗ Q685211 KW CROSS HIGH
agenciescorporatedepartmentsdesignedexecutivegovernmentlargeoperatorspoliceregionalsmalltransportationutility
SHARED TOKENS (13): "agencies", "corporate", "departments", "designed", "executive", "government", "large", "operators", "police", "regional", "small", "transportation", "utility".
0.260
beginningcomplexdefensedescribeseffectsindustrialindustrypolicypoliticalpublicsciencesuppliessupply
SHARED TOKENS (13): "beginning", "complex", "defense", "describes", "effects", "industrial", "industry", "policy", "political", "public", "science", "supplies", "supply".
0.260
airbusinesseconomyflightgenerallargestorganizationpoliticalrolesafetyseptemberspaceutility
SHARED TOKENS (13): "air", "business", "economy", "flight", "general", "largest", "organization", "political", "role", "safety", "september", "space", "utility".
0.240
agriculturebecomecontroldevelopedenvironmentalessentialfirehumaninfrastructuremonitoringproductsystem
SHARED TOKENS (12): "agriculture", "become", "control", "developed", "environmental", "essential", "fire", "human", "infrastructure", "monitoring", "product", "system".
0.240
actbusinesscorporatefundinghighlyindustrieslargerorganizationprocessprogramspublicrange
SHARED TOKENS (12): "act", "business", "corporate", "funding", "highly", "industries", "larger", "organization", "process", "programs", "public", "range".
0.220
airportcenterdispatchflightlegalmanagementoperationsperformanceplanningsystemwork
SHARED TOKENS (11): "airport", "center", "dispatch", "flight", "legal", "management", "operations", "performance", "planning", "system", "work".
0.220
abilitydifferentemergencyeventsfederalgloballygovernmentslocalmanagementrequiresrisk
SHARED TOKENS (11): "ability", "different", "emergency", "events", "federal", "globally", "governments", "local", "management", "requires", "risk".
0.220
Aviation fuel ↗ Q1875633 KW CROSS HIGH
airdesignedenginesfuelhandlingimportantoperateperformancepowerroadtransportation
SHARED TOKENS (11): "air", "designed", "engines", "fuel", "handling", "important", "operate", "performance", "power", "road", "transportation".
0.220
firewater
SHARED TOKENS (2): "fire", "water". | EXACT TITLE in aerospace_defense: "Aerial firefighting".
0.220
aroundcurrentdifferentfieldmechanicalrangesourcesspacesystemtechnologyuses
SHARED TOKENS (11): "around", "current", "different", "field", "mechanical", "range", "sources", "space", "system", "technology", "uses".
0.220
aircommercialcontroldepartmentfederalgovernmentorganizationspacetraffictransportationvehicles
SHARED TOKENS (11): "air", "commercial", "control", "department", "federal", "government", "organization", "space", "traffic", "transportation", "vehicles".
0.220
customerdemandinfrastructuremanagementmanagesmodelprovidersectorsystemstechnicaltechnology
SHARED TOKENS (11): "customer", "demand", "infrastructure", "management", "manages", "model", "provider", "sector", "systems", "technical", "technology".
0.220
Enfusion ↗ Q5377362 EXACT TITLE
eventsglobally
SHARED TOKENS (2): "events", "globally". | EXACT TITLE in technology: "Enfusion".
0.220
beginningboiseidahointerstatelinemajornearnorthwestoregonrangeveterans
SHARED TOKENS (11): "beginning", "boise", "idaho", "interstate", "line", "major", "near", "northwest", "oregon", "range", "veterans".
0.200
LTE ↗ Q247385 EXACT TITLE
EXACT TITLE in aerospace_defense: "LTE". | EXACT TITLE in technology: "LTE".
0.200
controldevelopmententerprisefieldhumanorganizationphysicalproblemssystemtechnical
SHARED TOKENS (10): "control", "development", "enterprise", "field", "human", "organization", "physical", "problems", "system", "technical".
0.200
Pilatus PC-24 ↗ Q2094874 KW CROSS HIGH
beganbusinesscapabilitycustomerdeliveryengineflightrangesinglework
SHARED TOKENS (10): "began", "business", "capability", "customer", "delivery", "engine", "flight", "range", "single", "work".
0.200
accessadvantageairappliedcontrolelectronicslandoperationsspacesystems
SHARED TOKENS (10): "access", "advantage", "air", "applied", "control", "electronics", "land", "operations", "space", "systems".
0.200
Freight exchange ↗ KW CROSS HIGH
aircapacitycustomersfreightlogisticsneedonlineprivateprovidersroad
SHARED TOKENS (10): "air", "capacity", "customers", "freight", "logistics", "need", "online", "private", "providers", "road".
0.180
Bell 412 ↗ Q815688 KW CROSS HIGH
commercialdevelopmentelectronicsfactoryindustriesintroductionmajormarketsutility
SHARED TOKENS (9): "commercial", "development", "electronics", "factory", "industries", "introduction", "major", "markets", "utility".
0.180
controldefensedepartmentexportlawnationalpolicysecuritytraffic
SHARED TOKENS (9): "control", "defense", "department", "export", "law", "national", "policy", "security", "traffic".
0.180
computerdevelopmentengineeringmaintainmanageprocesssciencesoftwaresystems
SHARED TOKENS (9): "computer", "development", "engineering", "maintain", "manage", "process", "science", "software", "systems".
0.180
airearlyenginelargerpacificperformancesouthsupportvertical
SHARED TOKENS (9): "air", "early", "engine", "larger", "pacific", "performance", "south", "support", "vertical".
0.180
aircontractdevelopedenteredmajoroperationsprogramsystemutility
SHARED TOKENS (9): "air", "contract", "developed", "entered", "major", "operations", "program", "system", "utility".
0.180
highlyindustriesindustrymanufacturingmatterpowersemiconductortreatmentwater
SHARED TOKENS (9): "highly", "industries", "industry", "manufacturing", "matter", "power", "semiconductor", "treatment", "water".
0.160
anotherelectricallocalplaceproductresearcherssecondvisible
SHARED TOKENS (8): "another", "electrical", "local", "place", "product", "researchers", "second", "visible".
0.160
aroundcontrolsengineengineersflightoperatingoperatorssystems
SHARED TOKENS (8): "around", "controls", "engine", "engineers", "flight", "operating", "operators", "systems".
0.160
cannothavinglawpoliceprivateprocessrequirerule
SHARED TOKENS (8): "cannot", "having", "law", "police", "private", "process", "require", "rule".
0.160
developedenvironmentalhumanlandpublicrisktransitiontransmission
SHARED TOKENS (8): "developed", "environmental", "human", "land", "public", "risk", "transition", "transmission".
0.160
accesscloudcomputingdemandnetworkorganizationphysicalpool
SHARED TOKENS (8): "access", "cloud", "computing", "demand", "network", "organization", "physical", "pool".
0.160
anotherconsumerdetectionelectricalexampleindustrialpositionpresence
SHARED TOKENS (8): "another", "consumer", "detection", "electrical", "example", "industrial", "position", "presence".
0.140
designedengineenginesflightpowersmallsystem
SHARED TOKENS (7): "designed", "engine", "engines", "flight", "power", "small", "system".
0.120
developedflightlawsingletraininguses
SHARED TOKENS (6): "developed", "flight", "law", "single", "training", "uses".
0.120
airdevelopedearlyreplacementsmalltraining
SHARED TOKENS (6): "air", "developed", "early", "replacement", "small", "training".
0.120
adaboisecapitalidahomeridiansecond
SHARED TOKENS (6): "ada", "boise", "capital", "idaho", "meridian", "second".
0.120
boisecanyoncollegeidahooregonwest
SHARED TOKENS (6): "boise", "canyon", "college", "idaho", "oregon", "west".
0.120
aircriticalemergencymedicaloperationsvehicles
SHARED TOKENS (6): "air", "critical", "emergency", "medical", "operations", "vehicles".
0.120
accesscommercialorganizationorganizedproviderrelated
SHARED TOKENS (6): "access", "commercial", "organization", "organized", "provider", "related".
0.100
idaholandlargestmajornorthwest
SHARED TOKENS (5): "idaho", "land", "largest", "major", "northwest".
0.100
Bell 212 ↗ Q698242 KW CROSS HIGH
capacitycommercialoperatorsproductionutility
SHARED TOKENS (5): "capacity", "commercial", "operators", "production", "utility".
0.100
Reserved word ↗ Q1192029 KW CROSS HIGH
adaanothercannotdistincttreat
SHARED TOKENS (5): "ada", "another", "cannot", "distinct", "treat".
◈ Frequently Asked Questions
Aerospace Defense × Technology — Treasure Valley
HAIKU · HIGH GATE
How do export control regulations affect aerospace defense companies operating from Boise and Nampa?
Aerospace defense firms in Ada County must comply with federal export control laws when developing technology for military applications, which restricts their ability to share certain technical data with international partners. Boise State University and College of Western Idaho researchers working on defense-related projects face similar restrictions when publishing or collaborating on sensitive work.
What role does machine learning play in aerospace defense operations based in the Treasure Valley?
Machine learning systems developed by Treasure Valley technology companies enable aerospace defense contractors to process sensor data and improve autonomous systems for aircraft and unmanned vehicles. Companies operating near Boise Airport leverage local computing infrastructure and talent from Boise State University to build these advanced systems.
How do geographic information systems support aerospace defense planning in Ada County?
GIS technology allows aerospace defense planners in the Boise area to map terrain, airspace corridors, and facility locations with precision for mission planning and operational analysis. Idaho Power infrastructure data integrated into GIS platforms helps aerospace companies understand power availability for testing facilities across the Treasure Valley.
What computer security challenges face aerospace defense suppliers in the Treasure Valley region?
Aerospace defense contractors operating in Nampa, Boise, and surrounding Ada County facilities must implement advanced computer security measures to protect classified design data and manufacturing specifications. College of Western Idaho and Boise State University cybersecurity programs train the technical workforce these companies require to defend against industrial espionage and state-sponsored attacks.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Aerospace Defense × Technology 16 QID bridges 203 edges 5,447 ext links 2026-07-17 19:16:52 UTC 34ba68b56153f0d4
Aerospace Defense corridor ↗ Technology corridor ↗ Technology × Aerospace Defense ↗ boisestandard.org/standard ↗
Parent Corridors
Aerospace Defense × All Other Verticals