—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Veterinary Animal Services ↔ relates to ↔ Pets

37 Wikipedia bridge articles confirmed in both vertical ledgers. 190 deterministic cross-vertical edges. 5,429 external source links harvested. Every edge provenance-stamped. Every claim auditable.

37 QID Bridge Articles
190 Cross Edges
5,429 External Sources
246 Wikipedia Articles
38 🌲 Evergreen
104 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Veterinary Animal Services
× Pets
QID Bridge Articles
37
confirmed Wikipedia overlap
Total Cross Edges
190
External Sources Harvested
5,429
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
American Veterinary Medical Association
score: 1.0300  ·  type: exact_title_cross  ·  9 shared tokens
QID Bridge Titles (20)
American Veterinary Medical AssociationVeterinary medicinePet insurancePet adoptionDogLivestockRabiesHorseVeterinarianAnimal welfareCatService animalAnimal shelterTreasure ValleyBoise, IdahoVeterinary surgeryNeuteringCruelty to animalsAnimal rescue groupDog grooming
Shared Semantics (20 tokens)
populationdogspetspetboiseidahocaremedicalveterinarymedicinedifferenthealthtreatmenthomedogcontrolspeciesworkpeopleada
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:48:48 UTC
Content Hash
92cf10e4893f55d5
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
37 BRIDGES
A
Q2843064 EXACT TITLE 1.030
QID OVERLAP: Q2843064 in veterinary_animal_services (tier:evergreen) and pets (tier:branch). | SHARED TOKENS (9): "education", "food", "medical", "medicine", "organization", "products", "supports", "veterinarians", "veterinary". | URL->A (1): http://avma.org/. | EXACT TITLE in veterinary_animal_services: "American Veterinary Medical Association".
educationfoodmedicalmedicineorganizationproductssupportsveterinariansveterinary
an Veterinary Medical Association (AVMA) is an American not-for-profit association founded in 1863 that represents more than 105,000 veterinarians. The AVMA provides information resources, continuing education opportunities, publications, and discounts on personal and professional products, programs, and services.
AVMA indicates that it lobbies for animal friendly legislation within a framework that supports the use of animals for human purposes (e.g., food, fiber, research, companionship). The AVMA Council on Education is the designated accrediting body for schools of veterinary medicine in the United States. The AVMA publishes the Journal of the American Veterinary Medical Association (JAVMA) and the American Journal of Veterinary Research (AJVR). The AVMA's veterinary student organization is the Student American Veterinary Medical Association (SAVMA).
Legislation AVMA supported the Veterinary Medicine Mobility Act of 2014, a law that amended the Controlled Substances Act (CSA) to clarify that veterinarians are not required to have separate registrations to dispense controlled substances outside of their principal place of business, such as when treating animals on a farm. AVMA argued that "the CSA must be amended so that our nation's animals do not suffer unnecessarily." Due to an interpretation of the law by the Drug Enforcement Administration, veterinarians were not allowed to travel to their off-site animal patients with controlled substances. Academic Accreditation The United States Department of Education has designated the AVMA Council on Education as the accrediting body for schools of veterinary medicine in the United States. In this capacity, the AVMA develops and maintains educational standards for these institutions to ensure the qualifications and competency of graduates of veterinary schools. Two bodies within AVMA are responsible for veterinary education accreditation: the AVMA Council on Education (COE) and the Committee on Veterinary Technician Education and Activities (CVTEA).
Veterinary medicine
EXACT TITLE 1.000
QID OVERLAP: Q170201 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (26): "affect", "care", "control", "dentistry", "different", "disease", "food", "health", "keep", "livestock", "management", "medical", "medicine", "pets", "roles", "safety", "species", "supervision", "supply", "treat".... | EXACT TITLE in veterinary_animal_services: "Veterinary medicine". | EXACT TITLE in pets: "Veterinary medicine".
affectcarecontroldentistrydifferentdiseasefoodhealthkeeplivestockmanagementmedicalmedicinepetsrolessafetyspeciessupervisionsupplytreattreatmentveterinarianveterinariansveterinarywelfarework
t, diagnosis, and treatment of disease, disorder, and injury in non-human animals. Its scope is wide, covering all animal species, both domesticated and wild, with a wide range of conditions that can affect different species. Veterinary medicine is practiced both with and without professional supervision. Professional care is most often led by a veterinary physician (also known as a veterinarian, veterinary surgeon, or "vet"), but also by paraveterinary workers, including veterinary nurses, veterinary technicians, and veterinary assistants. Other paraprofessionals may have specialized roles, such as animal physiotherapy or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
l species, both domesticated and wild, with a wide range of conditions that can affect different species. Veterinary medicine is practiced both with and without professional supervision. Professional care is most often led by a veterinary physician (also known as a veterinarian, veterinary surgeon, or "vet"), but also by paraveterinary workers, including veterinary nurses, veterinary technicians, and veterinary assistants. Other paraprofessionals may have specialized roles, such as animal physiotherapy or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
Hippiatrica is a Byzantine compilation of hippiatrics, dated to the fifth or sixth century AD. The first attempts to organize and regulate the practice of treating animals tended to focus on horses because of their economic significance. In the Middle Ages, farriers combined their work in horseshoeing with the more general task of "horse doctoring". The Arabic tradition of Bayṭara, or Shiyāt al-Khayl, originates with the treatise of Ibn Akhī Hizām (fl. late ninth century). In 1356, the Lord Mayor of London, Sir Henry Picard, concerned at the poor standard of care given to horses in the city, requested that all farriers operating within a 7-mile (11-km) radius of the City of London form a "fellowship" to regulate and improve their practices. This ultimately led to the establishment of the Worshipful Company of Farriers in 1674. Meanwhile, Carlo Ruini's book Anatomia del Cavallo (Anatomy of the Horse) was published in 1598.
P
Q10259814 EXACT TITLE 1.000
QID OVERLAP: Q10259814 in veterinary_animal_services (tier:branch) and pets (tier:evergreen). | SHARED TOKENS (19): "care", "cost", "costs", "expectations", "health", "higher", "insurance", "living", "market", "medical", "medicine", "owners", "partly", "person", "pet", "pets", "policies", "treatment", "veterinary". | EXACT TITLE in pets: "Pet insurance".
carecostcostsexpectationshealthhigherinsurancelivingmarketmedicalmedicineownerspartlypersonpetpetspoliciestreatmentveterinary
when the pet dies, or if the pet is lost or stolen. As veterinary medicine is increasingly employing expensive medical techniques and drugs, and owners have higher expectations for their pets' health care and standard of living than previously, the market for pet insurance has increased. The cost of veterinary care has increased significantly. History The first pet insurance policy was written in 1890 in Sweden by Claes Virgin. Virgin was the founder of Länsförsäkrings Alliance, and initially focused on horses and livestock. In 1947 the first pet insurance policy was sold in Britain. As of 2009, Britain had the second-highest level of pet insurance in the world (23%), behind only Sweden. In the United States as of 2024, fewer than 5% of all pets were covered by an insurance policy. As pet ownership has grown in the United States, so have expenses and the popularity of pet insurance. In 2022, Americans spent $136.8 billion on their pets, which was an increase of nearly 11% compared to 2021. As of 2022, the number of insured pets has increased 125% since 2018. As costs rise, increasingly pet owners report difficulty covering vet bills. Pet insurance can help bridge this gap, partially reimbursing owners for unexpected pet care.
edical techniques and drugs, and owners have higher expectations for their pets' health care and standard of living than previously, the market for pet insurance has increased. The cost of veterinary care has increased significantly. History The first pet insurance policy was written in 1890 in Sweden by Claes Virgin. Virgin was the founder of Länsförsäkrings Alliance, and initially focused on horses and livestock. In 1947 the first pet insurance policy was sold in Britain. As of 2009, Britain had the second-highest level of pet insurance in the world (23%), behind only Sweden. In the United States as of 2024, fewer than 5% of all pets were covered by an insurance policy. As pet ownership has grown in the United States, so have expenses and the popularity of pet insurance. In 2022, Americans spent $136.8 billion on their pets, which was an increase of nearly 11% compared to 2021. As of 2022, the number of insured pets has increased 125% since 2018. As costs rise, increasingly pet owners report difficulty covering vet bills. Pet insurance can help bridge this gap, partially reimbursing owners for unexpected pet care.
History The first pet insurance policy was written in 1890 in Sweden by Claes Virgin. Virgin was the founder of Länsförsäkrings Alliance, and initially focused on horses and livestock. In 1947 the first pet insurance policy was sold in Britain. As of 2009, Britain had the second-highest level of pet insurance in the world (23%), behind only Sweden. In the United States as of 2024, fewer than 5% of all pets were covered by an insurance policy. As pet ownership has grown in the United States, so have expenses and the popularity of pet insurance. In 2022, Americans spent $136.8 billion on their pets, which was an increase of nearly 11% compared to 2021. As of 2022, the number of insured pets has increased 125% since 2018. As costs rise, increasingly pet owners report difficulty covering vet bills. Pet insurance can help bridge this gap, partially reimbursing owners for unexpected pet care. Policies Pet insurance is a form of property insurance rather than health insurance. Insurance companies may limit coverage for pre-existing conditions, giving owners an incentive to insure even very young animals, which are not expected to incur high veterinary costs. Some British policies for dogs also include third-party liability insurance.
Pet adoption
Q7171565 EXACT TITLE 1.000
QID OVERLAP: Q7171565 in veterinary_animal_services (tier:branch) and pets (tier:evergreen). | SHARED TOKENS (15): "abandoned", "adoption", "current", "determine", "different", "family", "home", "medical", "need", "owners", "pet", "pets", "provide", "rescue", "shelters". | EXACT TITLE in pets: "Pet adoption".
abandonedadoptioncurrentdeterminedifferentfamilyhomemedicalneedownerspetpetsproviderescueshelters
sing a pet from a breeder or pet store. Common sources for adoptable pets are animal shelters, rescue groups, or other pet owners. Animals are placed up for adoption for numerous reasons, like being abandoned, lost, or rehomed from their current family. The need for rehoming sometimes results from allergies, death of a pet-owner, divorce, the birth of a baby, or relocation. After medical examinations, treatments, and behavioural tests, adoption centres (at their discretion) determine if the pet is healthy enough for adoption.
United states United States (first half of 2025): 2.8 million dogs and cats entered shelters (–4 % vs. 2024), 1.9 million adopted (–1 %) 2023 totals: 4.8 million adoptions; adoption rate rose from 56 % in 2019 to 61 % in 2023 2024: 4.19 million adoptions, still 5.6 % below pre-pandemic levels According to the American Society for the Prevention of Cruelty to Animals, about 5.8 million pets entered shelters and rescues in 2024; only a little over 4 million are adopted. Dog adoption Rescue dog A rescue dog is a dog that has been placed in a new home after being abused, neglected, or abandoned by its previous owner. Many animal rescue organisations exist to rescue, care for and re-home dogs and protect them from unnecessary euthanasia. Common examples include the RSPCA in the United Kingdom and other Commonwealth countries, the ISPCA in Ireland, or the ASPCA in the United States. Many rescue dogs are rehomed quickly, but some wait longer for a home. This may be relevant when the dog is older. Some agencies provide ongoing health care and support for older dogs after they have been placed in a home. There are several charities dedicated to rescuing and rehoming older dogs. The ASPCA estimates that approximately 3.3 million dogs in the United States enter shelters each year. Of these, 1.6 million are adopted, 670,000 are euthanized, and 620,000 are returned to their previous owners. A study conducted by the United States National Council on Pet Population Study and Policy (NCPPSP) in 1998 found that the main reasons for pets being relinquished are: family moving, landlord will not allow pets, too many animals in household, cost of keeping the pet, owner is having personal problems, inadequate facilities, and no homes available for puppies. The study found that 47.7% of dogs turned in to shelters were not altered (spayed or neutered), 33% had not been to a veterinarian, and 96% of dogs had no obedience training.
rrent family. The need for rehoming sometimes results from allergies, death of a pet-owner, divorce, the birth of a baby, or relocation. After medical examinations, treatments, and behavioural tests, adoption centres (at their discretion) determine if the pet is healthy enough for adoption. Euthanasia and “No Kill” Shelters Euthanasia (also known as putting down or putting to sleep) is another method that has been used when dealing with animals who may suffer from terminal illnesses, injuries, or overpopulation in shelters. Although many veterinarians do not consider this to be an ethical use of their resources for young and healthy animals, others argue that euthanasia is a more humane option than leaving a pet in a cage for very long periods of time. Homes cannot always be found, however, and euthanasia is often used for the excess animals to make room for newer pets unless the organization has a no-kill policy. The Humane Society of the United States estimates that 2.4 million healthy, adoptable cats and dogs are euthanized each year in the US because of a lack of homes. Animal protection advocates campaign for adoption instead of buying animals in order to reduce the number of animals who have to be euthanized.
Dog
Q144 EXACT TITLE 1.000
QID OVERLAP: Q144 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (21): "around", "behavior", "canine", "development", "dog", "dogs", "domestic", "environment", "households", "people", "pet", "physical", "police", "population", "process", "roles", "size", "society", "species", "them".... | EXACT TITLE in veterinary_animal_services: "Dog". | EXACT TITLE in pets: "Dog".
aroundbehaviorcaninedevelopmentdogdogsdomesticenvironmenthouseholdspeoplepetphysicalpolicepopulationprocessrolessizesocietyspeciesthemthrive
haviors, sensory capabilities, and physical attributes. Dog breeds vary widely in shape, size, and color. They have the same number of bones (with the exception of the tail), powerful jaws that house around 42 teeth, and well-developed senses of smell, hearing, and sight. Compared to humans, dogs possess a superior sense of smell and hearing, but inferior visual acuity. Dogs perform many roles for humans, such as hunting, herding, pulling loads, protection, companionship, therapy, aiding disabled people, and assisting police and the military. Communication in dogs includes eye gaze, facial expression, vocalization, body posture (including movements of bodies and limbs), and chemical communication (scents, pheromones, and taste). They mark their territories by urinating on them, which is more likely when entering a new environment. Over the millennia, dogs have uniquely adapted to human behavior; this adaptation includes being able to understand and communicate with humans. As such, the human–canine bond has been a topic of frequent study, and dogs' influence on human society has given them the sobriquet of "man's best friend". The global dog population is estimated at 700 million to 1 billion, distributed around the world. The dog is the most popular pet in the United States, present in 34–40% of households.
en a topic of frequent study, and dogs' influence on human society has given them the sobriquet of "man's best friend". The global dog population is estimated at 700 million to 1 billion, distributed around the world. The dog is the most popular pet in the United States, present in 34–40% of households.
distributed around the world. The dog is the most popular pet in the United States, present in 34–40% of households. Developed countries make up approximately 20% of the global dog population, while around 75% of dogs are estimated to be from developing countries, mainly in the form of feral and street dogs. Taxonomy Dogs are domesticated members of the family Canidae. They are classified as a subspecies of Canis lupus, along with wolves and dingoes. Genetic studies show that dogs likely diverged from wolves between 27,000 and 40,000 years ago. Dogs were domesticated from wolves at least 14,000 years ago by hunter-gatherers, before the development of agriculture; the remains of the Bonn–Oberkassel dog, buried alongside humans between 14,000 and 15,000 years ago, are the earliest to be conclusively identified as a domesticated dog. The dingo and the related New Guinea singing dog resulted from the geographic isolation and feralization of dogs in Oceania over 8,000 years ago. Dogs, wolves, and dingoes have sometimes been classified as separate species. In 1758, the Swedish botanist and zoologist Carl Linnaeus assigned the genus name Canis (which is the Latin word for "dog") to the domestic dog, the wolf, and the golden jackal in his book, Systema Naturae. He classified the domestic dog as Canis familiaris and, on the next page, classified the grey wolf as Canis lupus. Linnaeus considered the dog to be a separate species from the wolf because of its upturning tail (cauda recurvata in Latin term), which is not found in any other canid. In the 2005 edition of Mammal Species of the World, mammalogist W. Christopher Wozencraft listed the wolf as a wild subspecies of Canis lupus and proposed two additional subspecies: familiaris, as named by Linnaeus in 1758, and dingo, named by Meyer in 1793. Wozencraft included hallstromi (the New Guinea singing dog) as another name (junior synonym) for the dingo. This classification was informed by a 1999 mitochondrial DNA study. The classification of dingoes is disputed and a political issue in Australia. Classifying dingoes as wild dogs simplifies reducing or controlling dingo populations that threaten livestock. Treating dingoes as a separate species allows conservation programs to protect the dingo population. Dingo classification affects wildlife management policies, legislation, and societal attitudes. In 2019, a workshop hosted by the IUCN/Species Survival Commission's Canid Specialist Group considered the dingo and the New Guinea singing dog to be feral Canis familiaris.
Livestock
Q103459 EXACT TITLE 1.000
QID OVERLAP: Q103459 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (16): "agricultural", "commercial", "communities", "environment", "general", "goats", "health", "labor", "livestock", "major", "products", "provide", "public", "role", "source", "welfare". | EXACT TITLE in veterinary_animal_services: "Livestock". | EXACT TITLE in pets: "Livestock".
agriculturalcommercialcommunitiesenvironmentgeneralgoatshealthlaborlivestockmajorproductsprovidepublicrolesourcewelfare
Livestock are the domesticated animals that are raised in an agricultural setting mainly to provide labor and produce diversified animal products for human consumption such as meat, eggs, milk, fur, leather, and wool. The term is sometimes used to refer solely to animals which are raised for consumption, and sometimes used to refer solely to farmed ruminants, such as cattle, sheep, and goats. The breeding, maintenance, slaughter and general subjugation of livestock, called animal husbandry, is a part of modern agriculture and has been practiced in many cultures since humanity's transition to farming from hunter-gatherer lifestyles. Animal husbandry practices have varied widely across cultures and periods. They continue to play a major economic and cultural role in numerous communities. Livestock farming practices have largely shifted to intensive animal farming. Such farming increases the yield of the various commercial outputs, but also impairs animal welfare, the environment, and public health.
The word livestock was first used between 1650 and 1660, as a compound word combining the words "live" and "stock". In some periods, "cattle" and "livestock" have been used interchangeably. Over the 19th century, the meaning of livestock and cattle shifted, leading to the modern meaning of cattle referring to domesticated bovines, whilst livestock is used in a wider sense. United States federal legislation defines the term to make specified agricultural commodities eligible or ineligible for a program or activity. For example, the Livestock Mandatory Reporting Act of 1999 (P.L. 106–78, Title IX) defines livestock only as cattle, swine, and sheep, while the 1988 disaster assistance legislation defined the term as "cattle, sheep, goats, swine, poultry (including egg-producing poultry), equine animals used for food or in the production of food, fish used for food, and other animals designated by the Secretary". Horses are considered livestock in the United States. The USDA classifies pork, veal (meat of young cows, usually 5–8 months old), beef, and lamb (mutton) as livestock, and all livestock as red meat. Poultry and fish are not included in the category. The latter is likely because fish products are not governed by the USDA, but by the FDA. Deadstock is defined in contradistinction to or as the opposite of livestock as "animals that have died before slaughter, sometimes from illness or disease".
Since many livestock are herd animals, they were historically driven to market "on the hoof" to a town or other central location. The method is still used in some parts of the world. Truck transport is now common in developed countries. Local and regional livestock auctions and specialized agricultural markets facilitate trade in livestock. In Canada at the Cargill slaughterhouse in High River, Alberta, 2,000 workers process 4,500 cattle per day, or more than one-third of Canada's capacity. It closed when some of its workers became infected with coronavirus disease 2019. The Cargill plant together with the JBS plant in Brooks, Alberta and the Harmony Beef plant in Balzac, Alberta represent fully three-quarters of the Canadian beef supply. In other areas, livestock may be bought and sold in a bazaar or wet market, such as may be found in many parts of Central Asia. In non-Western countries, providing access to markets has encouraged farmers to invest in livestock, with the result being improved livelihoods.
Rabies
Q39222 EXACT TITLE 1.000
QID OVERLAP: Q39222 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (27): "age", "around", "care", "control", "cost", "costs", "depends", "direct", "disease", "dog", "dogs", "medical", "months", "people", "person", "population", "rabies", "reduce", "reported", "reporting".... | EXACT TITLE in veterinary_animal_services: "Rabies". | EXACT TITLE in pets: "Rabies".
agearoundcarecontrolcostcostsdependsdirectdiseasedogdogsmedicalmonthspeoplepersonpopulationrabiesreducereportedreportingrisksourcesystemtreatmentvaccinationwesternwork
ople may have an exposure to the virus without treatment and develop natural antibodies as a result. Rabies causes about 59,000 deaths worldwide per year, about 40% of which are in children under the age of 15. More than 95% of human deaths from rabies occur in Africa and Asia. Rabies is present in more than 150 countries and on all continents but Antarctica. More than 3 billion people live in regions of the world where rabies occurs. A number of countries, including Australia and Japan, as well as much of Western Europe, do not have rabies among dogs. Many Pacific islands do not have rabies at all.
The incubation period between infection and the first symptoms is typically one to three months in humans. Initial symptoms of rabies are often nonspecific, such as fever and headache. As rabies progresses and causes inflammation of the brain and meninges, symptoms can include slight or partial paralysis, anxiety, insomnia, confusion, agitation, abnormal behavior, paranoia, terror, and hallucinations. The person may also have fear of water. The symptoms eventually progress to delirium and coma. Death usually occurs two to ten days after first symptoms. Survival is almost unknown once symptoms have presented, even with intensive care. Rabies has also occasionally been referred to as hydrophobia ("fear of water") (see also Aquaphobia) throughout its history. It refers to a set of symptoms in the later stages of an infection in which the person has difficulty swallowing, shows panic when presented with liquids to drink, and cannot quench their thirst. Saliva production is greatly increased, and attempts to drink, or even the intention or suggestion of drinking, may cause excruciatingly painful spasms of the muscles in the throat and larynx. Since the infected individual cannot swallow saliva and water, the virus has a much higher chance of being transmitted, because it multiplies and accumulates in the salivary glands and is transmitted through biting. Hydrophobia is commonly associated with furious rabies, which affects 80% of rabies-infected people. This form of rabies causes irrational aggression in the host, which aids in the spreading of the virus through animal bites; a "foaming at the mouth" effect, caused by the accumulation of saliva, is also commonly associated with rabies in the public perception and in popular culture.
Rabies has also occasionally been referred to as hydrophobia ("fear of water") (see also Aquaphobia) throughout its history. It refers to a set of symptoms in the later stages of an infection in which the person has difficulty swallowing, shows panic when presented with liquids to drink, and cannot quench their thirst. Saliva production is greatly increased, and attempts to drink, or even the intention or suggestion of drinking, may cause excruciatingly painful spasms of the muscles in the throat and larynx. Since the infected individual cannot swallow saliva and water, the virus has a much higher chance of being transmitted, because it multiplies and accumulates in the salivary glands and is transmitted through biting. Hydrophobia is commonly associated with furious rabies, which affects 80% of rabies-infected people. This form of rabies causes irrational aggression in the host, which aids in the spreading of the virus through animal bites; a "foaming at the mouth" effect, caused by the accumulation of saliva, is also commonly associated with rabies in the public perception and in popular culture. The remaining 20% may experience a paralytic form of rabies that is marked by muscle weakness, loss of sensation, and paralysis; this form of rabies does not usually cause fear of water. Cause Rabies is caused by a number of lyssaviruses including the rabies virus and Australian bat lyssavirus. Duvenhage lyssavirus may cause a rabies-like infection. The rabies virus is the type species of the Lyssavirus genus, in the family Rhabdoviridae, order Mononegavirales. Lyssavirions have helical symmetry, with a length of about 180 nm and a cross-section of about 75 nm. These virions are enveloped and have a single-stranded RNA genome with negative sense. The genetic information is packed as a ribonucleoprotein complex in which RNA is tightly bound by the viral nucleoprotein. The RNA genome of the virus encodes five genes whose order is highly conserved: nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G), and the viral RNA polymerase (L). To enter cells, trimeric spikes on the exterior of the membrane of the virus interact with a specific cell receptor, the most likely one being the acetylcholine receptor. The cellular membrane pinches in a procession known as pinocytosis and allows entry of the virus into the cell by way of an endosome. The virus then uses the acidic environment, which is necessary, of that endosome and binds to its membrane simultaneously, releasing its five proteins and single-strand RNA into the cytoplasm. Once within a muscle or nerve cell, the virus undergoes replication. The L protein then transcribes five mRNA strands and a positive strand of RNA all from the original negative strand RNA using free nucleotides in the cytoplasm. These five mRNA strands are then translated into their corresponding proteins (P, L, N, G and M proteins) at free ribosomes in the cytoplasm. Some proteins require post-translational modifications. For example, the G protein travels through the rough endoplasmic reticulum, where it undergoes further folding, and is then transported to the Golgi apparatus, where a sugar group is added to it (glycosylation). When there are enough viral proteins, the viral polymerase will begin to synthesize new negative strands of RNA from the template of the positive-strand RNA. These negative strands will then form complexes with the N, P, L and M proteins and then travel to the inner membrane of the cell, where a G protein has embedded itself in the membrane. The G protein then coils around the N-P-L-M complex of proteins taking some of the host cell membrane with it, which will form the new outer envelope of the virus particle. The virus then buds from the cell. From the point of entry, the virus is neurotropic, traveling along the neural pathways into the central nervous system. The virus usually first infects muscle cells close to the site of infection, where they are able to replicate without being 'noticed' by the host's immune system. Once enough virus has been replicated, they begin to bind to acetylcholine receptors at the neuromuscular junction. The virus then travels through the nerve cell axon via retrograde transport, as its P protein interacts with dynein, a protein present in the cytoplasm of nerve cells. Once the virus reaches the cell body it travels rapidly to the central nervous system (CNS), replicating in motor neurons and eventually reaching the brain.
Horse
Q726 EXACT TITLE 1.000
QID OVERLAP: Q726 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (22): "age", "around", "behavior", "control", "development", "different", "equipment", "family", "full", "general", "horses", "large", "life", "months", "pharmaceuticals", "police", "products", "size", "small", "them".... | EXACT TITLE in veterinary_animal_services: "Horse". | EXACT TITLE in pets: "Horse".
agearoundbehaviorcontroldevelopmentdifferentequipmentfamilyfullgeneralhorseslargelifemonthspharmaceuticalspoliceproductssizesmallthemtrainingwork
rue wild horses, which are horses that have never been domesticated. There is an extensive, specialized vocabulary used to describe equine-related concepts, covering everything from anatomy to life stages, size, colors, markings, breeds, locomotion, and behavior. Horses are adapted to run, allowing them to quickly escape predators, and possess a good sense of balance and a strong fight-or-flight response. Related to this ability to flee from predators in the wild is an unusual trait: horses are able to sleep both standing up and lying down, with younger horses tending to sleep significantly more than adults. Female horses, called mares, carry their young for approximately 11 months and a young horse, called a foal, can stand and run shortly following birth. Most domesticated horses begin training under a saddle or in a harness between the ages of two and four. They reach full adult development by age five, and have an average lifespan of between 25 and 30 years. Horse breeds are loosely divided into three categories based on general temperament: spirited "hot bloods" with speed and endurance; "cold bloods", such as draft horses and some ponies, suitable for slow, heavy work; and "warmbloods", developed from crosses between hot bloods and cold bloods, often focusing on creating breeds for specific riding purposes, particularly in Europe. There are more than 300 breeds of horse in the world today, developed for many different uses. Horses and humans interact in a wide variety of sport competitions and non-competitive recreational pursuits as well as in working activities such as police work, agriculture, entertainment, and therapy. Horses were historically used in warfare, from which a wide variety of riding and driving techniques developed, using many different styles of equipment and methods of control.
their young for approximately 11 months and a young horse, called a foal, can stand and run shortly following birth. Most domesticated horses begin training under a saddle or in a harness between the ages of two and four. They reach full adult development by age five, and have an average lifespan of between 25 and 30 years. Horse breeds are loosely divided into three categories based on general temperament: spirited "hot bloods" with speed and endurance; "cold bloods", such as draft horses and some ponies, suitable for slow, heavy work; and "warmbloods", developed from crosses between hot bloods and cold bloods, often focusing on creating breeds for specific riding purposes, particularly in Europe. There are more than 300 breeds of horse in the world today, developed for many different uses. Horses and humans interact in a wide variety of sport competitions and non-competitive recreational pursuits as well as in working activities such as police work, agriculture, entertainment, and therapy. Horses were historically used in warfare, from which a wide variety of riding and driving techniques developed, using many different styles of equipment and methods of control.
equipment and methods of control. Many products are derived from horses, including meat, milk, hide, hair, bone, and pharmaceuticals extracted from the urine of pregnant mares. Lifespan and life stages Depending on breed, management and environment, the modern domestic horse has a life expectancy of 25 to 30 years. Uncommonly, a few animals live into their 40s and, occasionally, beyond. The oldest verifiable record was "Old Billy", a 19th-century horse that lived to the age of 62. In modern times, Sugar Puff, who had been listed in Guinness World Records as the world's oldest living pony, died in 2007 at age 56. Regardless of a horse or pony's actual birth date, for most competition purposes a year is added to its age each January 1 of each year in the Northern Hemisphere and each August 1 in the Southern Hemisphere.
Veterinarian
Q202883 EXACT TITLE 0.960
QID OVERLAP: Q202883 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (13): "control", "disease", "health", "management", "medical", "medicine", "preventive", "role", "treats", "vaccination", "veterinarian", "veterinarians", "veterinary". | EXACT TITLE in veterinary_animal_services: "Veterinarian". | EXACT TITLE in pets: "Veterinarian".
controldiseasehealthmanagementmedicalmedicinepreventiveroletreatsvaccinationveterinarianveterinariansveterinary
mals. Along with this, veterinarians also play a role in animal reproduction, health management, conservation, husbandry and breeding and preventive medicine like nutrition, vaccination and parasitic control as well as biosecurity and zoonotic disease surveillance and prevention. Description In many countries, the local nomenclature for a veterinarian is a regulated and protected term, meaning that members of the public without the prerequisite qualifications and/or license are not able to use the title. This title is selective in order to produce the most knowledgeable veterinarians that pass these qualifications. In many cases, the activities that may be undertaken by a veterinarian (such as treatment of illness or surgery in animals) are restricted only to those professionals who are registered as a veterinarian. For instance, in the United Kingdom, as in other jurisdictions, animal treatment may only be performed by registered veterinarians (with a few designated exceptions, such as paraveterinary workers), and it is illegal for any person who is not registered to call themselves a veterinarian, prescribe any drugs, or perform treatment. Most veterinarians work in a clinical setting or bricks and mortar practice, treating animals directly. Other vets work as mobile vets offering veterinary services and treating patients in their clients' home. Veterinarians may be involved in general practice, treating animals of all types; they may be specialized in a specific group of animals such as companion animals, livestock, zoo animals or equines; or may specialize in a narrow medical discipline such as surgery, dermatology or internal medicine. As with other healthcare professionals, veterinarians face ethical decisions about the care of their patients.
Occupational hazards Veterinarians work with a wide variety of animal species typically in hospitals, clinics, labs, farms, and zoos. Veterinarians face many occupational hazards including zoonotic diseases, bites and scratches, hazardous drugs, needlestick injuries, ionizing radiation, and noise. According to the U.S. Department of Labor, 12% of workers in the veterinary services profession reported a work-related injury or illness in 2016. Veterinary practices need a health and safety plan that addresses infection prevention and other hazards. Workplaces should utilize engineering controls, administrative controls, and personal protective equipment to keep their employees safe. PPE such as gloves, safety goggles, lab coats, and hearing protection should be readily available with mandatory training on proper usage.
Physical hazards Noise can be a prominent exposure, in which case a hearing loss prevention program may be recommended. A NIOSH study on kennel noise found that noise levels often exceeded OSHA's permissible exposure limit. Reducing noise is beneficial for animal and human health. Psychosocial hazards Veterinarians have high suicide rates in comparison to the general population. A study by the U.S. Centers for Disease Control and Prevention found that male veterinarians are 2.1 times and female veterinarians are 3.5 times as likely as the general population to die by suicide. Some reasons for this could be long hours, work overload, client expectations and complaints, poor remuneration, euthanasia procedures, and poor work-life balance. A survey of more than 11,000 vets found 9% had serious psychological distress, 31% experienced depressive episodes, and 17% had suicidal ideation. Online support groups, such as Not One More Vet, have been established to help veterinarians who may be experiencing suicidal thoughts. NOMV educates veterinarians and vet techs about other ways to help themselves with mental health. Another driver of stress can be student loan debt. A 2013 national survey found that average debt for veterinary medicine graduates was as high as $162,113.
Animal welfare
Q459426 EXACT TITLE 0.960
QID OVERLAP: Q459426 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (13): "affect", "behavior", "care", "concerns", "disease", "food", "life", "pets", "quality", "species", "therefore", "treat", "welfare". | EXACT TITLE in veterinary_animal_services: "Animal welfare". | EXACT TITLE in pets: "Animal welfare".
affectbehaviorcareconcernsdiseasefoodlifepetsqualityspeciesthereforetreatwelfare
umans. These concerns can include how animals are slaughtered for food, how they are used in scientific research, how they are kept (as pets, in zoos, farms, circuses, etc.), and how human activities affect the welfare and survival of wild species. There are two forms of criticism of the concept of animal welfare, coming from diametrically opposite positions. One view, held by some thinkers in history, holds that humans have no duties of any kind to animals. The other view is based on the animal rights position that animals should not be regarded as objects and any use of animals by humans is unacceptable. Accordingly, some animal rights proponents argue that the perception of better animal welfare is used as an excuse for continued exploitation of animals. Some authorities therefore treat animal welfare and animal rights as two opposing positions. Others see animal welfare gains as incremental steps towards animal rights. The predominant view of modern neuroscientists, notwithstanding philosophical problems with the definition of consciousness even in humans, is that consciousness exists in nonhuman animals; however, some still maintain that consciousness is a philosophical question that may never be scientifically resolved. A new study has devised a unique way to dissociate conscious from nonconscious perception in animals. The researchers built experiments predicting opposite behavioral outcomes to consciously vs. non-consciously perceived stimuli.
In addition to cetaceans, the welfare of other wild animals has also been studied, though to a lesser extent than that of animals in farms. Research in wild animal welfare has two focuses: the welfare of wild animals kept in captivity and the welfare of animals living in the wild. The former has addressed the situation of animals kept both for human use, as in zoos or circuses, or in rehabilitation centers. The latter has examined how the welfare of non-domesticated animals living in wild or urban areas are affected by humans or natural factors causing wild animal suffering. Some of the proponents of these views have advocated carrying out conservation efforts in ways that respect the welfare of wild animals, within the framework of the disciplines of compassionate conservation and conservation welfare, while others have argued in favor of improving the welfare of wild animals for the sake of the animals, regardless of whether there are any conservation issues involved at all. The welfare economist Yew-Kwang Ng, in his 1995 "Towards welfare biology: Evolutionary economics of animal consciousness and suffering", proposed welfare biology as a research field to study "living things and their environment with respect to their welfare (defined as net happiness, or enjoyment minus suffering)." Oscar Horta argued that the suffering of wild animals outweighs their happiness. He wrote that wild animals often have large offspring, with most of them dying young by starving or being eaten alive.
New welfarism New welfarism was coined by Gary L. Francione in 1996. It is a view that the best way to prevent animal suffering is to abolish the causes of animal suffering, but advancing animal welfare is a goal to pursue in the short term. Thus, for instance, new welfarists want to phase out fur farms and animal experiments but in the short-term they try to improve conditions for the animals in these systems, so they lobby to make cages less constrictive and to reduce the numbers of animals used in laboratories. Within the context of animal research, many scientific organisations believe that improved animal welfare will provide improved scientific outcomes. If an animal in a laboratory is suffering stress or pain it could negatively affect the results of the research.If a researcher wants to conduct an experiment, they must meet up with the 3R's (replacement, reduction, and refinement). They must show how they're going to put their plan into action. The ethics committee are to review the plan and check if all principles are being followed and ensure the benefits justify the harm of these animals. The 3R's are meant to lessen the use of animals in research and lessen any suffering. Increased affluence in many regions for the past few decades afforded consumers the disposable income to purchase products from high welfare systems. The adaptation of more economically efficient farming systems in these regions were at the expense of animal welfare and to the financial benefit of consumers, both of which were factors in driving the demand for higher welfare for farm animals.
Cat
Q146 EXACT TITLE 0.960
QID OVERLAP: Q146 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (13): "around", "cat", "cats", "control", "domestic", "events", "family", "intelligence", "pet", "population", "small", "social", "species". | EXACT TITLE in veterinary_animal_services: "Cat". | EXACT TITLE in pets: "Cat".
aroundcatcatscontroldomesticeventsfamilyintelligencepetpopulationsmallsocialspecies
nd solve problems. The domestic cat is the only domesticated species of the family Felidae. Advances in archaeology and genetics have shown that the domestication of the cat started in the Near East around 7500 BCE. Today, the domestic cat occurs across the globe and is valued by humans for companionship and its ability to kill vermin. It is commonly kept as a pet, working cat, and pedigreed cat shown at cat fancy events. Out of the estimated 600 million domestic cats worldwide, 400 million reside in Asia, including 58 million in China. About 73.8 million cats are estimated to live in the United States, and about 10.9 million cats in the United Kingdom. It also ranges freely as a feral cat, avoiding human contact. Pet abandonment contributes to increasing of the global feral cat population, which has driven the decline of bird, mammal, and reptile species.
Evolution The domestic cat is a member of the Felidae, a family that has a common ancestor from about 10 to 15 million years ago. The evolutionary radiation of the Felidae began in Asia during the Miocene around 8.38 to 14.45 million years ago. Analysis of mitochondrial DNA of all Felidae species indicates a radiation at 6.46 to 16.76 million years ago. The genus Felis genetically diverged from other Felidae around 6 to 7 million years ago. Results of phylogenetic research shows that the wild members of this genus evolved through sympatric or parapatric speciation, whereas the domestic cat evolved through artificial selection. The genome sequence of the domestic cat was first published in 2007 and is available at the National Center for Biotechnology Information. The domestic cat and its closest wild ancestor both possess 19 chromosome pairs and roughly 20,000 genes. The cat genome sequence has been used for various purposes, including the study of cat migration patterns and disease.
It was long thought that the domestication of the cat began in ancient Egypt, where cats were venerated from around 3100 BCE. However, the earliest known indication for the taming of an African wildcat was excavated close by a human Neolithic grave in Shillourokambos, southern Cyprus, dating to about 7500–7200 BCE. Since there is no evidence of native mammalian fauna on Cyprus, the inhabitants of this village most likely brought the cat and other wild mammals to the island from the West Asian mainland. Scientists therefore assume that African wildcats were attracted to early human settlements in the Fertile Crescent by rodents, in particular the house mouse (Mus musculus), and were tamed by Neolithic farmers. This mutual relationship between early farmers and tamed cats lasted thousands of years. As agricultural practices spread, so did tame and domesticated cats. Wildcats of Egypt contributed to the maternal gene pool of the domestic cat at a later time. The earliest known evidence for the occurrence of the domestic cat in Greece dates to around 1200 BCE. Greek, Phoenician, Carthaginian and Etruscan traders introduced it to southern Europe. By the 5th century BCE, it was a familiar animal around settlements in Magna Graecia and Etruria. During the Roman Empire, it was introduced to Corsica and Sardinia. By the end of the Western Roman Empire in the 5th century, the Egyptian domestic cat lineage had arrived in a Baltic Sea port in northern Germany. The leopard cat (Prionailurus bengalensis) was tamed independently in China around 5500 BCE. This line of a partially domesticated cat left no trace in the domestic cat populations of today. During domestication, cats have undergone only minor changes in anatomy and behavior, and they are still capable of surviving in the wild. Several natural behaviors and characteristics of wildcats may have pre-adapted them for domestication as pets. These traits include their small size, social nature, obvious body language, love of play, and high intelligence. Their rigorous grooming habits and instinct to bury their bodily waste make them generally much less messy than other domesticated animals. Captive Leopardus cats may also display affectionate behavior toward humans but are not domesticated. House cats may mate with feral cats. The development of cat breeds started in the mid-19th century. An analysis of the domestic cat genome revealed that the ancestral wildcat genome was significantly altered in the process of domestication, as specific mutations were selected to develop cat breeds.
Service animal
Q2827808 EXACT TITLE 0.940
QID OVERLAP: Q2827808 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (12): "accommodate", "assistance", "dogs", "function", "people", "pets", "policies", "public", "region", "support", "trained", "training". | EXACT TITLE in veterinary_animal_services: "Service animal". | EXACT TITLE in pets: "Service animal".
accommodateassistancedogsfunctionpeoplepetspoliciespublicregionsupporttrainedtraining
g assisted people since at least 1927. Various definitions exist for a service animal. Various laws and policies may define service animal more expansively, but they often do not include or specially accommodate emotional support animals, comfort animals, or therapy dogs. Regulations regarding service animals vary by region. For example, in Japan, regulations outline standards of training and certification for service animals.
Japan In Japan, the Act on Assistance Dogs for Physically Disabled Persons was issued in 2002. The stated goal of this act was to improve the quality of "assistance dogs for physically disabled persons" and expand the use of public facilities by physically disabled people. Assistance dogs are classified as either guide dogs, hearing dogs, or service dogs. Public transportation, public facilities, offices of public organisation, and private businesses of 50 or more people are required to accept certified assistance dogs. Only certified assistance dogs are required to be accommodated. They must display a sign with their certification number, and the dog's health records and proof of certification must be provided upon demand.
Staff can neither deny service for reasons such as allergies or fear of dogs nor deny service for people with allergies or psychiatric conditions for reasons of a service dog being present; instead, all disabled people need to be accommodated (for example, by having the allergic person use a different room from the person with a service dog). Staff cannot charge handlers extra fees because of a service animal. Hotels must provide handlers the ability to reserve any room, not just rooms deemed "pet-friendly". Staff are not responsible for supervising a service animal. Dog may be of any breed, though certain breeds, such as German Shepherds, Labrador Retrievers, and Golden Retrievers are more popular.
Animal shelter
Q1411287 EXACT TITLE 0.940
QID OVERLAP: Q1411287 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (12): "abandoned", "agricultural", "cats", "communities", "dogs", "livestock", "owner", "owners", "policy", "shelter", "shelters", "stray". | EXACT TITLE in veterinary_animal_services: "Animal shelter". | EXACT TITLE in pets: "Animal shelter".
abandonedagriculturalcatscommunitiesdogslivestockownerownerspolicysheltersheltersstray
An animal shelter or pound is a place where stray, lost, abandoned or surrendered animals – mostly dogs and cats – are housed. The word "pound" has its origins in the animal pounds of agricultural communities, where stray livestock would be penned or impounded until they were claimed by their owners. While no-kill shelters exist, it is sometimes policy to euthanize animals that are not claimed quickly enough by a previous or new owner.
Terminology The shelter industry has terminology for their unique field of work, and though there are no exact standards for consistent definitions, many words have meanings based on their usage. Animal control has the municipal function of picking up stray dogs and cats, and investigating reports of animal abuse, dog bites or animal attacks. It may also be called animal care and control, and earlier was called the dog catcher or rabies control. Stray, lost or abandoned pets picked up off the streets are usually transported to the local animal shelter, or pound. Uncomplicated stray cases are usually kept for a period of time, called stray hold. After the holding period, an animal is considered forfeited by its owner, and may become available for adoption. Animals involved in attacks or bites are placed in quarantine and are not available for adoption until investigations or legal cases are resolved. Animal control's interest is mainly public safety and rabies control. Many shelter policies allow individuals to bring in animals to the shelter, often called owner surrender, or relinquishing an animal. An open admission shelter will accept any animal regardless of reason, and is usually a municipal-run shelter or a private shelter with a contract to operate for a municipality. Municipal shelters may limit incoming animals to those from the area in which they serve. A managed admission shelter requires an appointment and will restrict admission of animals to fit their available resources. Limited admission shelters are usually private or non-profit shelters without municipal contracts, and they may limit their intake to only highly-adoptable and healthy animals. An animal in a shelter has four outcomes: return to owner, adoption, transfer to another shelter or rescue facility, or euthanasia. Return to owner is when a stray animal, that was found and housed at the shelter, is picked up by its owner. Most animal shelters practice adoption, where an animal in their care is given or sold to an individual who will keep it and care for it. Some shelters work with rescue organizations, giving an animal to the rescue rather than adopting it to an individual. Some jurisdictions mandate that shelters cooperate with rescues; some shelters utilize rescues to offload animals with health or behavior problems that they are not equipped to deal with. Many shelters practice some level of euthanasia. Euthanasia is the act of putting an animal to death. A high kill shelter euthanizes many of the animals they take in; a low kill shelter euthanizes few animals and usually operates programs to increase the number of animals that are released alive. A shelter's live release rate is the measure of how many animals leave a shelter alive compared to the number of animals they have taken in. A no kill shelter practices a very strict high live release rate, such as 90%, 95%, or even 100%. Since there is no standard of measurement, some shelters compare live releases to the number of healthy, adoptable animals, while others compare live releases to every animal they took in – as such, the terms high kill, low kill, and no kill are therefore subjective. Shelter partners include rescue groups, fosters and sanctuaries. Rescue groups will often pull dogs from shelters, helping to reduce the number of animals at a shelter. A rescue group often specializes in a specific dog breed, or they pull hard-to-adopt animals such as those with health or behavioral issues with the intention of rehabilitating the animal for a future adoption. Many rescues don't have brick and mortar locations but operate out of a home or with foster partners. A foster will temporarily take animals from the shelter to their home to give them special attention or care, such as a newly whelped litter of puppies, or an animal recovering from an illness. An animal sanctuary is an alternative to euthanasia for difficult-to-adopt animals; it is a permanent placement which may include secure kenneling and care by staff experienced in the handling of animals with serious aggression or permanent behavioral problems, or a home for aged animals that will be cared for until their natural death. Adoption and sending to rescue or sanctuary are permanent placements; fostering is a temporary placement. A retail rescue takes advantage of right-of-first-choice of the free or cheap inventory of animals from shelters to flip shelter-pulled animals under the banner of 'adoption', with little or no retraining or veterinary care in between pulling a dog and selling it. They may also obtain animals cheaply from auctions or puppy mills and command high dollar for their adoptions under the ruse of having 'rescued' the animal. A retail shelter operates like an ordinary animal shelter but with more of the flavor of a pet store than a traditional shelter by selling pet supplies. They may even obtain animals from out of the area to increase their inventory of animals, rather than serving only their geographic service area. Many shelters routinely spay or neuter all their adoptable animals and vaccinate them for rabies and other routine pet diseases. Shelters often offer rabies clinics or spay-neuter clinics to their local public at discount rates.
Czech Republic In the Czech Republic, approximately 42% of households own a pet, most commonly dogs and cats. Animal shelters in the country generally prioritise adoption over euthanasia or long-term housing. A study conducted between 2011 and 2015 across three Czech regions reported that 65% of cats entering shelters were adopted, while the remaining outcomes included unassisted death, euthanasia, or return to their original caretakers. Most cats admitted to shelters were under six months old and predominantly female, with intake rates peaking in summer and autumn. A separate study analysing 3,875 dogs housed in Czech municipal shelters between 2010 and 2013 found that lost dogs were typically reclaimed within one day, whereas abandoned dogs had a median waiting time of 23 days before adoption. Purebred dogs were adopted more quickly than crossbreeds. India Goshalas are a type of shelter for homeless, unwanted or elderly cattle in India.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (11): "agricultural", "boise", "idaho", "land", "local", "region", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in veterinary_animal_services: "Treasure Valley". | EXACT TITLE in pets: "Treasure Valley".
agriculturalboiseidaholandlocalregionriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 EXACT TITLE 0.880
QID OVERLAP: Q35775 in veterinary_animal_services (tier:evergreen) and pets (tier:branch). | SHARED TOKENS (9): "ada", "boise", "home", "idaho", "major", "population", "river", "treasure", "valley". | EXACT TITLE in veterinary_animal_services: "Boise, Idaho".
adaboisehomeidahomajorpopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Veterinary surgery
Q2499585 QID OVERLAP 0.800
QID OVERLAP: Q2499585 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (18): "additional", "advanced", "different", "former", "general", "important", "jurisdiction", "management", "pets", "practice", "procedures", "routine", "surgery", "surgical", "system", "treatment", "veterinarians", "veterinary".
additionaladvanceddifferentformergeneralimportantjurisdictionmanagementpetspracticeproceduresroutinesurgerysurgicalsystemtreatmentveterinariansveterinary
) are performed by veterinary surgeons (as registered in their jurisdiction). Most general practice veterinarians perform routine surgeries such as neuters and minor mass excisions; some also perform additional procedures. The goal of veterinary surgery may be quite different in pets and in farm animals. In the former, the situation is more close to that with human beings, where the benefit to the patient is the important factor.
cedures fall into three broad categories: orthopaedics (bones, joints, muscles), soft tissue surgery (skin, body cavities, cardiovascular system, GI/urogenital/respiratory tracts), and neurosurgery. Advanced surgical procedures such as joint replacement (total hip, knee and elbow replacement), fracture repair, stabilization of cranial cruciate ligament deficiency, oncologic (cancer) surgery, herniated disc treatment, complicated gastrointestinal or urogenital procedures, kidney transplant, skin grafts, complicated wound management, and minimally invasive procedures (arthroscopy, laparoscopy, thoracoscopy) are performed by veterinary surgeons (as registered in their jurisdiction). Most general practice veterinarians perform routine surgeries such as neuters and minor mass excisions; some also perform additional procedures. The goal of veterinary surgery may be quite different in pets and in farm animals. In the former, the situation is more close to that with human beings, where the benefit to the patient is the important factor.
Anesthesia in animals has many similarities to human anesthesia, but some differences as well. Local anesthesia is primarily used for wound closure and removal of small tumors. Lidocaine, mepivacaine, and bupivacaine are the most commonly used local anesthetics used in veterinary medicine. Sedation without general anesthesia is used for more involved procedures. Sedatives commonly used include acepromazine, hydromorphone, midazolam, diazepam, xylazine, and medetomidine. α2 agonists like xylazine and medetomidine are especially useful because they can be reversed, xylazine by yohimbine and medetomidine by atipamezole. Xylazine is approved for use in dogs, cats, horses, deer, and elk in the United States, while medetomidine is only approved for dogs. Most surgeries in ruminants can be performed with regional anesthesia. General anesthesia is commonly used in animals for major surgery. Animals are often premedicated intravenously or intramuscularly with a sedative, analgesic, and anticholinergic agent (dogs frequently receive buprenorphine and acepromazine). The next step is induction, usually with an intravenous drug. Dogs and cats commonly receive thiopental (no longer allowed in the UK), ketamine with diazepam, tiletamine with zolazepam (usually just in cats), and/or propofol. Alfaxalone is a steroid anaesthetic used in many practices in the UK to induce anaesthesia in cats and sometimes dogs. It is similar in physiological effect but different in composition to the now withdrawn Saffan. Horses commonly receive thiopental and guaifenesin. Following induction, the animal is intubated with an endotracheal tube and maintained on a gas anesthetic.
N
Q3482590 QID OVERLAP 0.800
QID OVERLAP: Q3482590 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (16): "adopted", "cats", "dogs", "homes", "horses", "humane", "large", "litters", "owners", "pet", "pets", "require", "rescue", "shelters", "system", "unwanted".
adoptedcatsdogshomeshorseshumanelargelittersownerspetpetsrequirerescueshelterssystemunwanted
urge pet owners to have their pets neutered to prevent the births of unwanted litters, which contribute to the overpopulation of unwanted animals in the rescue system. Many countries require that all adopted cats and dogs be sterilized before going to their new homes. Methods of sterilization Females (spaying) Spaying is the surgical removal of the ovaries and sometimes uterus in female animals. It is commonly performed as a method of birth control, behavior modification, or emergency removal of damaged ovaries. In non-human animals, the technical term is an ovo-hysterectomy or ovariohysterectomy; while in humans, this is called a hystero-oophorectomy. One form of spaying is to remove only the ovaries (oophorectomy or ovariectomy), which is mainly done in cats and young dogs as well as in laparoscopic procedures. Another, less commonly performed method is an "ovary-sparing spay" in which the uterus is removed but one (or both) ovaries are left.
Early-age neutering Early-age neutering, also known as pediatric spaying or prepubertal gonadectomy, is the removal of the ovaries or testes before the onset of puberty. It is used mainly in animal sheltering and rescue where puppies and kittens can be neutered before being adopted out, eliminating non-compliance with sterilization agreement, which is typically above 40%. The American Veterinary Medical Association, American Animal Hospital Association and the Canadian Veterinary Medical Association support the procedure for population control, provided that the veterinarian uses their best knowledge when making the decision about the age at neutering. A task force recommends that cats are spayed–neutered prior to 5 months of age. While the age-unrelated risks and benefits cited above also apply to early-age neutering, various studies have indicated that the procedure is safe and not associated with increased mortality or serious health and behavioral problems when compared to conventional age neutering. Anesthesia recovery in young animals is usually more rapid and there are fewer complications. One study found that in female dogs there is an increasing risk of urinary incontinence the earlier the procedure is carried out; the study recommended that female dogs be spayed no earlier than 3 to 4 months of age. A later study comparing female dogs spayed between 4 and 6 months and after 6 months showed no increased risk. One study showed the incidence of hip dysplasia increased to 6.7% for dogs neutered before 5.5 months compared to 4.7% for dogs neutered after 5.5 months, although the cases associated with early age neutering seems to be of a less severe form. There was no association between age of neutering and arthritis or long-bone fractures. Another study showed no correlation between age of neutering and musculoskeletal problems. A study of large breed dogs with cranial cruciate ligament rupture associated early-age neutering with the development of an excessive tibial plateau angle. Of particular note are two recent studies from Lynette Hart's lab at UC Davis. The first study from 2013, published in a well-known interdisciplinary peer-reviewed journal demonstrated "no cases of CCL (cruciate ligament tear) diagnosed in intact males or females, but in early-neutered males and females the occurrences were 5 percent and 8 percent, respectively. Almost 10 percent of early-neutered males were diagnosed with LSA (lymphosarcoma), 3 times more than intact males. The percentage of HSA (hemangiosarcoma) cases in late-neutered females (about 8 percent) was 4 times more than intact and early-neutered females. There were no cases of MCT (mast cell tumor) in intact females, but the occurrence was nearly 6 percent in late-neutered females". The second study from 2014 highlighted significant difference in closely related breeds (retrievers), suggesting that inter-breed variability is quite high and that sweeping legal measures and surgical mandates are not the best solutions to canine welfare and health. Specifically the study states: "In Labrador Retrievers, where about 5 percent of gonadally intact males and females had one or more joint disorders, neutering at 6 months doubled the incidence of one or more joint disorders in both sexes. In male and female Golden Retrievers, with the same 5 percent rate of joint disorders in intact dogs, neutering at 6 months increased the incidence of a joint disorder to 4–5 times that of intact dogs. The incidence of one or more cancers in female Labrador Retrievers increased slightly above the 3 percent level of intact females with neutering. In contrast, in female Golden Retrievers, with the same 3 percent rate of one or more cancers in intact females, neutering at all periods through 8 years of age increased the rate of at least one of the cancers by 3–4 times. In male Golden and Labrador Retrievers neutering had relatively minor effects in increasing the occurrence of cancers." In terms of behavior in dogs, separation anxiety, aggression, escape behavior and inappropriate elimination are reduced with neutering while noise phobia and sexual behavior has been shown to potentially increase. In males with aggression issues, earlier neutering may increase barking. In cats, asthma, gingivitis, and hyperactivity were decreased, while shyness was increased.
Spaying is the surgical removal of the ovaries and sometimes uterus in female animals. It is commonly performed as a method of birth control, behavior modification, or emergency removal of damaged ovaries. In non-human animals, the technical term is an ovo-hysterectomy or ovariohysterectomy; while in humans, this is called a hystero-oophorectomy. One form of spaying is to remove only the ovaries (oophorectomy or ovariectomy), which is mainly done in cats and young dogs as well as in laparoscopic procedures. Another, less commonly performed method is an "ovary-sparing spay" in which the uterus is removed but one (or both) ovaries are left.
Cruelty to animals
Q40053 QID OVERLAP 0.800
QID OVERLAP: Q40053 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (18): "basic", "costs", "cruelty", "different", "education", "food", "humane", "issue", "itself", "jurisdictions", "life", "people", "pets", "products", "routine", "status", "treatment", "welfare".
basiccostscrueltydifferenteducationfoodhumaneissueitselfjurisdictionslifepeoplepetsproductsroutinestatustreatmentwelfare
is similar to animal rights. Animal rights theorists criticize these positions, arguing that the words "unnecessary" and "humane" are subject to widely differing interpretations and that animals have basic rights.
Throughout history, some individuals, like Leonardo da Vinci for example, who once purchased caged birds in order to set them free, were concerned about cruelty to animals. His notebooks also record his anger with the fact that humans used their dominance to raise animals for slaughter. According to contemporary philosopher Nigel Warburton, for most of human history the dominant view has been that animals are there for humans to do with as they see fit. Sociologist David Nibert emphasizes that the process of domestication dramatically increased the exploitation of animals by humans, particularly in Eurasia, and asserts that this paved the way for the creation of a modern day, capitalist–driven animal–industrial complex.
Up until then, dogs were used for delivering milk, bread, fish, meat, fruit, vegetables, animal food (the cat's-meat man), and other items for sale and for collecting refuse (the rag-and-bone man). As Nigel Rothfels notes the prohibition against dogs pulling carts in or near London caused most of the dogs to be killed by their owners as they went from being contributors to the family income to unaffordable expenses. Cart dogs were replaced by people with handcarts. About 150,000 dogs were killed or abandoned. Erica Fudge quotes Hilda Kean: At the heart of nineteenth-century animal welfare campaigns is the middle-class desire not to be able to see cruelty. The Protection of Animals Act 1911 extended the ban on draft dogs to the rest of the kingdom. As many as 600,000 dogs were killed or abandoned. The Protection of Animals Act 1911 has since been largely superseded by the Animal Welfare Act 2006, which also superseded and consolidated more than 20 other pieces of legislation, including the Protection of Animals Act 1934 and the Abandonment of Animals Act 1960. The Act introduced a new welfare offense, which means that animal owners have a positive duty of care, and outlaws neglect to provide for their animals' basic needs, such as access to adequate nutrition and veterinary care. Under the Criminal Damage Act 1971, domestic animals can be classed as property that is capable of being "damaged or destroyed".
A
Q4764972 QID OVERLAP 0.800
QID OVERLAP: Q4764972 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (58): "abandoned", "adoption", "age", "behavior", "breed", "care", "cats", "commercial", "contract", "created", "different", "dog", "dogs", "environment", "facility", "foster", "general", "handling", "haven", "home"....
abandonedadoptionagebehaviorbreedcarecatscommercialcontractcreateddifferentdogdogsenvironmentfacilityfostergeneralhandlinghavenhomehomesissueskeepkennelkennelslawlistlocallongermedical+28
An animal rescue group or animal rescue organization is a group dedicated to pet adoption. These groups take abandoned, abused, or stray pets and attempt to find suitable homes for them.
Rescue groups exist for most pet types (such as reptile rescue, rabbit rescue or bird rescue), but are most common for dogs and cats. For animals with many breeds, rescue groups may specialize in specific breeds or groups of breeds. For example, there might be local Labrador Retriever rescue groups, hunting dog rescue groups, large-dog rescue groups, as well as general dog rescue groups. Animal rescuers take the animals and care for the animals in need. Animal rescue organizations have also been created to rescue and rehabilitate wild animals, such as lions, tigers, and cheetahs; a job which is normally shared or backed by zoos and other conservation charities. These animals are normally released back into the wild where possible, otherwise they will remain in captivity and, for endangered species, may be used in breeding programs. Widely recognized as an umbrella organization for animal rescue groups, Petfinder.org is an online, searchable database of more than 13,000 shelters and adoption agencies across the United States, Canada and Mexico. The American Kennel Club maintains a list of contacts, primarily within breed clubs, with information on breed rescue groups for purebred dogs in the United States. Animal shelters often work closely with rescue groups, because shelters that have difficulty placing otherwise healthy pet animals would usually rather have the animal placed in a home than euthanized; while shelters might run out of room, rescue groups can often find volunteers with space in their homes for temporary placement. Some organizations (such as Old Dog Haven) work with older animals whose age would likely cause them to be euthanized in county pounds. Each year, approximately three to four million cats and dogs are euthanized in shelters due to overcrowding and a shortage of foster homes. In the United Kingdom, both shelter and rescue organizations are described using the blanket term rescue, whether they have their own premises, buy in accommodation from commercial kennels, or operate a network of foster homes, where volunteers keep the animals in their homes until adoption. Kennels that have a council contract to take in stray dogs are usually referred to as dog pounds. Some dog pounds also carry out rescue and rehoming work and are effectively rescue groups that operate a pound service. Some rescue groups work with pounds to move dogs to rescues. By law, a dog handed in as a stray to a UK pound must be held for seven days before it can be rehomed or euthanized. In the US, there are three classifications for pet rescue: A municipal shelter is a facility that houses stray and abandoned animals, as well as animals that people can no longer care for, on behalf of local governments. A no-kill shelter is a usually private organization whose policies include the specification that no healthy, pet-worthy animal be euthanized. Not-for-profit rescue organizations typically operate through a network of volunteer foster homes. These rescue organizations are also committed to a no-kill policy. Many modern not-for-profit rescue organizations now not only focus on rehoming rescued animals, but rehabilitating and training them as well. Severely abused animals cannot move quickly from their previous environment into a new home. Specialized and trained rescue staff must identify signs of aggression and anxiety and work to remedy these behaviors. As with people, the recovery process is different for all animals.
Rescue groups and shelters There are two major differences between shelters and rescue groups. Shelters are usually run and funded by local governments. Rescue groups are funded mainly by donations and most of the staff are volunteers. While some shelters place animals in foster homes, many are housed on-site in kennels. Some rescue groups have facilities and others do not. Foster homes are heavily utilized in either case. Within the dog rescue community, there are breed-specific and all-breed rescues. As its name implies, breed-specific rescues save purebred dogs of a certain breed; for example, Akitas, Boxers, Dalmatians, Labrador Retrievers, etc. Almost every breed is supported by a network of national and international rescue organizations with the goal to save abandoned dogs of this breed. All-breed rescues are not limited to purebred dogs. Instead they save dogs of any breed. Many work with specific shelters to support their efforts. Adopting through a rescue group Most rescue groups use similar adoption procedures, including completing an application, checking a veterinary reference, conducting an interview (either in person or by phone), and a home visit. Rescue organizations are usually volunteer-run organizations and survive on donations and adoption fees. The adoption fees do not always cover the significant costs involved in rescue, which can include traveling to pick up an animal in need, providing veterinary care, vaccinations, food, spaying and neutering, training, and more. Most animals in the care of rescue groups live with foster home volunteers as members of the family until an appropriate adopter is found. There are a number of different techniques that can be used to make the transition from life at a rescue's foster home to an adoptive home easier on the animal. Generally, rescue groups provide adopters with basic information to aid in a successful transition. Often adoption counsellors are involved in the process to ensure that the pet is being sent to a suitable home. Questionnaires for adoption vary between organizations, but are essentially used to ensure that the animal being adopted suits the lifestyle of the prospect owner and will have all of their needs fulfilled. The Canadian Federation of Humane Societies accounts for the largest number of dog and cat shelters in Canada. With 172 shelters throughout the country, it is estimated that 103,000 cats and 46,000 dogs were taken in during 2013. Of these, 60% of cats and 49% of dogs were strays, 28% of cats and 34% of dogs were surrendered by their owners, 2% of cats and 3% of dogs were cases of abuse, and the rest were either transferred from neighbouring facilities or born in the shelters themselves. Of the thousands of animals in shelters in Canada in 2013, only 47% of dogs and 45% of cats were adopted. The remaining majority were left to be euthanized, sent back to their previous owners, or stayed in the shelters, possibly being transferred from one to another to increase adoptability. The rise of social media has since aided in adoption of pets. Shelters and rescue groups can now post pictures and biographies of the animals on their social media pages. These outlets allow people to find suitable pets in need of homes. Online interviews are now also possible, as well as international adoption through many organizations. Developments such as social media pages help shelters find appropriate adopters by venturing outside of their immediate surroundings and creating online networks, allowing more people to be exposed to the information and possibility of animal adoption.
Dog grooming
Q38479 QID OVERLAP 0.800
QID OVERLAP: Q38479 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (16): "care", "concerns", "different", "dog", "dogs", "groomers", "grooming", "household", "knowledge", "physical", "process", "provide", "require", "responsible", "trained", "work".
careconcernsdifferentdogdogsgroomersgroominghouseholdknowledgephysicalprocessproviderequireresponsibletrainedwork
Dog grooming refers to the hygienic care of a dog, a process by which a dog's physical appearance is altered or enhanced. A dog groomer (or simply "groomer") is a professional that is responsible for maintaining a dog’s hygiene and appearance by offering services such as bathing, brushing, hair trimming, nail clipping, and ear cleaning. Similarly to grooming humans and other animals, grooming dogs is an act of service to aid the dog in its course of shedding its fur, trimming its nails and tending to any skin concerns. The act of care may require different tools, such as clippers, shears and brushes. Dog grooming can be done in a household setting with cursory knowledge of the act, yet dog salons, with professionally trained dog groomers, can provide a more thorough service, especially for certain long haired breeds. The earliest record of grooming dogs was found to be between 1500 and 1600 A.D.
g. Similarly to grooming humans and other animals, grooming dogs is an act of service to aid the dog in its course of shedding its fur, trimming its nails and tending to any skin concerns. The act of care may require different tools, such as clippers, shears and brushes. Dog grooming can be done in a household setting with cursory knowledge of the act, yet dog salons, with professionally trained dog groomers, can provide a more thorough service, especially for certain long haired breeds. The earliest record of grooming dogs was found to be between 1500 and 1600 A.D.
Bathing Dogs can be bathed indoors in a sink, walk-in shower, or bathtub or outdoors using a garden hose. The water should be warm enough to prevent hypothermia but not hot enough to scald the skin. Dogs with heavy or matted coats should never be bathed without first being completely brushed out or first clipping/cutting any mats. Many types of shampoos and conditioners formulated for dogs are available. For dense and double-coated dogs, pre-mixing the shampoo with water will help ensure a more even distribution of the shampoo. When washing the head, grooming products can be irritating if they come in contact with the eyes. Additionally, excess water may become trapped in the ear canal, leading to secondary ear infections. If the shampoo is not fully rinsed off, residual chemicals may become irritating to the skin. Most dogs do not require frequent bathing; shampooing a coat too often can strip the coat of its natural oils, causing it to dry out. Dental care Dental care is particularly important and can be addressed while grooming. The dental kits available on the market include everything from special toothpaste to toothbrushes. Many models of toothbrushes include a flexible three-head design, which maintains the proper pressure on all surfaces of the tooth with every stroke. These brushes have side bristles set at 45-degree angles to reduce arm twisting and soft outer bristles for massaging the gums. Toothpaste designed to be used on dogs is usually sugar-free toothpaste with different flavoring.
Dog training
Q38490 QID OVERLAP 0.760
QID OVERLAP: Q38490 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (13): "behavior", "dog", "dogs", "domestic", "environment", "events", "household", "life", "pets", "practice", "roles", "trained", "training".
behaviordogdogsdomesticenvironmenteventshouseholdlifepetspracticerolestrainedtraining
Dog training is a type of animal training, the application of behavior analysis which uses the environmental events of antecedents (trigger for a behavior) and consequences to modify the dog behavior, either for it to assist in specific activities or undertake particular tasks, or for it to participate effectively in contemporary domestic life. While training dogs for specific roles dates back to Roman times at least, the training of dogs to be compatible household pets developed with suburbanization in the 1950s. A dog learns from interactions it has with its environment. This can be through classical conditioning, where it forms an association between two stimuli; non-associative learning, where its behavior is modified through habituation or sensitisation; and operant conditioning, where it forms an association between an antecedent and its consequence. Most working dogs are now trained using reward-based methods, sometimes referred to as positive reinforcement training. Other reward-based training methods include clicker training, model-rival training, and relationship-based training. Training methods that emphasize punishment include the Koehler method, electronic (shock collar) training, dominance-based training, and balanced training. The use of punishment is controversial with both the humaneness and effectiveness questioned by many behaviorists.
e 1950s. A dog learns from interactions it has with its environment. This can be through classical conditioning, where it forms an association between two stimuli; non-associative learning, where its behavior is modified through habituation or sensitisation; and operant conditioning, where it forms an association between an antecedent and its consequence. Most working dogs are now trained using reward-based methods, sometimes referred to as positive reinforcement training. Other reward-based training methods include clicker training, model-rival training, and relationship-based training. Training methods that emphasize punishment include the Koehler method, electronic (shock collar) training, dominance-based training, and balanced training. The use of punishment is controversial with both the humaneness and effectiveness questioned by many behaviorists.
ehler method, electronic (shock collar) training, dominance-based training, and balanced training. The use of punishment is controversial with both the humaneness and effectiveness questioned by many behaviorists. Furthermore, numerous scientific studies have found that reward-based training is more effective and less harmful to the dog-owner relationship than punishment-based methods. Definition Dog training is the act of teaching a dog particular skills or behaviors. Dog training includes teaching a dog to react to particular commands and cues as well as to act independently by deliberately changing their natural behavior. Dogs have been trained to perform a large number of practical functions including search and rescue, herding livestock, guarding, explosive or drug detection, and disability assistance. Dogs have also been trained to perform recreational functions, including companionship and shooting assistance. Dog training usually involves the basic obedience training to establish control over the animal and can then progress to more advanced specialist training.
Veterinary dentistry
Q7923725 QID OVERLAP 0.760
QID OVERLAP: Q7923725 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (13): "care", "dental", "dentistry", "disease", "equine", "feline", "horses", "medical", "medicine", "routine", "treatment", "veterinary", "work".
caredentaldentistrydiseaseequinefelinehorsesmedicalmedicineroutinetreatmentveterinarywork
Veterinary dentistry involves the application of dental care to animals, encompassing not only the prevention of diseases and maladies of the mouth, but also considers treatment. In the United States, veterinary dentistry is one of 20 veterinary specialties recognized by the American Veterinary Medical Association. Among other services, veterinary dentists perform endodontics, oral radiographs, and cosmetic and medically indicated surgeries. They address various conditions such as jaw fractures, malocclusions of the teeth, oral cancer, periodontal disease, and unique veterinary conditions like feline odontoclastic resorptive lesions.
Diagnosis Many pet owners are often unaware that their pets have dental issues, which is why checking the oral cavity should be included in every physical checkup conducted by the veterinarian. The latest Canine Preventive Healthcare Guidelines and Feline Preventive Healthcare Guidelines from the American Animal Hospital Association (AAHA) and AVMA emphasize the importance of dental care as part of the evaluation during annual veterinary visits. A conscious animal's oral examination can provide limited insight, while a complete oral assessment can only be performed under general anesthesia. These evaluations should take place at least once a year to detect any concerns and maintain optimal oral health. Assessing the entire animal, even if the main issue is the mouth, is standard practice. Certain dental conditions can stem from underlying systemic issues, and they can also lead to systemic complications that affect the kidneys, liver, and heart muscle.
Academy of Veterinary Dental Technicians Academy of Veterinary Dentistry American Society of Veterinary Dental Technicians American Veterinary Dental College American Veterinary Dental Society British Veterinary Dental Association European Veterinary Dental College European Veterinary Dental Foundation Veterinary Oral Health Council WikiVet Dentistry Guidelines: AAHA-AVMA canine preventive healthcare guidelines AAHA-AVMA feline preventive healthcare guidelines
Animal control service
Q3289646 QID OVERLAP 0.740
QID OVERLAP: Q3289646 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (12): "control", "dangerous", "dog", "dogs", "entity", "government", "health", "important", "public", "rabies", "safety", "stray".
controldangerousdogdogsentitygovernmenthealthimportantpublicrabiessafetystray
An animal control service or animal control agency is an entity charged with responding to requests for help with animals, including wild animals, dangerous animals, and animals in distress.
Duties and function Typically animals that are found will be checked for owner identification, including checking any ID tags, scanning for microchips, and checking for tattoos. Animals may be returned to their owners, or transported to a veterinary clinic or animal shelter. Animals held in the shelter can be returned to their owners, adopted, released to the wild, held as evidence in a criminal investigation or euthanized. Animal control services may be provided by the government or through a contract with a humane society or society for the prevention of cruelty to animals. Officers may work for, or with, police or sheriff departments, parks and recreation departments, and health departments by confining animals or investigating animal bites to humans. Active cruelty to animals may be an indicator of serious psychological or violence problems.
Politics An American colloquialism labels an unpopular politician by saying that they "couldn't be elected dogcatcher", with "dogcatcher" referring to a very low-level elected office. In practice, animal control officers are generally appointed by an executive authority and not elected. However, historic equivalents such as poundmaster, which was tasked with the control of stray livestock, and hog reeve, whose mandate extended exclusively to stray swine, were elective offices in Colonial and early American New England. The town of Duxbury, Vermont, was said to be the only place in the contemporary United States that actually elects a dog catcher, but electing of dogcatchers was found to be illegal in Vermont in 2018.
E
QID OVERLAP 0.720
QID OVERLAP: Q5373799 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (11): "health", "healthcare", "housing", "need", "people", "person", "required", "requirements", "rules", "support", "trained".
healthhealthcarehousingneedpeoplepersonrequiredrequirementsrulessupporttrained
An emotional support animal (ESA) is an animal that provides support to individuals with a mental health or psychiatric disability. Emotional support animals are not required to be trained. Any animal that provides support, comfort, or aid, to an individual through companionship, unconditional positive regard, and affection may be regarded as an emotional support animal. In the United States, emotional support animals are not recognized as service animals under the Americans with Disabilities Act. Service animals are trained to perform specialized tasks such as helping a blind person navigate. People with mental health disabilities who possess an emotional support animal may be exempt from certain federal housing and travel rules. To receive these exemptions, the following requirements must be met: 1. the handler must meet the federal definition of disabled 2. the emotional support animal must help alleviate the symptoms or effects of the disability.
s are not recognized as service animals under the Americans with Disabilities Act. Service animals are trained to perform specialized tasks such as helping a blind person navigate. People with mental health disabilities who possess an emotional support animal may be exempt from certain federal housing and travel rules. To receive these exemptions, the following requirements must be met: 1. the handler must meet the federal definition of disabled 2. the emotional support animal must help alleviate the symptoms or effects of the disability.
ust meet the federal definition of disabled 2. the emotional support animal must help alleviate the symptoms or effects of the disability. The individual may need to present a letter from a certified healthcare provider, stating that the emotional support animal is needed for their mental health. Requirements Emotional support animals are typically household domesticated animals, but may also be members of other animal species.
Paraveterinary worker
Q61341 QID OVERLAP 0.720
QID OVERLAP: Q61341 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (11): "assistance", "health", "medicine", "performs", "practice", "procedures", "role", "surgery", "system", "technician", "veterinary".
assistancehealthmedicineperformspracticeproceduresrolesurgerysystemtechnicianveterinary
A paraveterinarian is a professional of veterinary medicine who performs procedures autonomously or semi-autonomously, as part of a veterinary assistance system.
Veterinary assistant In most countries, a veterinary assistant is a person with fewer or no formal animal health qualifications, who has no autonomous practice, but who is designated to assist other professionals. Training programs are often workplace-based, and no formal licence or certification is required to perform the role. In the US, veterinary assistants have the option to earn a certificate of completion by taking basic animal health classes about contagious diseases, animal restraint, record keeping, work place safety, administration, etc. Having the knowledge of the basics allows for the development of trust between the veterinarian and the assistant, as well as smoother job training of veterinary assistants. Their scope of practice remains limited and equal to many on the job trained staff. Local laws restrict what activities a veterinary assistant may perform, as some procedures may only be legally completed by a licensed veterinary technician, including IV anesthesia induction, oral surgery, splinting and casting, and in some states, administering the rabies vaccine. History Veterinarians have had assistance from staff throughout their existence of the profession, but the first organised paraveterinary workers were the canine nurses trained by the Canine Nurses Institute in 1908, and announced in the magazine 'The Veterinary Student'. According to the founder, they would "carry out directions of the veterinary surgeon, meet a genuine need on the part of the dog owners, and at the same time provide a reasonably paid occupation for young women with a real liking for animals". In 1913, the Ruislip Dog Sanatorium was founded, and employed nurses to care for unwell dogs and in the 1920s, at least one veterinary surgery in Mayfair employed qualified human nurses to tend the animals. In the mid-1930s, the early veterinary nurses approached the Royal College of Veterinary Surgeons for official recognition, and in 1938 the Royal Veterinary College had a head nurse appointed, but the official recognition was not given until 1957, first as veterinary nurses, but changed within a year to Royal Animal Nursing Auxiliaries (RANAs) following objection from the human nursing profession. In 1951, the first formal paraveterinary role was created by the United States Air Force who introduced veterinary technicians, and this was followed in 1961 by a civilian programme at the State University of New York (SUNY) Agricultural and Technical College. In 1965 Walter Collins, DVM received federal funding to develop model curricula for training technicians.
UK - Registered Veterinary Nurses Ireland - Registered Veterinary Nurses (a profession in its infancy) Australia: Veterinary Nurses in only one state (Queensland). However, a VN title can be acquired with little education and only a certificate. Voluntary credentialing opened in some other states in 2018, but this is also a profession in its infancy. Vet Technicians, in contrast, hold a 3-year degree completed through a University program. The curriculum is not influenced by the industry or government as such and there is no quality assurance of practical skills; however, this degree has more in-depth knowledge required and exposure to much higher level skills. New Zealand - both Registered Veterinary Nurses and Veterinary Technicians Veterinary Technicians have the higher degree (3 years of school as opposed to 2) South Africa - Veterinary Nurse and Animal Health Technician Each title conferred has completely separate curricula, with the AHT being more like a Nurse Practitioner (in the US); aka a mid-level medical professional. Veterinary Nurses in SA are more like veterinary assistants in the US Denmark - title translates to Veterinary Nurse Norway - title translates to Veterinary Nurse There is an effort to change the title of credentialed Veterinary Technicians in the United States but legislative efforts have failed in all four states where the name change has been introduced to date. The VNI has spent over $200,000 with no clear accounting of where the money has been spent and no success.
Veterinary oncology
Q7923724 QID OVERLAP 0.700
QID OVERLAP: Q7923724 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (10): "age", "dogs", "domestic", "environment", "major", "medicine", "older", "pet", "treatment", "veterinary".
agedogsdomesticenvironmentmajormedicineolderpettreatmentveterinary
subspecialty of veterinary medicine that deals with cancer diagnosis and treatment in animals. Cancer is a major cause of death in pet animals. In one study, 45% of the dogs that reached 10 years of age or older died of cancer. Skin tumors are the most frequently diagnosed type of tumor in domestic animals for two reasons: 1. constant exposure of animal skin to the sun and external environment, 2.
Treatment The most effective method of treating cancer in animals is surgery. Surgery may involve a marginal excision, where just the capsule is excised; wide excision, where a wider area surrounding the capsule (typically 2–3cm) is excised; or radical excision, where the entire compartment is excised, often taking the form of an amputation. Cancer statistics Male dogs Female dogs These statistics, being from the 1960s, may not be an accurate representation of cancer in dogs currently. Human-animal cancer connections Companion animals such as dogs and cats suffer from many of the same types of cancer as humans. Cancer research with dogs has helped in the design of clinical trials for cancer therapy for humans.
Cancer statistics Male dogs Female dogs These statistics, being from the 1960s, may not be an accurate representation of cancer in dogs currently. Human-animal cancer connections Companion animals such as dogs and cats suffer from many of the same types of cancer as humans. Cancer research with dogs has helped in the design of clinical trials for cancer therapy for humans.
Nampa, Idaho
Q622633 QID OVERLAP 0.680
QID OVERLAP: Q622633 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (9): "boise", "canyon", "home", "idaho", "meridian", "nampa", "population", "west", "western".
boisecanyonhomeidahomeridiannampapopulationwestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Pet sitting
Q13414620 QID OVERLAP 0.680
QID OVERLAP: Q13414620 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (9): "boarding", "care", "home", "organization", "owner", "person", "pet", "required", "training".
boardingcarehomeorganizationownerpersonpetrequiredtraining
e pet owner's home, but may also occur at the provider's home or at a pet sitting place of business or organization. Pet sitting is a more personal and individualized arrangement for care compared to boarding or kenneling. Specialized training is usually not required for pet sitting. Description In 1997 Pet Sitters International (PSI) successfully campaigned to have "pet sitting" added to the Random House Dictionary. "Pet sitting" is defined as "the act of caring for a pet in its own home while the owner is away." Dog walking is also a form of pet sitting since it involves coming to the pet’s home to provide exercise and companionship. Caring for pets in the clients’ homes is what separates pet sitters from boarders or doggie daycares. Pet sitters visit the pet home to provide a range of services. This primarily involves feeding, exercise and companionship. Pet sitters generally bill clients on a per-visit, per-day or per vacation basis, and include additional charges for multiple pets, travel expenses, and non-standard duties. Pet sitting services do not include services in the pet sitter's home. This is considered "pet boarding." Boarding outside the pet's home generally requires a kennel license, city or county approval, and in some counties oversight by the local Department of Agriculture which requires protocols to help maintain standards to prevent the transmission of diseases. In many areas, no occupational license is required for pet sitters. The term "licensed" is often used by pet sitting professionals to refer to licenses to do business, and/or animal transportation permits available within the coverage area of the business.
Description In 1997 Pet Sitters International (PSI) successfully campaigned to have "pet sitting" added to the Random House Dictionary. "Pet sitting" is defined as "the act of caring for a pet in its own home while the owner is away." Dog walking is also a form of pet sitting since it involves coming to the pet’s home to provide exercise and companionship. Caring for pets in the clients’ homes is what separates pet sitters from boarders or doggie daycares. Pet sitters visit the pet home to provide a range of services. This primarily involves feeding, exercise and companionship. Pet sitters generally bill clients on a per-visit, per-day or per vacation basis, and include additional charges for multiple pets, travel expenses, and non-standard duties. Pet sitting services do not include services in the pet sitter's home. This is considered "pet boarding." Boarding outside the pet's home generally requires a kennel license, city or county approval, and in some counties oversight by the local Department of Agriculture which requires protocols to help maintain standards to prevent the transmission of diseases. In many areas, no occupational license is required for pet sitters. The term "licensed" is often used by pet sitting professionals to refer to licenses to do business, and/or animal transportation permits available within the coverage area of the business.
Global market According to Pet Sitters International's 2016 State of the Industry Survey, its members completed 17 million pet sitting assignments and generated more than $391 million in pet sitting revenues in 2015. Many pet owners prefer hiring pet sitters instead of the more traditional pet care options available. Some reasons cited for using a pet sitter are to prevent stress to the animal caused by a changing environment, travel trauma, contracting illnesses and parasites from exposure to other animals, not meeting vaccination requirements that may be necessary for kennelling, and to maintain regular routines and prevent the need to adapt to a new environment. It is also a solution for pets with health problems and mobility issues due to arthritis, dysplasia, incontinence, etc. Many new pet sitting businesses are emerging due to high levels of pet ownership and relatively low financial barriers of entry.
Garden City, Idaho
Q1516892 QID OVERLAP 0.660
QID OVERLAP: Q1516892 in veterinary_animal_services (tier:branch) and pets (tier:evergreen). | SHARED TOKENS (8): "ada", "boise", "garden", "government", "haven", "idaho", "municipal", "population".
adaboisegardengovernmenthavenidahomunicipalpopulation
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Dog daycare
Q38429 QID OVERLAP 0.660
QID OVERLAP: Q38429 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (8): "boarding", "care", "daycare", "dog", "dogs", "home", "kennel", "pet".
boardingcaredaycaredogdogshomekennelpet
Dog daycare, or doggy daycare, is short-term daytime care for dogs. It differs from multi-day kennel boarding and pet sitting, where the sitter comes to the pet's home. Background Dog daycares arose out of traditional kennels in the early 1990s. Prior to World War II, dogs more commonly lived outside in the United States, but as urbanization spread dogs started to live indoors more frequently. Other factors, including an increase in the population of adults without children, have gradually led to more attention and money being spent on pets. The first modern dog day care in New York City, Yuppie Puppy Pet Care was reportedly opened in 1987, by Joseph S. Sporn.
Environments There are multiple environments and varieties of dog daycare service. For example, some facilities provide a cage-free environment where dogs play under the supervision of a trained staff member. Other facilities may provide a cage free environment for dogs to play for a portion of the day, placing dogs in cages at other times of the day. A daycare kennel is a type of facility that offers cages or runs where the dog will be placed alone during the day. Some facilities allow dogs to play in an outside environment.
Ada County, Idaho
Q109820 QID OVERLAP 0.660
QID OVERLAP: Q109820 in veterinary_animal_services (tier:evergreen) and pets (tier:branch). | SHARED TOKENS (8): "ada", "boise", "home", "idaho", "jurisdiction", "local", "population", "private".
adaboisehomeidahojurisdictionlocalpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Exotic pet
Q3247163 QID OVERLAP 0.640
QID OVERLAP: Q3247163 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (7): "become", "established", "keep", "longer", "pet", "rather", "species".
becomeestablishedkeeplongerpetratherspecies
a pet which is relatively rare or unusual to keep, or is generally thought of as a wild species rather than as a domesticated pet. The definition varies by culture, location, and over time—as animals become firmly enough established in the world of animal fancy—they may no longer be considered exotic. Definitions The definition is an evolving one; fish, rabbits, and some rodents and birds have become firmly enough established in the world of animal fancy as to no longer be considered exotic in general usage, though they may still be classed as exotic in veterinary practice. Sometimes any unique or wild-looking pet (including common domestic animals such as the ferret and the rat) is considered an exotic pet. "Exotic" often refers to a species which is not native or indigenous to the owner's locale, and "pet" is a companion animal living with people. However, many use the term to include native species as well (e.g., snakes may sometimes be considered exotic as pets even in places where they are found in the wild). The international organization the American College of Zoological Medicine has defined the exotics group as "zoological companion animals".
become firmly enough established in the world of animal fancy—they may no longer be considered exotic. Definitions The definition is an evolving one; fish, rabbits, and some rodents and birds have become firmly enough established in the world of animal fancy as to no longer be considered exotic in general usage, though they may still be classed as exotic in veterinary practice. Sometimes any unique or wild-looking pet (including common domestic animals such as the ferret and the rat) is considered an exotic pet. "Exotic" often refers to a species which is not native or indigenous to the owner's locale, and "pet" is a companion animal living with people. However, many use the term to include native species as well (e.g., snakes may sometimes be considered exotic as pets even in places where they are found in the wild). The international organization the American College of Zoological Medicine has defined the exotics group as "zoological companion animals".
Private zoos When a person owns a collection of enough exotic pets, the property that they keep the animals on may be operated as a private zoo or a menagerie. As with exotic pets in general, laws about private zoos varies by country, state, county, and territory. A private zoo can range in size from a few acres to hundreds of acres and can have as many as a few to hundreds of exotic animals. Which people are allowed to view and interact with the animals depends on the owner. Because it usually requires a great deal of financial support for displaying exotic animals which are uncommon, difficult to acquire, and expensive to maintain in a living and active state, private zoos are at times seen as a status symbol that upper class people can use to illustrate their power and wealth. In the criminal underworld, crime bosses and drug lords are also known to have private zoos, in order to show how successful they have become in organized crime. In such zoos, there are also allegations that the criminals have been known to use the zoo animals to murder captives in damnatio ad bestias-like killings. A well-known example is Pablo Escobar's zoo, Hacienda Nápoles. One of the dangers of private zoos is the damage and harm that the animals can pose to people if they escape or are released by the owner. According to some advocacy groups such as REXANO (Responsible Exotic Animal Ownership) the ownership of exotic pets and private zoos can be both ethical and beneficial to wildlife. REXANO claims that captive breeding of exotic pets in zoos has saved many animals from extinction by providing a supply of captive-bred animals to reduce pressures on wild populations, thus helping to conserve them in their natural environments. REXANO also argues that close personal contact with wild animals can help promote their conservation among people, and because of this, venues such as circuses, fairs and private zoos are good for both people and wildlife. There are also private zoo owners who claim that their zoos also serve as animal rescue sanctuaries.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in veterinary_animal_services (tier:evergreen) and pets (tier:evergreen). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (7): "ada", "boise", "cities", "idaho", "making", "meridian", "population".
adaboisecitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
QID OVERLAP 0.620
QID OVERLAP: Q1515177 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "kuna", "population".
adaadditionalboiseidahokunapopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Caldwell, Idaho
Q849592 QID OVERLAP 0.620
QID OVERLAP: Q849592 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "population", "west".
boisecaldwellcanyonidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in veterinary_animal_services (tier:branch) and pets (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
153 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP153 edges
🌲 EVERGREEN1 edges
0.650
administrationcatscentercompaniondepartmentdogsfeedfoodhorsesmedicinepetsproductsregulateresponsiblesafetyspeciesvaccinesveterinarywork
SHARED TOKENS (19): "administration", "cats", "center", "companion", "department", "dogs", "feed", "food", "horses", "medicine", "pets", "products", "regulate", "responsible", "safety", "species", "vaccines", "veterinary", "work". | URL->A (1): https://www.fda.gov/animal-veterinary. | EXACT TITLE in veterinary_animal_services: "Center for Veterinary Medicine".
🌿 BRANCH104 edges
0.500
affectedassistancebasicbuildingdirectlyemergencyfoodfullgovernmenthealthimmediateimproveinfrastructurekeeplimitedmanagementpeopleplacesprovideproviding
SHARED TOKENS (26): "affected", "assistance", "basic", "building", "directly", "emergency", "food", "full", "government", "health", "immediate", "improve", "infrastructure", "keep", "limited", "management", "people", "places", "provide", "providing".... | EXACT TITLE in veterinary_animal_services: "Disaster response".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalaroundboisegeographicidaholandnationalofficialpeoplepopulationproductsriversmallsupplieswestwestern
SHARED TOKENS (16): "agricultural", "around", "boise", "geographic", "idaho", "land", "national", "official", "people", "population", "products", "river", "small", "supplies", "west", "western". | EXACT TITLE in veterinary_animal_services: "Idaho". | EXACT TITLE in pets: "Idaho".
0.500
Coyote ↗ Q44299 EXACT TITLE
caninechangescitiesfamilyhomeimprovelivingorganizationprovidingpublicrabbitsshowsmallersocialspecies
SHARED TOKENS (15): "canine", "changes", "cities", "family", "home", "improve", "living", "organization", "providing", "public", "rabbits", "show", "smaller", "social", "species". | EXACT TITLE in pets: "Coyote".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addcreatecreatesdependdirectequipmentgrowthhealthlandmanagementopenphysicalriskspacesspecies
SHARED TOKENS (15): "add", "create", "creates", "depend", "direct", "equipment", "growth", "health", "land", "management", "open", "physical", "risk", "spaces", "species". | EXACT TITLE in veterinary_animal_services: "Wildfire".
0.500
abandonedadoptiondogdogsdomesticenvironmentfoundationgeneralhomesorganizationownerspetpetsprocessrescuesheltersthemwelfarewildlife
SHARED TOKENS (19): "abandoned", "adoption", "dog", "dogs", "domestic", "environment", "foundation", "general", "homes", "organization", "owners", "pet", "pets", "process", "rescue", "shelters", "them", "welfare", "wildlife". | EXACT TITLE in veterinary_animal_services: "Animal rescue". | EXACT TITLE in pets: "Animal rescue".
0.500
affectedaffectsbecomecontractdiseasedomesticequipmentfamilyfeedgoatsinsidelimitslivestockmultiplerestrictionssmallspeciesvaccination
SHARED TOKENS (18): "affected", "affects", "become", "contract", "disease", "domestic", "equipment", "family", "feed", "goats", "inside", "limits", "livestock", "multiple", "restrictions", "small", "species", "vaccination". | EXACT TITLE in veterinary_animal_services: "Foot-and-mouth disease".
0.500
affectedbasiccommunitydifferentemergencyeventshouseholdslocalmanagementprovidingreducerequiresrescuerisksearch
SHARED TOKENS (15): "affected", "basic", "community", "different", "emergency", "events", "households", "local", "management", "providing", "reduce", "requires", "rescue", "risk", "search". | EXACT TITLE in veterinary_animal_services: "Emergency management".
0.500
Food safety ↗ Q909821 EXACT TITLE
affectsconsumercreatesdiseaseenforcementfoodgrowthhandlinghealthindustrymanagementmarketorganizationpersonphysicalpoliciesresultingsafetysupplysystems
SHARED TOKENS (20): "affects", "consumer", "creates", "disease", "enforcement", "food", "growth", "handling", "health", "industry", "management", "market", "organization", "person", "physical", "policies", "resulting", "safety", "supply", "systems". | EXACT TITLE in veterinary_animal_services: "Food safety".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingdeterminedevelopmentdifferentgovernmentgrowthlandlocalplacesplanningpolicyresidentialrulesscalesizesystemszoning
SHARED TOKENS (17): "building", "determine", "development", "different", "government", "growth", "land", "local", "places", "planning", "policy", "residential", "rules", "scale", "size", "systems", "zoning". | EXACT TITLE in veterinary_animal_services: "Zoning". | EXACT TITLE in pets: "Zoning".
0.500
accessbasiccarecommunitiescommunitycomplexcomprehensivecontroldevelopmentdifferentdiseaseeconomicseducationhealthhealthcareimportantinfrastructureissuesknowledgelarge
SHARED TOKENS (45): "access", "basic", "care", "communities", "community", "complex", "comprehensive", "control", "development", "different", "disease", "economics", "education", "health", "healthcare", "important", "infrastructure", "issues", "knowledge", "large".... | EXACT TITLE in veterinary_animal_services: "Public health". | EXACT TITLE in pets: "Public health".
0.500
Housing ↗ Q1247867 EXACT TITLE
accessaffectsassistancebecomedemanddepartmentdirectdirectlyeducationemergencyemploymentfoodgovernmenthealthhealthcarehomehousingissueslivingmarket
SHARED TOKENS (43): "access", "affects", "assistance", "become", "demand", "department", "direct", "directly", "education", "emergency", "employment", "food", "government", "health", "healthcare", "home", "housing", "issues", "living", "market".... | EXACT TITLE in veterinary_animal_services: "Housing". | EXACT TITLE in pets: "Housing".
0.500
Vaccination ↗ Q192995 EXACT TITLE
administrationagecenterscontroldiseasegeographichealthlargelistsmajormedicalnationalorganizationpartlypeoplepopulationprovidepublicresponsiblerising
SHARED TOKENS (26): "administration", "age", "centers", "control", "disease", "geographic", "health", "large", "lists", "major", "medical", "national", "organization", "partly", "people", "population", "provide", "public", "responsible", "rising".... | EXACT TITLE in veterinary_animal_services: "Vaccination". | EXACT TITLE in pets: "Vaccination".
0.500
Flood ↗ Q8068 EXACT TITLE
accessagriculturalbusinessescapacitychangescitiesdomesticenvironmenteventshealthhomesincreaseindustryissueslakelandlargelong-termmajormakes
SHARED TOKENS (30): "access", "agricultural", "businesses", "capacity", "changes", "cities", "domestic", "environment", "events", "health", "homes", "increase", "industry", "issues", "lake", "land", "large", "long-term", "major", "makes".... | EXACT TITLE in veterinary_animal_services: "Flood".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecarecommunitydirecthealthinstitutionaljurisdictionslinksmedicationpracticeproductsprovidingrolessafetysuppliesthereforework
SHARED TOKENS (17): "become", "care", "community", "direct", "health", "institutional", "jurisdictions", "links", "medication", "practice", "products", "providing", "roles", "safety", "supplies", "therefore", "work". | EXACT TITLE in veterinary_animal_services: "Pharmacy".
0.500
adoptionageallowscarechangeschroniccollectiondifferenthealthhealthcareimprovelargelong-termmeansmedicalmedicationmultipleneednetworksopen
SHARED TOKENS (29): "adoption", "age", "allows", "care", "changes", "chronic", "collection", "different", "health", "healthcare", "improve", "large", "long-term", "means", "medical", "medication", "multiple", "need", "networks", "open".... | EXACT TITLE in veterinary_animal_services: "Electronic health record".
0.500
affectscaredifferentdiseasehandlinglargemakingmedicationpeoplepreventivereportedriskruralthemtreatmentvaccination
SHARED TOKENS (16): "affects", "care", "different", "disease", "handling", "large", "making", "medication", "people", "preventive", "reported", "risk", "rural", "them", "treatment", "vaccination". | EXACT TITLE in veterinary_animal_services: "Plague (disease)".
0.500
Pet ↗ Q39201 EXACT TITLE
carecatscompanionconcernsdogdogsequinehomehomeshospitalshousingintelligencelivestocklivingownerownerspeoplepersonpetpets
SHARED TOKENS (28): "care", "cats", "companion", "concerns", "dog", "dogs", "equine", "home", "homes", "hospitals", "housing", "intelligence", "livestock", "living", "owner", "owners", "people", "person", "pet", "pets".... | EXACT TITLE in veterinary_animal_services: "Pet". | EXACT TITLE in pets: "Pet".
0.500
Poultry ↗ Q178559 EXACT TITLE
aroundcommercialdifferentfamilyfoodgrowthinvolvingmarketpeoplepracticeprocessproductsreducerisksmallsourcespeciessupplysystemsthem
SHARED TOKENS (20): "around", "commercial", "different", "family", "food", "growth", "involving", "market", "people", "practice", "process", "products", "reduce", "risk", "small", "source", "species", "supply", "systems", "them". | EXACT TITLE in veterinary_animal_services: "Poultry".
0.500
administrationcommunitydepartmentdomesticenforcementestablishedgovernmentintelligenceinvolvingjurisdictionlawnationaloperationsratherreportsresponsiblescheduling
SHARED TOKENS (17): "administration", "community", "department", "domestic", "enforcement", "established", "government", "intelligence", "involving", "jurisdiction", "law", "national", "operations", "rather", "reports", "responsible", "scheduling". | EXACT TITLE in veterinary_animal_services: "Drug Enforcement Administration".
0.500
Quarantine ↗ Q182899 EXACT TITLE
aroundbroaderdifferentdiseaseenforcementgovernmenthealthlawmedicalpeoplepopulationpracticepublicratherseparatedwestern
SHARED TOKENS (16): "around", "broader", "different", "disease", "enforcement", "government", "health", "law", "medical", "people", "population", "practice", "public", "rather", "separated", "western". | EXACT TITLE in veterinary_animal_services: "Quarantine".
0.500
Ranch ↗ Q509028 EXACT TITLE
additionalcontrolfeedhorseslandlargelimitedlivestockmanagementoperationspeoplepracticeprivatesizesmallerwestwesternwildlife
SHARED TOKENS (18): "additional", "control", "feed", "horses", "land", "large", "limited", "livestock", "management", "operations", "people", "practice", "private", "size", "smaller", "west", "western", "wildlife". | EXACT TITLE in veterinary_animal_services: "Ranch".
0.500
Rabbit ↗ Q9394 EXACT TITLE
affectallowsdiseasedomesticfamilyformerlargelimitedlitterslivestocklivinglongermajoropenpetpracticeproductsproviderabbitssmall
SHARED TOKENS (23): "affect", "allows", "disease", "domestic", "family", "former", "large", "limited", "litters", "livestock", "living", "longer", "major", "open", "pet", "practice", "products", "provide", "rabbits", "small".... | EXACT TITLE in veterinary_animal_services: "Rabbit". | EXACT TITLE in pets: "Rabbit".
0.500
Sheep ↗ EXACT TITLE
ageagriculturalapplyaroundcenterdomesticgeographicimportantlargelifelivestockmajormakingmodelolderregionsmallerspeciesthemwestern
SHARED TOKENS (20): "age", "agricultural", "apply", "around", "center", "domestic", "geographic", "important", "large", "life", "livestock", "major", "making", "model", "older", "region", "smaller", "species", "them", "western". | EXACT TITLE in veterinary_animal_services: "Sheep".
0.500
4-H ↗ Q238139 EXACT TITLE
communityconsumercreatedepartmentdevelopmentfamilyfoodhealthlivinglocalnationaloperatesorganizationprovideprovidedstaffsystemworkyouth
SHARED TOKENS (19): "community", "consumer", "create", "department", "development", "family", "food", "health", "living", "local", "national", "operates", "organization", "provide", "provided", "staff", "system", "work", "youth". | EXACT TITLE in pets: "4-H".
0.500
Anthrax ↗ Q129104 EXACT TITLE
becomecentercenterscontroldependdevelopmentdirectlydiseaselivestockmonthspeopleproductsrisksmallsurroundingtreatmentwork
SHARED TOKENS (17): "become", "center", "centers", "control", "depend", "development", "directly", "disease", "livestock", "months", "people", "products", "risk", "small", "surrounding", "treatment", "work". | EXACT TITLE in veterinary_animal_services: "Anthrax".
0.500
One Health ↗ Q7092706 EXACT TITLE
carecommunitiescomprehensivedevelopmentdomesticenvironmentfoodfosterhealthindependentlongermultipleneedorganizationpeopleprovidedpublicsocietyspeciessupport
SHARED TOKENS (21): "care", "communities", "comprehensive", "development", "domestic", "environment", "food", "foster", "health", "independent", "longer", "multiple", "need", "organization", "people", "provided", "public", "society", "species", "support".... | EXACT TITLE in veterinary_animal_services: "One Health".
0.500
agriculturalaroundcarechangesfeedgoatslandlivestockmajormanagementproductsrequirescalespeciessystems
SHARED TOKENS (15): "agricultural", "around", "care", "changes", "feed", "goats", "land", "livestock", "major", "management", "products", "require", "scale", "species", "systems". | EXACT TITLE in veterinary_animal_services: "Animal husbandry".
0.500
Rodeo ↗ Q207703 EXACT TITLE
basiccarecrueltyequipmenteventshorsesindustrylivestocklocallongermakingnationalofficialorganizationpublicregionrequiredrequirementsrestrictionsruns
SHARED TOKENS (23): "basic", "care", "cruelty", "equipment", "events", "horses", "industry", "livestock", "local", "longer", "making", "national", "official", "organization", "public", "region", "required", "requirements", "restrictions", "runs".... | EXACT TITLE in veterinary_animal_services: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
businessescurrentdetermineemploymentgovernmentindustrylargelimitedmedicalopenorganizationoversightpersonpracticeproviderelevantrulessystemthemtherefore
SHARED TOKENS (23): "businesses", "current", "determine", "employment", "government", "industry", "large", "limited", "medical", "open", "organization", "oversight", "person", "practice", "provide", "relevant", "rules", "system", "them", "therefore".... | EXACT TITLE in veterinary_animal_services: "Internship".
0.500
agriculturalassistancecommercialcommunitiescurrentdepartmentdirectlyfoodgovernmentlivestocknationalreportsruralsafetyserved
SHARED TOKENS (15): "agricultural", "assistance", "commercial", "communities", "current", "department", "directly", "food", "government", "livestock", "national", "reports", "rural", "safety", "served". | EXACT TITLE in veterinary_animal_services: "United States Department of Agriculture".
0.500
Feedlot ↗ Q1400937 EXACT TITLE
affectagriculturalaroundbasiccompletedifferentenvironmentfeedfoodgovernmenthorsesincreaselargelawlicenselivestockmanagementnationaloperationsrather
SHARED TOKENS (27): "affect", "agricultural", "around", "basic", "complete", "different", "environment", "feed", "food", "government", "horses", "increase", "large", "law", "license", "livestock", "management", "national", "operations", "rather".... | EXACT TITLE in veterinary_animal_services: "Feedlot".
0.500
adaboisecanyoncommunitycomprehensivedevelopmenteducationidaholargenampapopulationpublicreportedresidentsservedtreasurevalleywesternworkforce
SHARED TOKENS (19): "ada", "boise", "canyon", "community", "comprehensive", "development", "education", "idaho", "large", "nampa", "population", "public", "reported", "residents", "served", "treasure", "valley", "western", "workforce". | EXACT TITLE in veterinary_animal_services: "College of Western Idaho".
0.500
communityentityfinancegeneratehospitalsinstitutionlocalnonprofitoperatesoperationsorganizationownerspersonprivatepublicratherrevenuesocialstatus
SHARED TOKENS (19): "community", "entity", "finance", "generate", "hospitals", "institution", "local", "nonprofit", "operates", "operations", "organization", "owners", "person", "private", "public", "rather", "revenue", "social", "status". | EXACT TITLE in veterinary_animal_services: "Nonprofit organization".
0.500
administrationcontrolcurrentdepartmentdirectlyfeedfoodformerhealthhouseholdmedicalpetsproductspublicreportsresponsiblesafetysupervisionvaccinesveterinary
SHARED TOKENS (21): "administration", "control", "current", "department", "directly", "feed", "food", "former", "health", "household", "medical", "pets", "products", "public", "reports", "responsible", "safety", "supervision", "vaccines", "veterinary".... | EXACT TITLE in veterinary_animal_services: "Food and Drug Administration".
0.490
departmenthealthnationalorganizationresponsibleveterinarywelfare
SHARED TOKENS (7): "department", "health", "national", "organization", "responsible", "veterinary", "welfare". | URL->A (1): http://www.aphis.usda.gov/. | EXACT TITLE in veterinary_animal_services: "Animal and Plant Health Inspection Service".
0.480
Pet store ↗ Q220142 EXACT TITLE
carecatdogfoodgroomingownerpetproductsprovidepublicsuppliestagstrainingtreats
SHARED TOKENS (14): "care", "cat", "dog", "food", "grooming", "owner", "pet", "products", "provide", "public", "supplies", "tags", "training", "treats". | EXACT TITLE in pets: "Pet store".
0.480
centerscontroldiseasehealthhospitalshoursincreaseknowledgeorganizationpatternspracticepublicreportingrole
SHARED TOKENS (14): "centers", "control", "disease", "health", "hospitals", "hours", "increase", "knowledge", "organization", "patterns", "practice", "public", "reporting", "role". | EXACT TITLE in veterinary_animal_services: "Disease surveillance".
0.480
Raccoon ↗ Q121439 EXACT TITLE
behaviorcitiesenvironmentfamilyhomeintelligencelifelistraccoonsshowsocialspeciessurroundingthem
SHARED TOKENS (14): "behavior", "cities", "environment", "family", "home", "intelligence", "life", "list", "raccoons", "show", "social", "species", "surrounding", "them". | EXACT TITLE in veterinary_animal_services: "Raccoon". | EXACT TITLE in pets: "Raccoon".
0.460
becomecompletedepartmentdepartmentseducationentrymedicalmedicineprovidingrequireveterinarianveterinariansveterinary
SHARED TOKENS (13): "become", "complete", "department", "departments", "education", "entry", "medical", "medicine", "providing", "require", "veterinarian", "veterinarians", "veterinary". | EXACT TITLE in veterinary_animal_services: "Veterinary education".
0.460
adoptioncarecatcatscommunitydescribeslocalmeansownerresidentsstraysurgicalsystem
SHARED TOKENS (13): "adoption", "care", "cat", "cats", "community", "describes", "local", "means", "owner", "residents", "stray", "surgical", "system". | EXACT TITLE in pets: "Community cat".
0.460
carecentersdiseasehumaneimportantinstitutionalmedicalmedicinemodelsrolespeciesveterinariansveterinary
SHARED TOKENS (13): "care", "centers", "disease", "humane", "important", "institutional", "medical", "medicine", "models", "role", "species", "veterinarians", "veterinary". | EXACT TITLE in veterinary_animal_services: "Comparative medicine".
0.450
additionalapplicantsbeyondcarecompleteeducationentrygeneralimportantlistmedicinenationalpracticeproviderequirerequiresrolespecialistspecialtystaff
SHARED TOKENS (25): "additional", "applicants", "beyond", "care", "complete", "education", "entry", "general", "important", "list", "medicine", "national", "practice", "provide", "require", "requires", "role", "specialist", "specialty", "staff".... | URL->A (1): http://www.avma.org/.
0.450
administrationbehaviorbreedcarecatscontroldiagnosticdogsgoatshomehorsesmajormedicineownerpeoplepetsproceduresprocesssizespecies
SHARED TOKENS (26): "administration", "behavior", "breed", "care", "cats", "control", "diagnostic", "dogs", "goats", "home", "horses", "major", "medicine", "owner", "people", "pets", "procedures", "process", "size", "species".... | URL->A (1): http://www.navta.net/.
0.440
Tick ↗ Q10304508 EXACT TITLE
affectagearoundbecomeenvironmentfamilyfeedlifelivingmajorspeciesstructure
SHARED TOKENS (12): "affect", "age", "around", "become", "environment", "family", "feed", "life", "living", "major", "species", "structure". | EXACT TITLE in pets: "Tick".
0.440
Biology ↗ Q420 EXACT TITLE
basicdiscoveryexplainfunctiongrowthlifelivingmedicinemultipleorganizationpopulationstructure
SHARED TOKENS (12): "basic", "discovery", "explain", "function", "growth", "life", "living", "medicine", "multiple", "organization", "population", "structure". | EXACT TITLE in veterinary_animal_services: "Biology".
0.420
Biosecurity ↗ Q803874 EXACT TITLE
differentdiseasefoodlivestockpeoplepopulationpreventivereduceriskspecieswelfare
SHARED TOKENS (11): "different", "disease", "food", "livestock", "people", "population", "preventive", "reduce", "risk", "species", "welfare". | EXACT TITLE in veterinary_animal_services: "Biosecurity".
0.420
Zoo ↗ Q43501 EXACT TITLE
behaviorcollectionconcernsfacilitygardenhousingimproveopenedpeoplepublicwelfare
SHARED TOKENS (11): "behavior", "collection", "concerns", "facility", "garden", "housing", "improve", "opened", "people", "public", "welfare". | EXACT TITLE in veterinary_animal_services: "Zoo".
0.420
basiccatscontroldiseasedogsgoatsimportantmodelraccoonsspeciesvaccines
SHARED TOKENS (11): "basic", "cats", "control", "disease", "dogs", "goats", "important", "model", "raccoons", "species", "vaccines". | EXACT TITLE in veterinary_animal_services: "Pseudorabies".
0.420
boisedivisioneconomicseducationhealthidahoindependentinstitutionpublicreportedwest
SHARED TOKENS (11): "boise", "division", "economics", "education", "health", "idaho", "independent", "institution", "public", "reported", "west". | EXACT TITLE in veterinary_animal_services: "Boise State University".
0.400
Mink ↗ Q17700 EXACT TITLE
controlestablishedfamilymedicalproductsspeciestreattreatmentwelfarewildlife
SHARED TOKENS (10): "control", "established", "family", "medical", "products", "species", "treat", "treatment", "welfare", "wildlife". | EXACT TITLE in veterinary_animal_services: "Mink".
0.400
adoptionlakenonprofitorganizationpetrescueshelterssocietystarwelfare
SHARED TOKENS (10): "adoption", "lake", "nonprofit", "organization", "pet", "rescue", "shelters", "society", "star", "welfare". | EXACT TITLE in pets: "Best Friends Animal Society".
0.400
communitycomprehensiveconcernsidaholakepublicrivershowstatuswestern
SHARED TOKENS (10): "community", "comprehensive", "concerns", "idaho", "lake", "public", "river", "show", "status", "western". | EXACT TITLE in veterinary_animal_services: "North Idaho College".
0.400
Pet food ↗ Q6648982 EXACT TITLE
catdogfeedfoodgeneralindustrymajormarketpetpets
SHARED TOKENS (10): "cat", "dog", "feed", "food", "general", "industry", "major", "market", "pet", "pets". | EXACT TITLE in pets: "Pet food".
0.400
beyonddevelopmenteventsknowledgemodelnetworksopensearchsocialsystems
SHARED TOKENS (10): "beyond", "development", "events", "knowledge", "model", "networks", "open", "search", "social", "systems". | EXACT TITLE in veterinary_animal_services: "Knowledge graph".
0.400
additionalboisecommunitycomprehensiveidaholargepublicregionvalleywestern
SHARED TOKENS (10): "additional", "boise", "community", "comprehensive", "idaho", "large", "public", "region", "valley", "western". | EXACT TITLE in veterinary_animal_services: "College of Southern Idaho".
0.400
affectaffectedaffectsbecomeclassificationdiseasedomesticlimitedspeciesvaccination
SHARED TOKENS (10): "affect", "affected", "affects", "become", "classification", "disease", "domestic", "limited", "species", "vaccination". | EXACT TITLE in veterinary_animal_services: "Avian influenza".
0.380
Kennel ↗ Q2724542 EXACT TITLE
buildingcollectiondogdogskennelkennelsmeansshelterstructure
SHARED TOKENS (9): "building", "collection", "dog", "dogs", "kennel", "kennels", "means", "shelter", "structure". | EXACT TITLE in veterinary_animal_services: "Kennel". | EXACT TITLE in pets: "Kennel".
0.380
Tularemia ↗ Q153861 EXACT TITLE
affectedarounddeaddirectlydiseasepeoplerabbitsreportedtreatment
SHARED TOKENS (9): "affected", "around", "dead", "directly", "disease", "people", "rabbits", "reported", "treatment". | EXACT TITLE in veterinary_animal_services: "Tularemia".
0.380
Brucellosis ↗ Q156050 EXACT TITLE
affectschronicdiseasedogsfunctiongoatslifesmallspecies
SHARED TOKENS (9): "affects", "chronic", "disease", "dogs", "function", "goats", "life", "small", "species". | EXACT TITLE in veterinary_animal_services: "Brucellosis".
0.380
Cattle ↗ Q830 EXACT TITLE
largelivestockpetsproductsresponsiblesmallspeciesthemwestern
SHARED TOKENS (9): "large", "livestock", "pets", "products", "responsible", "small", "species", "them", "western". | EXACT TITLE in veterinary_animal_services: "Cattle".
0.360
boisedivisionestablishedidahoopenedoperatespublicrural
SHARED TOKENS (8): "boise", "division", "established", "idaho", "opened", "operates", "public", "rural". | EXACT TITLE in veterinary_animal_services: "University of Idaho".
0.360
Ann Morrison Park ↗ EXACT TITLE
boisedepartmenteventsfacilitiesidahooutdoorpeopleriver
SHARED TOKENS (8): "boise", "department", "events", "facilities", "idaho", "outdoor", "people", "river". | EXACT TITLE in pets: "Ann Morrison Park".
0.360
behaviordevelopmentdogdogsdomesticphysicalsocialwelfare
SHARED TOKENS (8): "behavior", "development", "dog", "dogs", "domestic", "physical", "social", "welfare". | EXACT TITLE in pets: "Dog behavior".
0.340
Q fever ↗ Q164818 EXACT TITLE
affectscatsdiseasedogsdomesticgoatsparasite
SHARED TOKENS (7): "affects", "cats", "disease", "dogs", "domestic", "goats", "parasite". | EXACT TITLE in veterinary_animal_services: "Q fever".
0.340
Farrier ↗ Q694579 EXACT TITLE
becomecareequinehorsesknowledgespecialistveterinarian
SHARED TOKENS (7): "become", "care", "equine", "horses", "knowledge", "specialist", "veterinarian". | EXACT TITLE in veterinary_animal_services: "Farrier". | EXACT TITLE in pets: "Farrier".
0.340
Goat ↗ Q2934 EXACT TITLE
arounddomesticfamilygoatslivestocklivingspecies
SHARED TOKENS (7): "around", "domestic", "family", "goats", "livestock", "living", "species". | EXACT TITLE in veterinary_animal_services: "Goat". | EXACT TITLE in pets: "Goat".
0.320
companionhealthcareindustrymarketpetproducts
SHARED TOKENS (6): "companion", "healthcare", "industry", "market", "pet", "products". | EXACT TITLE in pets: "Pet industry".
0.320
businessesfinancialfundraisingnonprofitonlineprocess
SHARED TOKENS (6): "businesses", "financial", "fundraising", "nonprofit", "online", "process". | EXACT TITLE in veterinary_animal_services: "Fundraising". | EXACT TITLE in pets: "Fundraising".
0.320
crueltyhumanelifeproviderescuesociety
SHARED TOKENS (6): "cruelty", "humane", "life", "provide", "rescue", "society". | EXACT TITLE in veterinary_animal_services: "Humane society". | EXACT TITLE in pets: "Humane society".
0.300
Dairy farming ↗ KW CROSS HIGH
agriculturalaroundcontrolcreateddirectgeneralgrowthhealthimportantincreaseindustryissueslargelivestocklong-termrolescalesmallsystemswaste
SHARED TOKENS (21): "agricultural", "around", "control", "created", "direct", "general", "growth", "health", "important", "increase", "industry", "issues", "large", "livestock", "long-term", "role", "scale", "small", "systems", "waste"....
0.300
administrationapplicantscarecommercialdifferentgovernmenthealthindustryjurisdictionlicenselicensedlicenseslinksmedicalnationalonlineoperatingprivateproviderequires
SHARED TOKENS (22): "administration", "applicants", "care", "commercial", "different", "government", "health", "industry", "jurisdiction", "license", "licensed", "licenses", "links", "medical", "national", "online", "operating", "private", "provide", "requires"....
0.300
carecomplexconcernsdecisiondevelopmentdiseasehealthhealthcareintelligenceinvolvingissuesmedicalplanningpublicsupportsystemstreatment
SHARED TOKENS (17): "care", "complex", "concerns", "decision", "development", "disease", "health", "healthcare", "intelligence", "involving", "issues", "medical", "planning", "public", "support", "systems", "treatment".
0.300
agebehaviorcaninedifferentdogdogsenvironmenthealthimportantmedicalpersonphysicalratherspacestatus
SHARED TOKENS (15): "age", "behavior", "canine", "different", "dog", "dogs", "environment", "health", "important", "medical", "person", "physical", "rather", "space", "status".
0.300
Dog licence ↗ Q38683 KW CROSS HIGH
additionalcurrentdogjurisdictionskeeplicensingorganizationownerpetrabiesrequirerequiredsmallstrayvaccination
SHARED TOKENS (15): "additional", "current", "dog", "jurisdictions", "keep", "licensing", "organization", "owner", "pet", "rabies", "require", "required", "small", "stray", "vaccination".
0.300
administrationchangescontrolcreateddecisionsdivisioneducationenforcementenvironmentgovernmentincreaseitselflawlegalmodelopenedpublicregulaterulessocial
SHARED TOKENS (23): "administration", "changes", "control", "created", "decisions", "division", "education", "enforcement", "environment", "government", "increase", "itself", "law", "legal", "model", "opened", "public", "regulate", "rules", "social"....
0.300
administrationagriculturalcompliancediseaseenvironmentfeedfoodgrowthhealthimportantimproveincreaseindustrylivestockmedicineorganizationsafetysupporttreattreatment
SHARED TOKENS (22): "administration", "agricultural", "compliance", "disease", "environment", "feed", "food", "growth", "health", "important", "improve", "increase", "industry", "livestock", "medicine", "organization", "safety", "support", "treat", "treatment"....
0.300
behaviorchangescitiescommunitiescommunitycomprehensivecostsdependdependsdevelopmentfacilitiesfunctionhealthjurisdictionslandmeanspatternspeoplephysicalplanning
SHARED TOKENS (27): "behavior", "changes", "cities", "communities", "community", "comprehensive", "costs", "depend", "depends", "development", "facilities", "function", "health", "jurisdictions", "land", "means", "patterns", "people", "physical", "planning"....
0.300
additionalcarecatdeaddogfacilitiesfacilityjurisdictionlawlicenselicensedmonthspersonpetpoliciesrequiredspeciestrainedtreatmentveterinarian
SHARED TOKENS (21): "additional", "care", "cat", "dead", "dog", "facilities", "facility", "jurisdiction", "law", "license", "licensed", "months", "person", "pet", "policies", "required", "species", "trained", "treatment", "veterinarian"....
0.300
capacitydangeroushousinglawlifelimitsmedicalprotocolspublicqualityrequiredsafetysheltershelterssystemwork
SHARED TOKENS (16): "capacity", "dangerous", "housing", "law", "life", "limits", "medical", "protocols", "public", "quality", "required", "safety", "shelter", "shelters", "system", "work".
0.300
accessadministrationcapacitycenterschangescontroldepartmentdiseasefoodgovernmenthealthimproveinstitutionallongermajormedicalnationalorganizationpublicrestrictions
SHARED TOKENS (21): "access", "administration", "capacity", "centers", "changes", "control", "department", "disease", "food", "government", "health", "improve", "institutional", "longer", "major", "medical", "national", "organization", "public", "restrictions"....
0.300
accessboiseconnectscreateddepartmentgardenidaholandmunicipalregionriverrunssocietywestwestern
SHARED TOKENS (15): "access", "boise", "connects", "created", "department", "garden", "idaho", "land", "municipal", "region", "river", "runs", "society", "west", "western".
0.300
affectbecomebuildingcategorycommercialcommunitycontrolcreateddecisionsdevelopmentdifferentestategrowthhomeshousingjurisdictionjurisdictionslandlargelaw
SHARED TOKENS (42): "affect", "become", "building", "category", "commercial", "community", "control", "created", "decisions", "development", "different", "estate", "growth", "homes", "housing", "jurisdiction", "jurisdictions", "land", "large", "law"....
0.300
adoptionbreedcatcatscommunitiescommunitycomplaintscostsdirectfeedfoodgrowthhomesincreaselandlifemeansmedicalownerspeople
SHARED TOKENS (31): "adoption", "breed", "cat", "cats", "communities", "community", "complaints", "costs", "direct", "feed", "food", "growth", "homes", "increase", "land", "life", "means", "medical", "owners", "people"....
0.300
careclinicscontrolfoodhorseshousinghumanekennelslargemedicalownerspetpetsrescueshelterssizetagstrainersveterinarians
SHARED TOKENS (19): "care", "clinics", "control", "food", "horses", "housing", "humane", "kennels", "large", "medical", "owners", "pet", "pets", "rescue", "shelters", "size", "tags", "trainers", "veterinarians".
0.300
carecommunitiescurrentdomesticfinancehealthhealthcareindustrymedicalpersonpharmaceuticalspreventiveproductsrequirementssystemtreat
SHARED TOKENS (16): "care", "communities", "current", "domestic", "finance", "health", "healthcare", "industry", "medical", "person", "pharmaceuticals", "preventive", "products", "requirements", "system", "treat".
0.300
Petfinder ↗ Q7178304 KW CROSS HIGH
adoptionadoptionscatscommercialdogshorseslistlistslivestockonlineoperatespetpetsreportsrescueservingshelterssmall
SHARED TOKENS (18): "adoption", "adoptions", "cats", "commercial", "dogs", "horses", "list", "lists", "livestock", "online", "operates", "pet", "pets", "reports", "rescue", "serving", "shelters", "small".
0.300
accessdevelopmentdirectlyhealthmanagementmedicinemultipleorganizationpreventiveprovidepublicreducerequireresponsiblesidethemtreat
SHARED TOKENS (17): "access", "development", "directly", "health", "management", "medicine", "multiple", "organization", "preventive", "provide", "public", "reduce", "require", "responsible", "side", "them", "treat".
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agecanyoncommercialcontrolcreatedidahoimportantlakelargelimitedmajornationalpolicyprivatepublicrapidregionriverroleruns
SHARED TOKENS (23): "age", "canyon", "commercial", "control", "created", "idaho", "important", "lake", "large", "limited", "major", "national", "policy", "private", "public", "rapid", "region", "river", "role", "runs"....
0.300
careclinicsemergencyenvironmentfacilitiesgeneralgeneratehealthhealthcarehomehomeshospitalhospitalsinvolvingmedicaloperatingrequiresuppliestreatmentunwanted
SHARED TOKENS (23): "care", "clinics", "emergency", "environment", "facilities", "general", "generate", "health", "healthcare", "home", "homes", "hospital", "hospitals", "involving", "medical", "operating", "require", "supplies", "treatment", "unwanted"....
0.300
Feral cat ↗ Q2404562 KW CROSS HIGH
becomebreedcatcatscontroldomesticfeeditselflistlocallong-termpeoplespeciesstraythemwildlife
SHARED TOKENS (16): "become", "breed", "cat", "cats", "control", "domestic", "feed", "itself", "list", "local", "long-term", "people", "species", "stray", "them", "wildlife".
0.300
affectapplychangescreateddescribesdirectdiseasedomesticenvironmenthealthincreaseindustrymodelpeoplepopulationspecieswildlife
SHARED TOKENS (17): "affect", "apply", "changes", "created", "describes", "direct", "disease", "domestic", "environment", "health", "increase", "industry", "model", "people", "population", "species", "wildlife".
0.300
Dog breed ↗ KW CROSS HIGH
behaviorbreedcaninedifferentdogdogsdomesticfunctionkennelnationalorganizationphysicalroleshowshowssizesmallsocietyspeciesthem
SHARED TOKENS (20): "behavior", "breed", "canine", "different", "dog", "dogs", "domestic", "function", "kennel", "national", "organization", "physical", "role", "show", "shows", "size", "small", "society", "species", "them".
0.300
Estray ↗ Q3930015 KW CROSS HIGH
carecatcostsdecisiondogdomesticgenerallargelawlivestocklocalownerownershippersonpetsplacesprocesspublicratherreported
SHARED TOKENS (24): "care", "cat", "costs", "decision", "dog", "domestic", "general", "large", "law", "livestock", "local", "owner", "ownership", "person", "pets", "places", "process", "public", "rather", "reported"....
0.300
Raw feeding ↗ KW CROSS HIGH
catscommercialconcernsdogsdomesticfeedfoodhealthlimitedownerspeoplepetpetspracticeproductsrisksurrounding
SHARED TOKENS (17): "cats", "commercial", "concerns", "dogs", "domestic", "feed", "food", "health", "limited", "owners", "people", "pet", "pets", "practice", "products", "risk", "surrounding".
0.300
Telehealth ↗ Q46994 KW CROSS HIGH
accessadministrationcarediagnosticeducationfacilitiesfeedhealthhealthcarehigherhomeimprovelimitedmanagementmeansmedicalmedicineonlinephysicalpractice
SHARED TOKENS (32): "access", "administration", "care", "diagnostic", "education", "facilities", "feed", "health", "healthcare", "higher", "home", "improve", "limited", "management", "means", "medical", "medicine", "online", "physical", "practice"....
0.300
basicbusinessescarecentersclinicscommercialcomprehensivedecisionsdiseasefacilitieshealthhospitalsindependentlong-termmanagementmedicalprovideprovidedsizetreatment
SHARED TOKENS (20): "basic", "businesses", "care", "centers", "clinics", "commercial", "comprehensive", "decisions", "disease", "facilities", "health", "hospitals", "independent", "long-term", "management", "medical", "provide", "provided", "size", "treatment".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
adoptedapplybuildingcodecodescompliancecontroldepartmentsestatefacilitygeneralhealthinsurancejurisdictionjurisdictionallawlocalmodelnationalplanning
SHARED TOKENS (31): "adopted", "apply", "building", "code", "codes", "compliance", "control", "departments", "estate", "facility", "general", "health", "insurance", "jurisdiction", "jurisdictional", "law", "local", "model", "national", "planning"....
0.300
affectsbehaviorconcernsconsumercreatesentrygeneralgovernmentgrowthhealthhigherlawlicenselicensedlicensingmarketpersonprovideprovidedpublic
SHARED TOKENS (24): "affects", "behavior", "concerns", "consumer", "creates", "entry", "general", "government", "growth", "health", "higher", "law", "license", "licensed", "licensing", "market", "person", "provide", "provided", "public"....
0.300
Dog park ↗ Q38516 EXACT TITLE
dogdogsenvironmentownerssupervision
SHARED TOKENS (5): "dog", "dogs", "environment", "owners", "supervision". | EXACT TITLE in pets: "Dog park".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
directentityexplicitlyfeesfinancialgrowthlargelegallicenseslicensingmarketmeansmodelpracticeproceduresproductsregulaterisksmallsystem
SHARED TOKENS (20): "direct", "entity", "explicitly", "fees", "financial", "growth", "large", "legal", "licenses", "licensing", "market", "means", "model", "practice", "procedures", "products", "regulate", "risk", "small", "system".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
categorychangescontroldevelopmentfinancefinancialfinancinggenerallimitedlong-termmanagementownershippartnershipsprivateproductsprovidepublicratherrole
SHARED TOKENS (19): "category", "changes", "control", "development", "finance", "financial", "financing", "general", "limited", "long-term", "management", "ownership", "partnerships", "private", "products", "provide", "public", "rather", "role".
0.300
Epizootiology ↗ Q4115091 KW CROSS HIGH
affectagriculturalcontroldiseasedomesticenvironmenthealthimprovelivestockpatternspracticepublicrolesystemsveterinarywildlife
SHARED TOKENS (16): "affect", "agricultural", "control", "disease", "domestic", "environment", "health", "improve", "livestock", "patterns", "practice", "public", "role", "systems", "veterinary", "wildlife".
0.300
Animal feed ↗ Q2836947 KW CROSS HIGH
agriculturalbasiccostdemanddomesticenvironmentfeedfoodimportantimprovelandlargelivestockmakesmakingneedreducereducessystemswaste
SHARED TOKENS (20): "agricultural", "basic", "cost", "demand", "domestic", "environment", "feed", "food", "important", "improve", "land", "large", "livestock", "makes", "making", "need", "reduce", "reduces", "systems", "waste".
0.300
Animal rights ↗ Q426 KW CROSS HIGH
basiccentercontractfoodindependentitselflawlegallifemerelypeopleratherrelevantsocialspeciesstatussupportthereforevaluewelfare
SHARED TOKENS (20): "basic", "center", "contract", "food", "independent", "itself", "law", "legal", "life", "merely", "people", "rather", "relevant", "social", "species", "status", "support", "therefore", "value", "welfare".
🫐 BERRY48 edges
0.280
carediseasehousingmedicalprocesspublicrolespeciesthemtreatmentveterinarywelfarewildlifework
SHARED TOKENS (14): "care", "disease", "housing", "medical", "process", "public", "role", "species", "them", "treatment", "veterinary", "welfare", "wildlife", "work".
0.280
Dairy cattle ↗ Q2915 EXACT TITLE
industrylargeproductsspecies
SHARED TOKENS (4): "industry", "large", "products", "species". | EXACT TITLE in veterinary_animal_services: "Dairy cattle".
0.280
entityfinancialsmallertreatment
SHARED TOKENS (4): "entity", "financial", "smaller", "treatment". | EXACT TITLE in veterinary_animal_services: "Consolidation (business)".
0.280
Skunk ↗ Q43604020 EXACT TITLE
differentfamilyskunksspecies
SHARED TOKENS (4): "different", "family", "skunks", "species". | EXACT TITLE in veterinary_animal_services: "Skunk". | EXACT TITLE in pets: "Skunk".
0.280
Shortage ↗ Q2184645 EXACT TITLE
demandeconomicsmarketsupply
SHARED TOKENS (4): "demand", "economics", "market", "supply". | EXACT TITLE in veterinary_animal_services: "Shortage". | EXACT TITLE in pets: "Shortage".
0.280
controlpopulationspecieswork
SHARED TOKENS (4): "control", "population", "species", "work". | EXACT TITLE in veterinary_animal_services: "Animal control". | EXACT TITLE in pets: "Animal control".
0.280
agriculturalcontrolownershipprocess
SHARED TOKENS (4): "agricultural", "control", "ownership", "process". | EXACT TITLE in veterinary_animal_services: "Animal identification".
0.280
controldiseasefinancialfoodgeneralhealthinstitutionalproductsregionalsafetysystemveterinarywelfarework
SHARED TOKENS (14): "control", "disease", "financial", "food", "general", "health", "institutional", "products", "regional", "safety", "system", "veterinary", "welfare", "work".
0.280
buildingcenterscommercialestategeneratehousinglandlocalmedicalmultiplerealresidentialspacezoning
SHARED TOKENS (14): "building", "centers", "commercial", "estate", "generate", "housing", "land", "local", "medical", "multiple", "real", "residential", "space", "zoning".
0.260
Elk ↗ Q180404 KW CROSS HIGH
aroundfamilyhigherindustrylargelivestockopenregionshowssignalspeciesvaccinationwestern
SHARED TOKENS (13): "around", "family", "higher", "industry", "large", "livestock", "open", "region", "shows", "signal", "species", "vaccination", "western".
0.260
Cremation ↗ Q207315 EXACT TITLE
deadhealthrisk
SHARED TOKENS (3): "dead", "health", "risk". | EXACT TITLE in veterinary_animal_services: "Cremation".
0.260
agriculturalpracticesocial
SHARED TOKENS (3): "agricultural", "practice", "social". | EXACT TITLE in veterinary_animal_services: "Agricultural science".
0.260
meanspracticetreatment
SHARED TOKENS (3): "means", "practice", "treatment". | EXACT TITLE in veterinary_animal_services: "Artificial insemination".
0.260
idahomeridianpublic
SHARED TOKENS (3): "idaho", "meridian", "public". | EXACT TITLE in veterinary_animal_services: "Idaho State University".
0.260
arounddepartmenteducationenforcementfinancialgovernmentindependentlegallocalmattersnationalpublicregional
SHARED TOKENS (13): "around", "department", "education", "enforcement", "financial", "government", "independent", "legal", "local", "matters", "national", "public", "regional".
0.260
certificationspeoplerelevant
SHARED TOKENS (3): "certifications", "people", "relevant". | EXACT TITLE in veterinary_animal_services: "Credential".
0.260
Red fox ↗ Q8332 KW CROSS HIGH
carefamilyfoxesimportantlargelistpopulationrabbitssizesmallsmallerspeciessuburban
SHARED TOKENS (13): "care", "family", "foxes", "important", "large", "list", "population", "rabbits", "size", "small", "smaller", "species", "suburban".
0.240
Zoonosis ↗ Q182672 KW CROSS HIGH
dangerousdifferentdirectdirectlydiseaseimportantmajorparasiterabiesrequirerequiredrole
SHARED TOKENS (12): "dangerous", "different", "direct", "directly", "disease", "important", "major", "parasite", "rabies", "require", "required", "role".
0.240
certificationsdepartmentsgovernmentjurisdictionlicenselicenseslocalmultipleoperatingphysicalrequiredrequires
SHARED TOKENS (12): "certifications", "departments", "government", "jurisdiction", "license", "licenses", "local", "multiple", "operating", "physical", "required", "requires".
0.220
catsdogsdomestichumaneissuelitterspetsrescueshelterssocialunwanted
SHARED TOKENS (11): "cats", "dogs", "domestic", "humane", "issue", "litters", "pets", "rescue", "shelters", "social", "unwanted".
0.220
breedoperations
SHARED TOKENS (2): "breed", "operations". | EXACT TITLE in veterinary_animal_services: "Beef cattle".
0.220
diseaseequipmentfunctionindustrylimitedmediamedicalproceduresprocesssignaltreat
SHARED TOKENS (11): "disease", "equipment", "function", "industry", "limited", "media", "medical", "procedures", "process", "signal", "treat".
0.220
Psittacosis ↗ Q164727 EXACT TITLE
diseasefollows
SHARED TOKENS (2): "disease", "follows". | EXACT TITLE in veterinary_animal_services: "Psittacosis".
0.220
differentfacilitieshomeshospitalsimprovelifepopulationprovidedsocialstresstreatment
SHARED TOKENS (11): "different", "facilities", "homes", "hospitals", "improve", "life", "population", "provided", "social", "stress", "treatment".
0.200
addadministrationcontrolfoodlawmedicalmedicationnationalrequirementssafety
SHARED TOKENS (10): "add", "administration", "control", "food", "law", "medical", "medication", "national", "requirements", "safety".
0.200
companiondiscoverydiseaseimportantmedicalrolesafetyveterinariansveterinarywildlife
SHARED TOKENS (10): "companion", "discovery", "disease", "important", "medical", "role", "safety", "veterinarians", "veterinary", "wildlife".
0.180
Photography ↗ Q11633 KW CROSS HIGH
createdirectinsidemeansoperatespersonpracticerealvisible
SHARED TOKENS (9): "create", "direct", "inside", "means", "operates", "person", "practice", "real", "visible".
0.180
Animal science ↗ Q168091 KW CROSS HIGH
broadercatscompanioncontroldogshorseslivestockmanagementspecies
SHARED TOKENS (9): "broader", "cats", "companion", "control", "dogs", "horses", "livestock", "management", "species".
0.180
createddepartmentenforcementidaholawmunicipalorganizationpolicepublic
SHARED TOKENS (9): "created", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "public".
0.180
Volunteering ↗ Q188844 KW CROSS HIGH
communityeducationemergencylabormedicineproviderescuetrainingwork
SHARED TOKENS (9): "community", "education", "emergency", "labor", "medicine", "provide", "rescue", "training", "work".
0.180
completelaborlicensepeoplepracticeprovidedrolessystemtraining
SHARED TOKENS (9): "complete", "labor", "license", "people", "practice", "provided", "roles", "system", "training".
0.160
Pre-medical ↗ Q7239245 KW CROSS HIGH
educationentrymedicalprocessprovidingrequireveterinaryvolunteer
SHARED TOKENS (8): "education", "entry", "medical", "process", "providing", "require", "veterinary", "volunteer".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahomiddletonpopulationstarwest
SHARED TOKENS (8): "ada", "boise", "canyon", "idaho", "middleton", "population", "star", "west".
0.160
carecrueltydomesticpetsproviderathersocietythem
SHARED TOKENS (8): "care", "cruelty", "domestic", "pets", "provide", "rather", "society", "them".
0.160
creatediseasedomesticreducespeciestreattreatmentvaccines
SHARED TOKENS (8): "create", "disease", "domestic", "reduce", "species", "treat", "treatment", "vaccines".
0.160
centerconsumerfinancialfinancingmedicalonlineproductsveterinary
SHARED TOKENS (8): "center", "consumer", "financial", "financing", "medical", "online", "products", "veterinary".
0.140
boisegovernmentidaholimitspeoplepopulationresidents
SHARED TOKENS (7): "boise", "government", "idaho", "limits", "people", "population", "residents".
0.140
brandingcomplexlargelivestockownersystemwest
SHARED TOKENS (7): "branding", "complex", "large", "livestock", "owner", "system", "west".
0.140
diseasehomemedicalmedicinerequiresspecialtywest
SHARED TOKENS (7): "disease", "home", "medical", "medicine", "requires", "specialty", "west".
0.120
healthimprovephysicalpublicsocialveterinary
SHARED TOKENS (6): "health", "improve", "physical", "public", "social", "veterinary".
0.120
horseslivestockpetsspeciestransporttransportation
SHARED TOKENS (6): "horses", "livestock", "pets", "species", "transport", "transportation".
0.120
crueltymeansnonprofitorganizationprovidesociety
SHARED TOKENS (6): "cruelty", "means", "nonprofit", "organization", "provide", "society".
0.120
Pig ↗ Q787 KW CROSS HIGH
aroundcitiesdomesticpetsproductsspecies
SHARED TOKENS (6): "around", "cities", "domestic", "pets", "products", "species".
0.100
educationmedicalmedicineprocessveterinary
SHARED TOKENS (5): "education", "medical", "medicine", "process", "veterinary".
0.100
Machine learning ↗ Q2539 KW CROSS HIGH
developmentexplicitlyintelligencenetworksrisk
SHARED TOKENS (5): "development", "explicitly", "intelligence", "networks", "risk".
0.100
Deer ↗ Q23390 KW CROSS HIGH
familyhandleslandrolespecies
SHARED TOKENS (5): "family", "handles", "land", "role", "species".
0.100
growthlivestockpopulationvaluework
SHARED TOKENS (5): "growth", "livestock", "population", "value", "work".
0.100
departmentgovernmentmanagementpeoplewildlife
SHARED TOKENS (5): "department", "government", "management", "people", "wildlife".
◈ Frequently Asked Questions
Veterinary Animal Services × Pets — Treasure Valley
HAIKU · HIGH GATE
What veterinary medical services do Boise-area pet owners typically access for their dogs and cats?
Veterinary Animal Services in the Treasure Valley provide preventive care, treatment, and health management for companion animals including dogs and cats through licensed veterinarians. These services address the medical needs of the pet population in Boise, Idaho and surrounding areas, from routine examinations to specialized treatment aligned with American Veterinary Medical Association standards.
How does pet adoption in the Treasure Valley connect to veterinary care requirements?
Animal shelters in the Treasure Valley facilitate pet adoption, and adopted dogs and cats require veterinary medicine services for health assessments, rabies vaccination, and ongoing medical care. Veterinary Animal Services ensure newly adopted pets receive the treatment necessary for home integration and long-term wellness in the Boise area.
Why do Treasure Valley pet owners consider veterinary services when choosing pet insurance?
Pet insurance in the Boise, Idaho market reflects the costs of veterinary medical treatment for dogs, cats, and other pets requiring care from licensed veterinarians. Veterinary Animal Services providers in the Treasure Valley work with pet owners to manage medical expenses through prevention, diagnosis, and treatment covered under various insurance plans.
How do veterinary services support animal welfare standards for pets in Boise?
Veterinary Animal Services in the Treasure Valley enforce animal welfare through health assessments, rabies prevention programs, and medical oversight of pets in the Boise area. Licensed veterinarians ensure dogs, cats, and other companion animals receive treatment and care that meets established health and welfare standards across Idaho.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Veterinary Animal Services × Pets 37 QID bridges 190 edges 5,429 ext links 2026-07-17 23:48:48 UTC 28273338f7536799
Veterinary Animal Services corridor ↗ Pets corridor ↗ Pets × Veterinary Animal Services ↗ boisestandard.org/standard ↗
Parent Corridors
Veterinary Animal Services × All Other Verticals