—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Tourism Hospitality ↔ relates to ↔ Outdoor Recreation

16 Wikipedia bridge articles confirmed in both vertical ledgers. 216 deterministic cross-vertical edges. 5,678 external source links harvested. Every edge provenance-stamped. Every claim auditable.

16 QID Bridge Articles
216 Cross Edges
5,678 External Sources
258 Wikipedia Articles
18 🌲 Evergreen
109 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Tourism Hospitality
× Outdoor Recreation
QID Bridge Articles
16
confirmed Wikipedia overlap
Total Cross Edges
216
External Sources Harvested
5,678
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Bogus Basin
score: 1.1500  ·  type: exact_title_cross  ·  16 shared tokens
QID Bridge Titles (16)
Bogus BasinTrailBoise River GreenbeltFishingBoise National ForestCampsiteHikingBoise RiverBirdwatchingBoise, IdahoGarden City, IdahoAda County, IdahoMeridian, IdahoCanyon County, IdahoEagle, IdahoKuna, Idaho
Shared Semantics (20 tokens)
boiseidahomilestrailsroadhikingriverlandwesturbanactivityparkpeoplecapitalsecondbasinmountainnationalprivaterecreation
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:36:43 UTC
Content Hash
6c0431f213f925fd
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
16 BRIDGES
Bogus Basin
Q4937866 EXACT TITLE 1.150
QID OVERLAP: Q4937866 in tourism_hospitality (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (16): "basin", "bogus", "boise", "conditions", "idaho", "land", "miles", "mountain", "national", "operated", "organization", "private", "recreation", "road", "trails", "western". | URL->B (1): http://www.bogusbasin.org/. | EXACT TITLE in tourism_hospitality: "Bogus Basin". | EXACT TITLE in outdoor_recreation: "Bogus Basin".
basinbogusboiseconditionsidaholandmilesmountainnationaloperatedorganizationprivaterecreationroadtrailswestern
Bogus Basin Mountain Recreation Area is a ski area in the western United States, located in Boise County, Idaho, sixteen road miles (26 km) north-northeast of the city of Boise. Bogus is operated by the Bogus Basin Recreation Association, a non-profit organization, on private and leased land in the Boise National Forest. Ski season generally runs from Thanksgiving weekend until the weekend preceding April 15, depending on snow conditions.
History The area probably got its name during the 19th-century gold rush. Crooks in the hills above Boise City, known as "spelterers", would make bogus gold dust by heating lead filings with a bit of real gold dust. Alf Engen, the father of the American powder technique, selected the site for the ski area at Bogus Basin in 1939. It opened to the public 84 years ago in December 1942 with a 500-foot (150 m) rope tow, and a 3,300-foot (1,010 m) T-bar was installed in 1946. In the early 1950s, Bogus had a 30-meter Nordic ski jump, designed by Corey Engen, and his brother Sverre was Bogus' ski instructor. The first chairlift at Bogus was installed in the fall of 1959 at Deer Point, and night skiing debuted in December 1964. The resort currently operates 7 chairlifts and 4 magic carpets. Four of the chairlifts are high-speed quads (#1 Deer Point, and #6 Pine Creek) were installed in 1996 and 1999, #3 Superior in 2011, and #2 Morning Star in 2019. Bogus Basin has 2,600 acres (4.1 mi2; 10.5 km2) of mixed runs, bowls, and glades, with 900 acres (3.6 km2) groomed. The lift-served vertical drop is 1,790 ft (546 m) on the east-facing "back side," with a summit elevation of 7,582 ft (2,311 m) above sea level at the top of Shafer Butte, the highest point of the Boise Ridge mountains. This back side of Shafer Butte was opened in January 1977, following the installation of Pine Creek (#6), a double chairlift, the previous summer. A fixed-grip double for 23 seasons, it became a high-speed quad in the summer of 1999. On the front side, Bogus Basin's southern lift-served summit is at "Doe Point," adjacent to Deer Point, which is slightly higher and covered with communications towers at an elevation of 7,070 feet (2,155 m). Both vantage points overlook Boise and the entire Treasure Valley, over 4,000 vertical feet (1,220 m) below. Bogus' base area and main day lodge (J. R. Simplot Lodge, formerly Bogus Creek) are at 6,150 ft (1,875 m), at the base of the north-facing slopes served by the Deer Point Express (#1), a high-speed quad installed in the summer of 1996. The original double chairlift on #1 was installed in 1959 and upgraded in 1981. Showcase (#4), a double chairlift that had replaced a surface poma lift in 1972, is east of and parallel with the Deer Point Express. The original Deer Point lift was relocated and renamed Coach (#7) in 1996, servicing the beginner learning area. It honors Bill "Coach" Everts, an early area manager (1953–58) and longtime director. At mid-mountain, a second day lodge (Pioneer Lodge - 1973) sits at 6,800 feet (2,070 m) with a sizable parking lot, a cluster of condominia (1975), and the Jason Harper Training Center. From the Pioneer area, there is direct access to the gentle south-facing slopes served by a high-speed quad chairlift, Morning Star (#2) and the north-facing slopes of the Bitterroot (#5), a quad chair lift (vertical: 525 ft (160 m)), which runs only on weekends and holidays. In addition, there is connecting trail access to the base of the Superior Express (#3) lift. With its 1,500-foot (457 m) vertical rise, the Superior Express serves the advanced and expert terrain on the northern face of Shafer Butte, unloading at 7,480 feet (2,280 m). It replaced a Riblet double chairlift built in 1965, and cut the ride time of the original lift in half. Night skiing was added to the Superior area with the installation of lights in the summer of 1986, and Morning Star was converted from a double to a triple chairlift in 1999 then to a quad chairlift in 2019. Historically, Bogus Basin's average annual snowfall is 200–250 inches (510–640 cm), but since 2011, the snowfall has been well below average. Due to limited water resources, there is no significant snow making, only small portable units for patching. Night skiing is available on 165 acres (0.67 km2) on runs served by five of the chairlifts (none on #5 or #6). Three terrain parks are also available; two on the Deer Point mountain, one for advanced, the other for beginner to intermediate skill levels. The Sunshine Park is located on the Morning Star side of the mountain. The main day lodge at Bogus Creek was built in 1962 and expanded in 1991; its ground floor contains the ticket office and ski lockers. In 2002 it was named for agribusiness magnate J. R. Simplot (1909–2008), because without him there might not be a Bogus Basin. When the fledgling ski area was struggling to pay its debts in 1953, Simplot bought its ski lifts and other mountain improvements from the Kingcliffe Co. and leased them back to the Bogus Basin Recreational Association for $1,500 per year for ten years. His intervention averted almost certain financial demise and won the everlasting gratitude of a generation of skiers.
Chairlifts Bogus Basin has 7 chairlifts, and 4 magic carpets. As of 2024-25 ski season, Coach and Bitterroot chairlifts have been replaced by newly built Fixed-grip Skytrac lifts. Their predecessors (1981 Yan lift and 1973 Riblet lift) have been removed and their lift paths have been relocated to a higher vertical. Concept graphics are available on bogusbasin.org as well as specific information. Other activities The GoldRush Tubing Hill opened in the fall of 2003, constructed just west of the main parking lot for about $100,000. Annual revenues from the hill were expected to be four to five times that figure; revenues for its fourth season (2006–07) were just under $140,000. The Glade Runner is a year-round operating mountain coaster that opened in November 2017. The base station was constructed a few yards from the J. R. Simplot Lodge, and the mountain coaster features 4,330 feet (1,320 m) of track. Other summer activities are available at Bogus, including climbing, tubing, hiking, mountain biking, and a disc golf course.
Trail
Q628179 EXACT TITLE 1.000
QID OVERLAP: Q628179 in tourism_hospitality (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (15): "expansion", "hiking", "land", "north", "oregon", "pedestrian", "road", "routes", "simultaneously", "small", "sports", "trail", "trails", "travel", "west". | EXACT TITLE in tourism_hospitality: "Trail". | EXACT TITLE in outdoor_recreation: "Trail".
expansionhikinglandnorthoregonpedestrianroadroutessimultaneouslysmallsportstrailtrailstravelwest
iking trail is the preferred term for a pedestrian trail. However, it is sometimes applied to highways in North America. In the United States, the term was historically used to describe the westward expansion trails (e.g. the Oregon Trail), which are land routes into or through wildness regions of the American West (i.e. the so-called "Wild West") used by explorers and migrants, and "trace" is a synonym for trail (e.g. the Natchez Trace). Some trails are restricted to use by only hikers, cyclists or equestrians, or for cattle driving, snowshoeing or cross-country skiing, while others (e.g. bridleways in the UK) are shared-use and can be used by walkers, cyclists and equestrians simultaneously. Although most trail ban usage by motorized vehicles (primarily due to the significantly higher surface erosion), there are unpaved trails that allow dirt bikes, quad bikes and other off-road vehicles, usually for extreme sports and rally races.
ed primarily for usage by pedestrians, riding animals and non-motorized vehicles, although occasionally some off-roading motor vehicles may also use it. In the United Kingdom and Ireland, footpath or hiking trail is the preferred term for a pedestrian trail. However, it is sometimes applied to highways in North America. In the United States, the term was historically used to describe the westward expansion trails (e.g. the Oregon Trail), which are land routes into or through wildness regions of the American West (i.e. the so-called "Wild West") used by explorers and migrants, and "trace" is a synonym for trail (e.g. the Natchez Trace). Some trails are restricted to use by only hikers, cyclists or equestrians, or for cattle driving, snowshoeing or cross-country skiing, while others (e.g. bridleways in the UK) are shared-use and can be used by walkers, cyclists and equestrians simultaneously. Although most trail ban usage by motorized vehicles (primarily due to the significantly higher surface erosion), there are unpaved trails that allow dirt bikes, quad bikes and other off-road vehicles, usually for extreme sports and rally races.
In Australia, the term "track" can be used interchangeably with trail or walk, and can refer to anything from a dirt road to an unpaved footpath or walkway. In New Zealand, the terms "track" or "walkway" are used almost exclusively except when referring to cross-country skiing: "walkways vary enormously in nature, from short urban strolls, to moderate coastal locations, to challenging tramps [hikes] in the high country [mountains]". Walkway is used similarly in St. John's, Newfoundland, Canada, where the "Grand Concourse", is an integrated walkway system. In the United Kingdom, the term "trail" is in common usage. Longer distance walking routes, and government-promoted long-distance paths, collectively known as National Trails, are also frequently called ways as in the Pennine Way and South Downs Way. Generally, the term footpath is preferred for pedestrian routes, including long-distance trails, and is used for urban paths and sometimes in place of pavement. Track is used for wider paths (wide enough for vehicles), often used for hiking. The terms bridleway, byway, restricted byway are all recognised legal terms and to a greater or lesser extent in general usage. The increased popularity of mountain biking has led to a proliferation of mountain bike trails in many countries. Often these will be grouped to form larger complexes, known as trail centers. In the early years of the 20th century, the term auto trail was used for a marked highway route, and trail is now used to designate routes, including highway routes, designated for tourist interest like the Cabot Trail, Nova Scotia, Canada and the Quilt Trails in the US. The term trail has been used by developers and urban planners for a variety of modern paved roads, highways, and boulevards, in these countries, and some highways continue to be officially called a trail, such as the Susquehanna Trail in Pennsylvania, a designation that varies from a two-lane road to a four-lane freeway.
Boise River Greenbelt
Q4938475 EXACT TITLE 1.000
QID OVERLAP: Q4938475 in tourism_hospitality (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (17): "beyond", "boise", "connects", "eagle", "greenbelt", "idaho", "miles", "parks", "river", "road", "routes", "system", "trail", "trails", "transportation", "urban", "west". | EXACT TITLE in tourism_hospitality: "Boise River Greenbelt". | EXACT TITLE in outdoor_recreation: "Boise River Greenbelt".
beyondboiseconnectseaglegreenbeltidahomilesparksriverroadroutessystemtrailtrailstransportationurbanwest
States. The Boise Greenbelt is more of a greenway than a green belt since its character is linear. It extends more than 20 miles (32 km) beginning at Lucky Peak Dam in the east to a short distance beyond Eagle Road (Idaho State Highway 55) in the west in Eagle, Idaho. Taking into account both sides of the river and other parallel trails and spurs, the total Greenbelt trail system measures more than 30 miles (48 km). The Greenbelt connects Boise's riverside parks and connects Boise with neighboring municipalities. The majority of the Greenbelt is paved with asphalt or concrete on both sides of the river. However some sections are unpaved and bicycles may be prohibited on some unpaved sections. Where this occurs, bicycles have alternate routes on residential streets or dedicated bike paths. Motorized vehicles are prohibited on all parts of the Greenbelt.
the west in Eagle, Idaho. Taking into account both sides of the river and other parallel trails and spurs, the total Greenbelt trail system measures more than 30 miles (48 km). The Greenbelt connects Boise's riverside parks and connects Boise with neighboring municipalities. The majority of the Greenbelt is paved with asphalt or concrete on both sides of the river. However some sections are unpaved and bicycles may be prohibited on some unpaved sections. Where this occurs, bicycles have alternate routes on residential streets or dedicated bike paths. Motorized vehicles are prohibited on all parts of the Greenbelt.
account both sides of the river and other parallel trails and spurs, the total Greenbelt trail system measures more than 30 miles (48 km). The Greenbelt connects Boise's riverside parks and connects Boise with neighboring municipalities. The majority of the Greenbelt is paved with asphalt or concrete on both sides of the river. However some sections are unpaved and bicycles may be prohibited on some unpaved sections. Where this occurs, bicycles have alternate routes on residential streets or dedicated bike paths. Motorized vehicles are prohibited on all parts of the Greenbelt.
Fishing
Q14373 EXACT TITLE 1.000
QID OVERLAP: Q14373 in tourism_hospitality (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (20): "activities", "activity", "additional", "commercial", "culture", "direct", "employment", "environment", "fish", "fishing", "food", "important", "long-term", "million", "park", "people", "provide", "reservoirs", "water", "wildlife". | EXACT TITLE in tourism_hospitality: "Fishing". | EXACT TITLE in outdoor_recreation: "Fishing".
activitiesactivityadditionalcommercialculturedirectemploymentenvironmentfishfishingfoodimportantlong-termmillionparkpeopleprovidereservoirswaterwildlife
o hunting aquatic mammals, where terms like whaling and sealing are used instead. Fishing has been an important part of human culture since hunter-gatherer times. It is one of the few food production activities that has persisted from prehistory into the modern age, surviving both the Neolithic Revolution and successive Industrial Revolutions. In addition to fishing for food, people commonly fish as a recreational pastime. Fishing tournaments are held, and caught fish are sometimes kept long-term as preserved or living trophies. When BioBlitzes occur, fish are typically caught, identified, and then released. According to the United Nations FAO statistics, the total number of commercial fishers and fish farmers is estimated to be 39.0 million. Fishing industries and aquaculture provide direct and indirect employment to over 500 million people in developing countries.
Recreational and sport fishing refer to fishing primarily for pleasure or competition. Recreational fishing has conventions, rules, licensing restrictions and laws that limit how fish may be caught; typically, these prohibit the use of nets and the catching of fish with hooks not in the mouth. The most common form of recreational fishing is done with a rod, reel, line, hooks and any one of a wide range of baits or lures such as artificial flies. The practice of catching or attempting to catch fish with a hook is generally known as angling. In angling, it is sometimes expected or required that fish be returned to the water (catch and release). Recreational or sport fishermen may log their catches or participate in fishing competitions. The estimated global number of recreational fishers varies from 220 million to a maximum number of 700 million fishers globally, which is thought to be double the number of individuals working as commercial fishers. In the United States alone it was estimated that 50.1 million people engaged in fishing activities in both saltwater and freshwater environments. Big-game fishing is fishing from boats to catch large open-water species such as swordfish, tuna, sharks, and marlin. Sportfishing (sometimes game fishing) is recreational fishing where the primary reward is the challenge of finding and catching the fish rather than the culinary or financial value of the fish's flesh.
Environmental factors are mostly related to seafloor topography and obstructions, although tides, currents, waves, winds, and interaction with wildlife are also important. Operational losses and operator errors can occur even during normal fishing operations. Problems such as inadequate fisheries management and regulations that do not include adequate controls can hamper collection of ALDFG (e.g. there may be poor access to collection facilities). Gear loss resulting from conflicts primarily occurs (intentionally or unintentionally) in areas with high concentrations of fishing activities, leading to gear being towed away, fouled, sabotaged or vandalized. Passive and unattended gear such as pots, set gillnets and traps are particularly prone to conflict damage.
Boise National Forest
Q891075 EXACT TITLE 1.000
QID OVERLAP: Q891075 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (24): "acres", "basin", "boise", "campgrounds", "districts", "facilities", "feet", "hiking", "idaho", "land", "miles", "mountain", "multiple", "national", "people", "recreation", "rentals", "reservoirs", "resources", "river".... | EXACT TITLE in outdoor_recreation: "Boise National Forest".
acresbasinboisecampgroundsdistrictsfacilitiesfeethikingidaholandmilesmountainmultiplenationalpeoplerecreationrentalsreservoirsresourcesrivertrailswaterwestwildlife
Boise National Forest is a National Forest covering 2,203,703 acres (8,918.07 km2) of the U.S. state of Idaho. Created on July 1, 1908, from part of Sawtooth National Forest, it is managed by the U.S. Forest Service as five units: the Cascade, Emmett, Idaho City, Lowman, and Mountain Home ranger districts. The Idaho Batholith underlies most of Boise National Forest, forming the forest's Boise, Salmon River, and West mountain ranges; the forest reaches a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
s a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
Archaeological evidence indicates that human habitation in Idaho began towards the end of the last ice age: bone fragments about 10,000 years old have been found in Wilson Butte Cave, an inflationary cave on the Snake River Plain believed to have been occupied by indigenous people until as recently as the 17th century. A change of climate around 7000 years ago dried up much of the Great Basin, forcing the Shoshone people northward into the mountainous areas of central Idaho. Most of what is now Boise National Forest was sparsely inhabited by Native Americans, and several archaeological sites, including campsites, rock shelters, burial grounds, and pictographs have been found along rivers in the area. Trappers and fur traders of European descent first arrived in the area in the early 1800s, starting with John Jacob Astor's Pacific Fur Company in October 1811. Donald Mackenzie and Francois Payette trapped in the area of Boise National Forest in 1819. By 1840, the fur trade was coming to an end, but the westward migration on the Oregon Trail, which passed south of the forest, was beginning. The first settlers moved into the mountains in the 1860s after gold was discovered in Idaho, which forced many of the Shoshone out and led to conflicts throughout the state, including the Bannock War in southern Idaho. Prospectors George Grimes and Moses Splawn were the first to discover gold in the forest at the eponymous Grimes Creek on August 2, 1862. Subsequent gold discoveries at Rocky Bar in 1863 and Atlanta in 1864 increased the rush of people to Idaho, and in 1863 Idaho City, with a population of 6,267, surpassed Portland, Oregon as the largest city in the Pacific Northwest. The Idaho gold rush was largely over by 1870, and the population of the Boise Basin fell from 16,000 to 3,500. In 1898 the forest's first gold dredge was built in Placerville and followed by several others. By 1951, when the last dredges shut down, at least 2.3 million ounces (65.2 million grams) of gold had been produced from the Boise Basin area. Silver was mined along the Crooked River from 1882 until 1921, but a silver mine at Silver Mountain proved unsuccessful. Following a shortage of mercury during World War II, mines in the Stibnite area became the country's largest producer of tungsten and second largest source of mercury. The most important known placer deposit of niobium and tantalum in the United States is located in Bear Valley. From 1953 until 1959, dredges there produced $12.5 million ($138 million today) in niobium, tantalum, and uranium. Other minerals mined in the forest include antimony and molybdenum. U.S. Forest Service Boise National Forest was created on July 1, 1908, from part of Sawtooth National Forest, and originally covered 1,147,360 acres (4,643.2 km2). By the Forest Reserve Act of 1891, the U.S. Congress granted the U.S. President the authority to establish forest reserves out of Public Domain Lands that were subject to disposal (homesteads, sales, etc.) administered by the United States General Land Office, which had been placed under the authority of the U.S. Department of the Interior in 1849. With the passage of the Transfer Act of 1905, forest reserves were transferred to the U.S. Department of Agriculture in the newly created U.S. Forest Service. Present-day Boise National Forest was first protected as part of two forest reserves by proclamations issued by President Theodore Roosevelt: Sawtooth Forest Reserve (created on May 29, 1905, and expanded on November 6, 1906) and Payette Forest Reserve (created on June 3, 1905). After forest reserves were renamed national forests in 1908, Boise National Forest was split from Sawtooth National Forest into an independent national forest. Emile Grandjean was the forest's first supervisor, serving from 1908 to 1922. On April 1, 1944, the entirety of what was then Payette National Forest was transferred to Boise National Forest, and simultaneously Weiser and Idaho national forests were combined to reestablish the present-day Payette National Forest, which is to the north of Boise National Forest. In 1933 the Boise Basin Experimental Forest was created on 8,740 acres (35.4 km2) of the forest near Idaho City to study the management of ponderosa pine. The Lucky Peak Nursery was established in 1959 to produce trees for planting on burned or logged lands on the national forests of the Intermountain region. After the creation of the Civilian Conservation Corps (CCC) in 1933, nine camps and eight subcamps were set up in Boise National Forest, but the number of camps was reduced from 1934 until the program was closed in 1942.
Campsite
Q832778 EXACT TITLE 0.960
QID OVERLAP: Q832778 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (13): "campground", "facilities", "family", "group", "hiking", "means", "outdoor", "park", "people", "place", "related", "road", "simply". | EXACT TITLE in outdoor_recreation: "Campsite".
campgroundfacilitiesfamilygrouphikingmeansoutdoorparkpeopleplacerelatedroadsimply
Campsite, campground, and camping pitch are all related terms regarding a place used for camping (an overnight stay in an outdoor area). The usage differs between British English and American English. In British English, a campsite is an area, usually divided into a number of camping pitches, where people can camp overnight using tents, campervans or caravans. In the US, the expression used is campground and not campsite.
xpression used is campground and not campsite. In American English, the term campsite generally means an area where an individual, family, group, or military unit can pitch a tent or park a camper; a campground may contain many campsites. There are two types of campsites (US) or pitches (UK): one, a designated area with various facilities; or two, an impromptu area (as one might decide to stop while backpacking or hiking, or simply adjacent to a road through the wilderness).
tches (UK): one, a designated area with various facilities; or two, an impromptu area (as one might decide to stop while backpacking or hiking, or simply adjacent to a road through the wilderness). Campgrounds The term 'camp' comes from the Latin word campus, meaning "field". Therefore, a campground typically consists of open areas where a camper can pitch a tent or park a camper. More specifically, a campsite is a designated area set aside for camping, often requiring a user fee. Campsites typically feature a few (but sometimes no) improvements. Dedicated campsites, known as campgrounds, usually have some amenities.
Hiking
Q12014035 EXACT TITLE 0.920
QID OVERLAP: Q12014035 in tourism_hospitality (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (11): "activity", "describes", "developed", "forms", "hiking", "leisure", "organizations", "park", "trails", "urban", "walking". | EXACT TITLE in tourism_hospitality: "Hiking". | EXACT TITLE in outdoor_recreation: "Hiking".
activitydescribesdevelopedformshikingleisureorganizationsparktrailsurbanwalking
nd fell walking (a term mostly used for hillwalking in northern England). The term bushwalking is endemic to Australia. In New Zealand a long, vigorous walk or hike is called tramping. It is a common activity with numerous hiking organizations worldwide. Related terms Hiking means walking outdoors on a trail or off-trail for recreational purposes. A "day hike" refers to a hike that can be completed in a single day. In Northern England, including the Lake District and Yorkshire Dales, "fell walking" describes hill or mountain walks, as fell is the common word for both features in these locations. Hiking sometimes involves bushwhacking and is sometimes referred to as such. This specifically refers to difficult walking through dense forest, undergrowth, or bushes where forward progress requires pushing vegetation aside. In extreme cases of bushwhacking, where the vegetation is so dense that human passage is impeded, a machete is typically used to clear a pathway. The Australian term bushwalking refers to both on and off-trail hiking. Common terms for hiking used by New Zealanders are tramping (particularly for overnight and longer trips), walking or bushwalking. Trekking describes multi-day hiking in mountainous regions. Hiking a long-distance trail from end-to-end is also referred to as trekking or thru-hiking.
Hiking can be hazardous because of terrain, inclement weather, potential to get lost, or pre-existing medical conditions. The dangerous circumstances hikers can face include specific accidents or physical ailments. It is especially hazardous in high mountains, crossing rivers and glaciers, and when there is snow and ice. At times hiking may involve scrambling, as well as the use of ropes, ice axes and crampons and the skill to properly use them. Potential hazards involving physical ailments may include dehydration, frostbite, hypothermia, sunburn, sunstroke, or diarrhea, and such injuries as ankle sprains, or broken bones. Hypothermia is a danger for all hikers and especially inexperienced hikers. Weather does not need to be very cold to be dangerous since ordinary rain or mist has a strong cooling effect. In high mountains a further danger is altitude sickness. This typically occurs only above 2,500 metres (8,000 ft), though some are affected at lower altitudes. Risk factors include a prior episode of altitude sickness, a high degree of activity, and a rapid increase in elevation. Other threats include attacks by animals (e.g., bears, snakes, and insects such as ticks that carry Lyme) or contact with noxious plants (e.g., poison ivy, poison oak, poison sumac. Lightning is also a threat, especially on high ground. Walkers in high mountains may encounter hazardous snow and ice conditions. Year-round glaciers are potentially hazardous.
king" is the preferred term in Canada and the United States; the term "walking" is used in these countries for shorter, particularly urban walks. In the United Kingdom and Ireland, the word "walking" describes all forms of walking, whether it is a walk in a park or backpacking in the Alps. The word hiking is also often used in the UK, along with rambling, hillwalking, and fell walking (a term mostly used for hillwalking in northern England). The term bushwalking is endemic to Australia. In New Zealand a long, vigorous walk or hike is called tramping.
Boise River
Q891080 EXACT TITLE 0.880
QID OVERLAP: Q891080 in tourism_hospitality (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (9): "approximately", "boise", "idaho", "lands", "miles", "river", "snake", "urban", "western". | EXACT TITLE in tourism_hospitality: "Boise River". | EXACT TITLE in outdoor_recreation: "Boise River".
approximatelyboiseidaholandsmilesriversnakeurbanwestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Birdwatching
Q685629 EXACT TITLE 0.780
QID OVERLAP: Q685629 in tourism_hospitality (tier:berry) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (4): "activity", "form", "public", "viewing". | EXACT TITLE in outdoor_recreation: "Birdwatching".
activityformpublicviewing
Birdwatching, or birding, is the observing of birds, either as a recreational activity or as a form of citizen science.
The early interest in observing birds for their aesthetic rather than utilitarian (mainly food) value is traced to the late 18th century in the works of Gilbert White, Thomas Bewick, George Montagu and John Clare. The study of birds, and of natural history in general, became increasingly prevalent in Britain during the Victorian Era, often associated with collection, eggs and later skins being the artifacts of interest. Wealthy collectors made use of their contacts in the colonies to obtain specimens from around the world. It was only in the late 19th century that the call for bird protection led to the rising popularity of observation of living birds. The Audubon Society was started to protect birds from the growing trade in feathers in the United States while the Royal Society for the Protection of Birds began in Britain. The phrase "bird watching" appeared for the first time as the title of the book Bird Watching by Edmund Selous in 1901. In North America, the identification of birds, once thought possible only by shooting, was made possible by the emergence of optics and field identification guides. The earliest field guide in the US was Birds through an Opera Glass (1889) by Florence Bailey. Birding in North America was focused in the early and mid-20th century in the eastern seaboard region, and was influenced by the works of Ludlow Griscom and later Roger Tory Peterson. Bird Neighbors (1897) by Neltje Blanchan, an early birding book, sold over 250,000 copies. It was illustrated with color photographs of stuffed birds. The organization and networking of those interested in birds began through organizations like the Audubon Society, which was against the killing of birds, and the American Ornithologists' Union (AOU). The availability of first the bicycle and then the car increased the mobility of birdwatchers and this made new locations accessible. Networks of birdwatchers in the UK began to form in the late 1930s under the British Trust for Ornithology (BTO). The BTO saw the potential to produce scientific results through the networks, unlike the Royal Society for the Protection of Birds (RSPB) which like the Audubon Society originated from the bird protection movement. Like the AOU in North America, the BOU had a focus mainly on collection-based taxonomy. The BOU changed focus to ecology and behaviour only in the 1940s. The BTO movement towards 'organized birdwatching' was opposed by the RSPB, which claimed that the 'scientification' of the pastime was 'undesirable'. This stand was to change only in 1936 when the RSPB was taken over by Tom Harrisson and others. Harrisson was instrumental in the organization of pioneering surveys of the great crested grebe. Increased mobility of birdwatchers ensured that books like Where to Watch Birds by John Gooders became best-sellers. By the 1960s air travel became feasible and long-distance holiday destinations opened up. By 1965, Britain's first birding tour company, Ornitholidays had been started by Lawrence Holloway. Travelling far away also led to problems in name usage: British birds such as "wheatear", "heron" and "swallow" needed adjectives to differentiate them in places where there were several related species. The falling cost of air travel made flying to remote birding destinations a possibility for a large number of people towards the 1980s. The need for global guides to birds increased, and one of the biggest resulting projects was the Handbook of the Birds of the World, begun in the 1990s by Josep del Hoyo, Jordi Sargatal, David A. Christie, and ornithologist Andy Elliott. Initially, birdwatching was largely restricted to developed countries such as the United Kingdom and the United States of America. Since the second half of the 20th century an increasing number of people in developing countries have engaged in this activity, such as in the Degua Tembien district of Ethiopia. Transnational birding has played an important role in this, as birders in developing countries usually take up the pastime under the influence of foreign cultures with a history of birding.
Mobile applications The increasing availability of mobile devices in the 2010s allowed the smartphone to become a useful tool for birding. Mobile apps can be used as replacements for physical birding field guides, such as the digital version of the Sibley Guide to Birds and the official Audubon Society app. Other apps utilize machine learning to automatically identify birds from photographs and audio recordings, such as the Cornell Lab of Ornithology's Merlin Bird ID application and iNaturalist. Cornell Lab of Ornithology's eBird database is a popular tool used by birders to document their sightings. In addition to serving as a citizen science project used by ornithologists to document trends in bird populations, it allows birders see recent reports by other birders and search by species and location. Some species, including endangered species and others likely to be disrupted by increased human activity, are designated "sensitive species" by eBird and have locations of sightings hidden from the general public. Code of conduct As the numbers of birdwatchers increases, there is growing concern about the impact of birdwatching on the birds and their habitat. Birdwatching etiquette is evolving in response to this concern. Some examples of birdwatching etiquette include promoting the welfare of birds and their environment, limiting use of photography, pishing and playback devices to mitigate stress caused to birds, maintaining a distance away from nests and nesting colonies, and respecting private property. The lack of definite evidence, except arguably in the form of photographs, makes birding records difficult to prove but birdwatchers strive to build trust in their identification.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (13): "boise", "capital", "downtown", "feet", "idaho", "locally", "major", "miles", "north", "oregon", "river", "treasure", "valley".
boisecapitaldowntownfeetidaholocallymajormilesnorthoregonrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
ise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
Garden City, Idaho
Q1516892 QID OVERLAP 0.640
QID OVERLAP: Q1516892 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (7): "boise", "garden", "government", "idaho", "municipal", "second", "street".
boisegardengovernmentidahomunicipalsecondstreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
s only main street, Chinden Boulevard, is a portmanteau of the words "China" and "garden." In the second decade of the 21st century, it became a haven for artists' studios. Garden City is part of the Boise metropolitan area. Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Ada County, Idaho
Q109820 QID OVERLAP 0.640
QID OVERLAP: Q109820 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (7): "boise", "capital", "district", "idaho", "local", "private", "second".
boisecapitaldistrictidaholocalprivatesecond
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (6): "among", "boise", "capital", "idaho", "meridian", "second".
amongboisecapitalidahomeridiansecond
population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "nampa".
boisecaldwellcanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "boise", "downtown", "eagle", "idaho", "miles".
boisedowntowneagleidahomiles
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District. The portion in the Boise School District is zoned to: Shadow Hills Elementary School, Riverglen Middle School, and Capital High School. In popular culture The 2008 show The Baby Borrowers was filmed in Eagle.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Kuna, Idaho
Q1515177 QID OVERLAP 0.560
QID OVERLAP: Q1515177 in tourism_hospitality (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (3): "additional", "boise", "idaho".
additionalboiseidaho
metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020. History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
200 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP200 edges
🌲 EVERGREEN3 edges
0.650
accessamenitiesboisecapitalconnectsdepartmentdowntowngardengreenbelthistoricalhistoryidaholandmunicipalnorthoperatedparkparkspedestrianrecreation
SHARED TOKENS (26): "access", "amenities", "boise", "capital", "connects", "department", "downtown", "garden", "greenbelt", "historical", "history", "idaho", "land", "municipal", "north", "operated", "park", "parks", "pedestrian", "recreation".... | URL->A (1): https://history.idaho.gov/museum/. | EXACT TITLE in tourism_hospitality: "Julia Davis Park".
0.650
boisecentercommercialdepartmentdowntownfacilityidahomilesmillionnationaloperatedoperatesprotectionrequiringsupportwestern
SHARED TOKENS (16): "boise", "center", "commercial", "department", "downtown", "facility", "idaho", "miles", "million", "national", "operated", "operates", "protection", "requiring", "support", "western". | URL->A (1): http://www.iflyboise.com/about-boi/statistics/. | EXACT TITLE in tourism_hospitality: "Boise Airport".
0.650
acresadditionalboisebureaucanyonconservationcoverscreatingdifferentfeethistoricalidahoimportantlandlandsmanagementmilemilesmillionnational
SHARED TOKENS (32): "acres", "additional", "boise", "bureau", "canyon", "conservation", "covers", "creating", "different", "feet", "historical", "idaho", "important", "land", "lands", "management", "mile", "miles", "million", "national".... | URL->B (1): https://www.blm.gov/programs/national-conservation-lands/idaho/morley-nelson-snake-river-birds-of-prey. | EXACT TITLE in outdoor_recreation: "Morley Nelson Snake River Birds of Prey National Conservation Area".
🌿 BRANCH108 edges
0.590
acresalcoholboisebureaucanyondepartmentidahomilesoregonriversnakevalley
SHARED TOKENS (12): "acres", "alcohol", "boise", "bureau", "canyon", "department", "idaho", "miles", "oregon", "river", "snake", "valley". | URL->A (1): https://idahowines.org/idaho-wines/idaho-wine-history/. | EXACT TITLE in tourism_hospitality: "Snake River Valley AVA".
0.510
Idaho wine ↗ Q2555765 EXACT TITLE
historyidahonationaloregonriversnaketowardvalley
SHARED TOKENS (8): "history", "idaho", "national", "oregon", "river", "snake", "toward", "valley". | URL->A (1): https://idahowines.org/idaho-wines/idaho-wine-history/. | EXACT TITLE in tourism_hospitality: "Idaho wine".
0.500
accesscentercommercialdevelopmentdistrictdistrictsevenheritagehistoricalprotectionregionrelatedsmallstatusstructuresurban
SHARED TOKENS (16): "access", "center", "commercial", "development", "district", "districts", "even", "heritage", "historical", "protection", "region", "related", "small", "status", "structures", "urban". | EXACT TITLE in tourism_hospitality: "Historic district".
0.500
acresagenciesamongapproximatelybureauconservationdepartmentdescribedestatefederalgovernmentgroupsidaholandlandsmanagementmilesmillionnationaloffice
SHARED TOKENS (29): "acres", "agencies", "among", "approximately", "bureau", "conservation", "department", "described", "estate", "federal", "government", "groups", "idaho", "land", "lands", "management", "miles", "million", "national", "office".... | EXACT TITLE in outdoor_recreation: "Bureau of Land Management".
0.500
Idaho ↗ Q1221 EXACT TITLE
approximatelybasinboisecapitalcountryeconomyidaholandmilesmillionmountainmountainsnationalnorthofficialoregonpeopleproductsriversmall
SHARED TOKENS (24): "approximately", "basin", "boise", "capital", "country", "economy", "idaho", "land", "miles", "million", "mountain", "mountains", "national", "north", "official", "oregon", "people", "products", "river", "small".... | EXACT TITLE in tourism_hospitality: "Idaho". | EXACT TITLE in outdoor_recreation: "Idaho".
0.500
Resort ↗ Q875157 EXACT TITLE
accommodationactivitiescentralcommercialfoodmeansnorthoperatedownershippeopleprovideresortsinglesportsvisit
SHARED TOKENS (15): "accommodation", "activities", "central", "commercial", "food", "means", "north", "operated", "ownership", "people", "provide", "resort", "single", "sports", "visit". | EXACT TITLE in tourism_hospitality: "Resort". | EXACT TITLE in outdoor_recreation: "Resort".
0.500
Wildfire ↗ Q169950 EXACT TITLE
changecreatecreatesdirecteconomicequipmenteventgrowthlandmanagementoregonphysicalspacesurbanwater
SHARED TOKENS (15): "change", "create", "creates", "direct", "economic", "equipment", "event", "growth", "land", "management", "oregon", "physical", "spaces", "urban", "water". | EXACT TITLE in outdoor_recreation: "Wildfire".
0.500
addingbecomedepartmentdistrictdistrictsfederalfinancialformsgovernmentgroupshistoricalhistorymillionmultiplenationalofficialparkparksplacespreservation
SHARED TOKENS (30): "adding", "become", "department", "district", "districts", "federal", "financial", "forms", "government", "groups", "historical", "history", "million", "multiple", "national", "official", "park", "parks", "places", "preservation".... | EXACT TITLE in tourism_hospitality: "National Register of Historic Places".
0.500
accommodationsactivitiesactivitybusinesscreatedirectlyeconomicexperienceslocaloperatoroperatorsproductspublictransportationtravel
SHARED TOKENS (15): "accommodations", "activities", "activity", "business", "create", "directly", "economic", "experiences", "local", "operator", "operators", "products", "public", "transportation", "travel". | EXACT TITLE in tourism_hospitality: "Tour operator".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesdeterminedevelopeddevelopmentdifferentformgovernmentgrowthlandlocalplacesplanningregulatoryrulesscalesinglesystemsurban
SHARED TOKENS (18): "activities", "determine", "developed", "development", "different", "form", "government", "growth", "land", "local", "places", "planning", "regulatory", "rules", "scale", "single", "systems", "urban". | EXACT TITLE in tourism_hospitality: "Zoning".
0.500
agenciesbusinessescapacityconcentrationdeterminedistributioneconomicemploymentimportantlandlawmarketorganizationregulatoryrelatedsmallstructure
SHARED TOKENS (17): "agencies", "businesses", "capacity", "concentration", "determine", "distribution", "economic", "employment", "important", "land", "law", "market", "organization", "regulatory", "related", "small", "structure". | EXACT TITLE in tourism_hospitality: "Market concentration".
0.500
acresbecomebuiltbureaudepartmentdevelopmentfederalgovernmentjunelandslawmanagementmillionpeopleresourcerevenuesecondsourcewaterwestern
SHARED TOKENS (20): "acres", "become", "built", "bureau", "department", "development", "federal", "government", "june", "lands", "law", "management", "million", "people", "resource", "revenue", "second", "source", "water", "western". | EXACT TITLE in outdoor_recreation: "Bureau of Reclamation".
0.500
State park ↗ Q1761072 EXACT TITLE
administrationconservationentitiesexperiencefederalgovernmenthistoryimportantlocalnationalparkparkspreservepreservingprogramsratherregionalresourcessystemsvisitor
SHARED TOKENS (21): "administration", "conservation", "entities", "experience", "federal", "government", "history", "important", "local", "national", "park", "parks", "preserve", "preserving", "programs", "rather", "regional", "resources", "systems", "visitor".... | EXACT TITLE in outdoor_recreation: "State park".
0.500
accessactivitiesactivityenvironmentfacilitiesfishinghikingoutdoorparksphysicalratherrecreationriversportingsportstrainingwalking
SHARED TOKENS (17): "access", "activities", "activity", "environment", "facilities", "fishing", "hiking", "outdoor", "parks", "physical", "rather", "recreation", "river", "sporting", "sports", "training", "walking". | EXACT TITLE in tourism_hospitality: "Outdoor recreation". | EXACT TITLE in outdoor_recreation: "Outdoor recreation".
0.500
accessaccessibilityamongbegancommunitycontrolcountrydevelopeddevelopmentdifferentdistributioneducationenvironmentalevenimportantinfrastructureknowledgemajormanagementorganizations
SHARED TOKENS (32): "access", "accessibility", "among", "began", "community", "control", "country", "developed", "development", "different", "distribution", "education", "environmental", "even", "important", "infrastructure", "knowledge", "major", "management", "organizations".... | EXACT TITLE in tourism_hospitality: "Public health".
0.500
businesscurrentformfortidahoincreasinglymilemountainsnearnorthoregonpointriverroutestraffictrailtrailstravelersvalleywest
SHARED TOKENS (21): "business", "current", "form", "fort", "idaho", "increasingly", "mile", "mountains", "near", "north", "oregon", "point", "river", "routes", "traffic", "trail", "trails", "travelers", "valley", "west".... | EXACT TITLE in tourism_hospitality: "Oregon Trail". | EXACT TITLE in outdoor_recreation: "Oregon Trail".
0.500
Tourism ↗ EXACT TITLE
activitybenefitsbeyondbusinesscommercialcountrydevelopmenteconomicenvironmentenvironmentalgrowthhoursleisurelocalmarketsorganizationorganizationspeopleplacesprograms
SHARED TOKENS (26): "activity", "benefits", "beyond", "business", "commercial", "country", "development", "economic", "environment", "environmental", "growth", "hours", "leisure", "local", "markets", "organization", "organizations", "people", "places", "programs".... | EXACT TITLE in tourism_hospitality: "Tourism". | EXACT TITLE in outdoor_recreation: "Tourism".
0.500
activitycanyoncenterconservationedgeidahoimportantlandnampanationaloregonriversecondsitesnakevisitorvisitorswaterwestwildlife
SHARED TOKENS (20): "activity", "canyon", "center", "conservation", "edge", "idaho", "important", "land", "nampa", "national", "oregon", "river", "second", "site", "snake", "visitor", "visitors", "water", "west", "wildlife". | EXACT TITLE in tourism_hospitality: "Deer Flat National Wildlife Refuge".
0.500
communityculturedevelopmenteconomicenvironmentalformheritagehistoricalhistorylocalpreservationpreservingregionresourcessitesthemtourismtraditions
SHARED TOKENS (18): "community", "culture", "development", "economic", "environmental", "form", "heritage", "historical", "history", "local", "preservation", "preserving", "region", "resources", "sites", "them", "tourism", "traditions". | EXACT TITLE in tourism_hospitality: "Heritage tourism".
0.500
Airport ↗ Q1248784 EXACT TITLE
changecommercialcontrolemergencyenvironmentalexperiencefacilitiesfacilityimportantinfrastructurelandlocalmajoroperationsoperatorsrestaurantssafetyservingsitessources
SHARED TOKENS (26): "change", "commercial", "control", "emergency", "environmental", "experience", "facilities", "facility", "important", "infrastructure", "land", "local", "major", "operations", "operators", "restaurants", "safety", "serving", "sites", "sources".... | EXACT TITLE in tourism_hospitality: "Airport".
0.500
Picnic ↗ Q506294 EXACT TITLE
differenteventfoodformformsoutdoorparkparksplacepublicrequiresrestroomsscenicspringviewwater
SHARED TOKENS (16): "different", "event", "food", "form", "forms", "outdoor", "park", "parks", "place", "public", "requires", "restrooms", "scenic", "spring", "view", "water". | EXACT TITLE in outdoor_recreation: "Picnic".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessaccommodationaccommodationsadditionalamenitiesbeganbuiltbusinesscenterculturedepartmentdepartmentsdestinationdirecteconomyenvironmentequipmenteventfacilitiesfacility
SHARED TOKENS (43): "access", "accommodation", "accommodations", "additional", "amenities", "began", "built", "business", "center", "culture", "department", "departments", "destination", "direct", "economy", "environment", "equipment", "event", "facilities", "facility".... | EXACT TITLE in tourism_hospitality: "Hotel".
0.500
Rural tourism ↗ EXACT TITLE
activitiesamongbenefitsbusinessescommunityconnectsconservationcreatingculturedevelopeddevelopmenteconomiceducationemploymentenvironmentenvironmentaleventsexperiencefishingform
SHARED TOKENS (40): "activities", "among", "benefits", "businesses", "community", "connects", "conservation", "creating", "culture", "developed", "development", "economic", "education", "employment", "environment", "environmental", "events", "experience", "fishing", "form".... | EXACT TITLE in tourism_hospitality: "Rural tourism".
0.500
Hunting ↗ EXACT TITLE
activitiesbecomecapacityconservationcontrolenvironmentevenfishfishingfoodformimportantlawmaintenancemanagementmeansparksproductsprogramsprovide
SHARED TOKENS (26): "activities", "become", "capacity", "conservation", "control", "environment", "even", "fish", "fishing", "food", "form", "important", "law", "maintenance", "management", "means", "parks", "products", "programs", "provide".... | EXACT TITLE in outdoor_recreation: "Hunting".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciesbasincanyoncentralcommercialconstructioncontrolculturedevelopeddownstreamfishfishingflowshabitathistoryidahoimportantmajormiles
SHARED TOKENS (38): "activities", "agencies", "basin", "canyon", "central", "commercial", "construction", "control", "culture", "developed", "downstream", "fish", "fishing", "flows", "habitat", "history", "idaho", "important", "major", "miles".... | EXACT TITLE in tourism_hospitality: "Snake River". | EXACT TITLE in outdoor_recreation: "Snake River".
0.500
activitiesadditionalagenciesdatadevelopedfacilitiesfederalgovgovernmentinformationpermitsplanningplatformrecreationreservationsitesitessystemtravel
SHARED TOKENS (19): "activities", "additional", "agencies", "data", "developed", "facilities", "federal", "gov", "government", "information", "permits", "planning", "platform", "recreation", "reservation", "site", "sites", "system", "travel". | EXACT TITLE in outdoor_recreation: "Recreation.gov".
0.500
Motel ↗ Q216212 EXACT TITLE
accommodationbeganbuiltcabinscentralchaindevelopeddirectlygrowthnationalparkingplacesratherresponseroadroutessinglesitessmallsystems
SHARED TOKENS (22): "accommodation", "began", "built", "cabins", "central", "chain", "developed", "directly", "growth", "national", "parking", "places", "rather", "response", "road", "routes", "single", "sites", "small", "systems".... | EXACT TITLE in tourism_hospitality: "Motel".
0.500
acresdepartmentdistrictfederalhistoricalmanagementmillionnationalparkparkspeopleplacespreservingpublicthem
SHARED TOKENS (15): "acres", "department", "district", "federal", "historical", "management", "million", "national", "park", "parks", "people", "places", "preserving", "public", "them". | EXACT TITLE in tourism_hospitality: "National Park Service".
0.500
Irrigation ↗ Q11453 EXACT TITLE
centralconditionscontroldevelopeddirectlydistributeddistributiondownstreamenvironmentalformgrowthlandmanagementnetworkoperationsprotectrequiringreservoirsriverrole
SHARED TOKENS (27): "central", "conditions", "control", "developed", "directly", "distributed", "distribution", "downstream", "environmental", "form", "growth", "land", "management", "network", "operations", "protect", "requiring", "reservoirs", "river", "role".... | EXACT TITLE in tourism_hospitality: "Irrigation".
0.500
Franchising ↗ Q171947 EXACT TITLE
anotherbusinesscapitalchainconditionsdirecteconomicexpansionexplicitlyfinancialgrowthliabilitylicenseslicensingmarketmeansproductssmallsportssystem
SHARED TOKENS (20): "another", "business", "capital", "chain", "conditions", "direct", "economic", "expansion", "explicitly", "financial", "growth", "liability", "licenses", "licensing", "market", "means", "products", "small", "sports", "system". | EXACT TITLE in tourism_hospitality: "Franchising".
0.500
Fort Boise ↗ Q3077782 EXACT TITLE
becomeboisecanyoncapitaldevelopeddifferentdistrictfortgovernmentidahomilesnearoregonplaceriversecondsnakewestern
SHARED TOKENS (18): "become", "boise", "canyon", "capital", "developed", "different", "district", "fort", "government", "idaho", "miles", "near", "oregon", "place", "river", "second", "snake", "western". | EXACT TITLE in tourism_hospitality: "Fort Boise". | EXACT TITLE in outdoor_recreation: "Fort Boise".
0.500
Open space ↗ Q1451377 EXACT TITLE
businesschaincommunityconservationcorridordesigndevelopmentlandmakesparkpeopleplanningpublicsmallspacespacesstructuresurban
SHARED TOKENS (18): "business", "chain", "community", "conservation", "corridor", "design", "development", "land", "makes", "park", "people", "planning", "public", "small", "space", "spaces", "structures", "urban". | EXACT TITLE in outdoor_recreation: "Open space".
0.500
boisecanyoncommunitydevelopmenteducationgovernedidahonampanorthprogramspublicsouthwesttreasurevalleywestern
SHARED TOKENS (15): "boise", "canyon", "community", "development", "education", "governed", "idaho", "nampa", "north", "programs", "public", "southwest", "treasure", "valley", "western". | EXACT TITLE in tourism_hospitality: "College of Western Idaho".
0.500
businessconstructioncontroldesigndirectgovernmentlicensinglocalmanagementoperatingoperationalreservationscalesellingsystemsthemtraining
SHARED TOKENS (17): "business", "construction", "control", "design", "direct", "government", "licensing", "local", "management", "operating", "operational", "reservation", "scale", "selling", "systems", "them", "training". | EXACT TITLE in tourism_hospitality: "Management contract".
0.500
beganboisecapitalconstructiondepartmentdesigndistrictfederalformationgovernmentidaholistsmillionnationalparkplaceswest
SHARED TOKENS (17): "began", "boise", "capital", "construction", "department", "design", "district", "federal", "formation", "government", "idaho", "lists", "million", "national", "park", "places", "west". | EXACT TITLE in tourism_hospitality: "Idaho State Capitol".
0.480
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventfoodgroupmanagementparksplacesprivateproviderestaurantssafetyservingspaces
SHARED TOKENS (14): "business", "commercial", "event", "food", "group", "management", "parks", "places", "private", "provide", "restaurants", "safety", "serving", "spaces". | EXACT TITLE in tourism_hospitality: "Catering".
0.480
Food safety ↗ Q909821 EXACT TITLE
chaincreatesdevelopedenforcementfoodgrowthmanagementmarketmillionorganizationphysicalrelatedsafetysystems
SHARED TOKENS (14): "chain", "creates", "developed", "enforcement", "food", "growth", "management", "market", "million", "organization", "physical", "related", "safety", "systems". | EXACT TITLE in tourism_hospitality: "Food safety".
0.480
acresboisediscoveryfishinggreenbeltidahomilesnearparkpointpublicrecreationriverspring
SHARED TOKENS (14): "acres", "boise", "discovery", "fishing", "greenbelt", "idaho", "miles", "near", "park", "point", "public", "recreation", "river", "spring". | EXACT TITLE in outdoor_recreation: "Lucky Peak State Park".
0.470
departmentgovernmentidahoparksprogramsrecreation
SHARED TOKENS (6): "department", "government", "idaho", "parks", "programs", "recreation". | URL->B (1): https://parksandrecreation.idaho.gov/. | EXACT TITLE in outdoor_recreation: "Idaho Department of Parks and Recreation".
0.460
boisedepartmenteventsfacilitiesfloatingidahooutdoorparkparkspeoplerecreationriverurban
SHARED TOKENS (13): "boise", "department", "events", "facilities", "floating", "idaho", "outdoor", "park", "parks", "people", "recreation", "river", "urban". | EXACT TITLE in outdoor_recreation: "Ann Morrison Park".
0.460
acresboisecanyondepartmentfishfortidahomanagementnearriversnakewaterwildlife
SHARED TOKENS (13): "acres", "boise", "canyon", "department", "fish", "fort", "idaho", "management", "near", "river", "snake", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Fort Boise Wildlife Management Area".
0.440
boiseidaholandlocaloregonregionresourcesriversnaketreasurevalleywestern
SHARED TOKENS (12): "boise", "idaho", "land", "local", "oregon", "region", "resources", "river", "snake", "treasure", "valley", "western". | EXACT TITLE in tourism_hospitality: "Treasure Valley". | EXACT TITLE in outdoor_recreation: "Treasure Valley".
0.440
beganbureauchildrencreatingdepartmentenforcementidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (12): "began", "bureau", "children", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "public", "statewide". | EXACT TITLE in tourism_hospitality: "Idaho State Police".
0.440
activityamongboisebusinesseducationidahoinstitutionmillionmountainprogramspublicwest
SHARED TOKENS (12): "activity", "among", "boise", "business", "education", "idaho", "institution", "million", "mountain", "programs", "public", "west". | EXACT TITLE in tourism_hospitality: "Boise State University".
0.420
addsboisecanyonidahomeridianmetromountainnampaoregontreasurevalley
SHARED TOKENS (11): "adds", "boise", "canyon", "idaho", "meridian", "metro", "mountain", "nampa", "oregon", "treasure", "valley". | EXACT TITLE in tourism_hospitality: "Boise metropolitan area".
0.420
builtconservationdevelopmentenvironmentheritagehistoricalmaintainspreservationpreserveproductsprotect
SHARED TOKENS (11): "built", "conservation", "development", "environment", "heritage", "historical", "maintains", "preservation", "preserve", "products", "protect". | EXACT TITLE in tourism_hospitality: "Historic preservation".
0.420
approximatelycommunitydowntownidahonearnorthpublicriverstatustogetherwestern
SHARED TOKENS (11): "approximately", "community", "downtown", "idaho", "near", "north", "public", "river", "status", "together", "western". | EXACT TITLE in tourism_hospitality: "North Idaho College".
0.420
categoryestateeventfoodhospitalityparksplanningrealrestaurantstourismtravel
SHARED TOKENS (11): "category", "estate", "event", "food", "hospitality", "parks", "planning", "real", "restaurants", "tourism", "travel". | EXACT TITLE in tourism_hospitality: "Hospitality industry".
0.420
ServSafe ↗ Q7455532 EXACT TITLE
alcoholfoodmanagementmanagersmillionnationalpeopleprotectionrestaurantssafetytraining
SHARED TOKENS (11): "alcohol", "food", "management", "managers", "million", "national", "people", "protection", "restaurants", "safety", "training". | EXACT TITLE in tourism_hospitality: "ServSafe".
0.420
boisecenterdistrictdowntowneventexpansionfeetgroupsidahooperatingspace
SHARED TOKENS (11): "boise", "center", "district", "downtown", "event", "expansion", "feet", "groups", "idaho", "operating", "space". | EXACT TITLE in tourism_hospitality: "Boise Centre".
0.400
Food code ↗ Q5465447 EXACT TITLE
conditionsdefinedeterminedistributionequipmentfoodnationalpreservationproductsregional
SHARED TOKENS (10): "conditions", "define", "determine", "distribution", "equipment", "food", "national", "preservation", "products", "regional". | EXACT TITLE in tourism_hospitality: "Food code".
0.400
agenciescomdataenginesinformationkayakproviderproviderssourcestravel
SHARED TOKENS (10): "agencies", "com", "data", "engines", "information", "kayak", "provider", "providers", "sources", "travel". | EXACT TITLE in tourism_hospitality: "Metasearch engine".
0.400
Trout ↗ Q2258881 EXACT TITLE
familyfishfoodimportantnamesnorthproviderelatedsourcethemselves
SHARED TOKENS (10): "family", "fish", "food", "important", "names", "north", "provide", "related", "source", "themselves". | EXACT TITLE in outdoor_recreation: "Trout".
0.400
Museum ↗ Q33506 EXACT TITLE
countryheritagehistoryinstitutionlocalpreservationpreservingprivatepublicvisitors
SHARED TOKENS (10): "country", "heritage", "history", "institution", "local", "preservation", "preserving", "private", "public", "visitors". | EXACT TITLE in tourism_hospitality: "Museum".
0.400
activitybecomeconditionsculturedevelopedequipmentfeetparticipationsinglespecialized
SHARED TOKENS (10): "activity", "become", "conditions", "culture", "developed", "equipment", "feet", "participation", "single", "specialized". | EXACT TITLE in outdoor_recreation: "Snowboarding".
0.380
countryenvironmentgovernedmountainoutdoorplaceroadtrailtrails
SHARED TOKENS (9): "country", "environment", "governed", "mountain", "outdoor", "place", "road", "trail", "trails". | EXACT TITLE in outdoor_recreation: "Trail running".
0.380
Chef ↗ Q3499072 EXACT TITLE
businessdifferentfoodinstitutionoperationsrestaurantssystemsystemstraining
SHARED TOKENS (9): "business", "different", "food", "institution", "operations", "restaurants", "system", "systems", "training". | EXACT TITLE in tourism_hospitality: "Chef".
0.380
Rafting ↗ Q207238 EXACT TITLE
activitiesactivitybecomedifferenteventexperienceoutdoorriverwater
SHARED TOKENS (9): "activities", "activity", "become", "different", "event", "experience", "outdoor", "river", "water". | EXACT TITLE in outdoor_recreation: "Rafting".
0.360
affectingbuiltcontrolenvironmentenvironmentalmajorpublicrequirements
SHARED TOKENS (8): "affecting", "built", "control", "environment", "environmental", "major", "public", "requirements". | EXACT TITLE in tourism_hospitality: "Environmental health".
0.360
approximatelyboisecenteridahomilesnampasportswest
SHARED TOKENS (8): "approximately", "boise", "center", "idaho", "miles", "nampa", "sports", "west". | EXACT TITLE in tourism_hospitality: "Ford Idaho Center".
0.360
Ski resort ↗ Q130003 EXACT TITLE
activitydestinationdevelopednorthresortsportssystemtrails
SHARED TOKENS (8): "activity", "destination", "developed", "north", "resort", "sports", "system", "trails". | EXACT TITLE in outdoor_recreation: "Ski resort".
0.340
Boating ↗ Q2141830 EXACT TITLE
activitiesactivityfishingitselfleisuresportstravel
SHARED TOKENS (7): "activities", "activity", "fishing", "itself", "leisure", "sports", "travel". | EXACT TITLE in outdoor_recreation: "Boating".
0.340
Wastewater ↗ Q336191 EXACT TITLE
activitiesanothercommercialcommunitymunicipalpeoplewater
SHARED TOKENS (7): "activities", "another", "commercial", "community", "municipal", "people", "water". | EXACT TITLE in tourism_hospitality: "Wastewater".
0.340
departmentdevelopmenteconomicgrowthidahopublicresources
SHARED TOKENS (7): "department", "development", "economic", "growth", "idaho", "public", "resources". | EXACT TITLE in tourism_hospitality: "Idaho Department of Commerce".
0.340
activityhistoryidahonearoregonwestwestern
SHARED TOKENS (7): "activity", "history", "idaho", "near", "oregon", "west", "western". | EXACT TITLE in tourism_hospitality: "History of Idaho".
0.340
environmentalfoundationparkingpointsmallspacewater
SHARED TOKENS (7): "environmental", "foundation", "parking", "point", "small", "space", "water". | EXACT TITLE in outdoor_recreation: "Boat ramp".
0.340
centralgovernmentlandlocalnationalpublicsystem
SHARED TOKENS (7): "central", "government", "land", "local", "national", "public", "system". | EXACT TITLE in tourism_hospitality: "Public land". | EXACT TITLE in outdoor_recreation: "Public land".
0.340
departmentfishlandsnationalpublicsystemwildlife
SHARED TOKENS (7): "department", "fish", "lands", "national", "public", "system", "wildlife". | EXACT TITLE in tourism_hospitality: "National Wildlife Refuge".
0.340
Outdoor gym ↗ Q692630 EXACT TITLE
builtconstructionequipmentoutdoorparkpublictrails
SHARED TOKENS (7): "built", "construction", "equipment", "outdoor", "park", "public", "trails". | EXACT TITLE in outdoor_recreation: "Outdoor gym".
0.340
bureauconservationlandlandsmanagementnationalrestrictions
SHARED TOKENS (7): "bureau", "conservation", "land", "lands", "management", "national", "restrictions". | EXACT TITLE in outdoor_recreation: "National Conservation Area".
0.340
agenciesapproximatelycomgroupmillionoperatestravel
SHARED TOKENS (7): "agencies", "approximately", "com", "group", "million", "operates", "travel". | EXACT TITLE in tourism_hospitality: "Tripadvisor".
0.320
communityenvironmenthistoryprovidesmallurban
SHARED TOKENS (6): "community", "environment", "history", "provide", "small", "urban". | EXACT TITLE in tourism_hospitality: "Boutique hotel".
0.320
accommodationincreasinglyrentalrentalstemporarytravel
SHARED TOKENS (6): "accommodation", "increasingly", "rental", "rentals", "temporary", "travel". | EXACT TITLE in tourism_hospitality: "Vacation rental".
0.320
Sales tax ↗ Q11055488 EXACT TITLE
directlyeducationfoodpointproviderelated
SHARED TOKENS (6): "directly", "education", "food", "point", "provide", "related". | EXACT TITLE in tourism_hospitality: "Sales tax".
0.320
Restaurant ↗ Q11707 EXACT TITLE
businessfamilyfoodluxuryrestaurantssingle
SHARED TOKENS (6): "business", "family", "food", "luxury", "restaurants", "single". | EXACT TITLE in tourism_hospitality: "Restaurant". | EXACT TITLE in outdoor_recreation: "Restaurant".
0.300
assetassetscapitalclassificationcommercialdevelopmentestatefinancialinstitutionalmajormarketsofficeoperatesoperationsprivaterealurbanvalue
SHARED TOKENS (18): "asset", "assets", "capital", "classification", "commercial", "development", "estate", "financial", "institutional", "major", "markets", "office", "operates", "operations", "private", "real", "urban", "value".
0.300
Ecotourism ↗ Q187449 KW CROSS HIGH
changecommunityconservationculturedependsdifferentdirecteconomiceducationenvironmentenvironmentalexperienceformimportantinfrastructurelocalorganizationspeopleprogramstouring
SHARED TOKENS (24): "change", "community", "conservation", "culture", "depends", "different", "direct", "economic", "education", "environment", "environmental", "experience", "form", "important", "infrastructure", "local", "organizations", "people", "programs", "touring"....
0.300
businessdesigndevelopmentdifferentemergencyenvironmenteventeventsgroupsknowledgemanagementmarketmarketingorganizationsparkingpermitsplanningprojectpublicrelationships
SHARED TOKENS (23): "business", "design", "development", "different", "emergency", "environment", "event", "events", "groups", "knowledge", "management", "market", "marketing", "organizations", "parking", "permits", "planning", "project", "public", "relationships"....
0.300
activitiesamongbeyondcommunityconservationcontrolgovernmentlicenselicenseslicensingmanagementregulatoryrequiringresourcerevenue
SHARED TOKENS (15): "activities", "among", "beyond", "community", "conservation", "control", "government", "license", "licenses", "licensing", "management", "regulatory", "requiring", "resource", "revenue".
0.300
accessactivitiesamongdirectlygrowthhabitatheritageimportantlocalmillionorganizationpeopleplacessitestourismtravelviewingwildlife
SHARED TOKENS (18): "access", "activities", "among", "directly", "growth", "habitat", "heritage", "important", "local", "million", "organization", "people", "places", "sites", "tourism", "travel", "viewing", "wildlife".
0.300
anotherbecomebeganchaindescribeddifferentdirectlyeconomymanagementmarketownershipproductsratherrelatedriver
SHARED TOKENS (15): "another", "become", "began", "chain", "described", "different", "directly", "economy", "management", "market", "ownership", "products", "rather", "related", "river".
0.300
acresbureaubusinessdepartmentdevelopmentfederalfishlandlandsmajormanagementmillionnationalofficeoperationsparkprivatesystemwildlife
SHARED TOKENS (19): "acres", "bureau", "business", "department", "development", "federal", "fish", "land", "lands", "major", "management", "million", "national", "office", "operations", "park", "private", "system", "wildlife".
0.300
centergroupsmajorresortshows
SHARED TOKENS (5): "center", "groups", "major", "resort", "shows". | EXACT TITLE in tourism_hospitality: "Convention center".
0.300
approximatelyboisebuiltdowntownevenfeethistoricalidahomilesnearoperatedplacesinglesitespringswestern
SHARED TOKENS (16): "approximately", "boise", "built", "downtown", "even", "feet", "historical", "idaho", "miles", "near", "operated", "place", "single", "site", "springs", "western".
0.300
alreadybecomechangeconditionsconservationculturecurrentfoodhabitathistoricalimportantlocalplacepointratherspacesupportwater
SHARED TOKENS (18): "already", "become", "change", "conditions", "conservation", "culture", "current", "food", "habitat", "historical", "important", "local", "place", "point", "rather", "space", "support", "water".
0.300
authoritycentralchangecommunityconditionsconservationcountrycreatingdependsdesigndevelopmentdistrictseconomicenvironmentalexposurefacilitieslandmeansneighborhoodspeople
SHARED TOKENS (29): "authority", "central", "change", "community", "conditions", "conservation", "country", "creating", "depends", "design", "development", "districts", "economic", "environmental", "exposure", "facilities", "land", "means", "neighborhoods", "people"....
0.300
additionalboisebusinesscentralcommunitydifferentgardenidahomajormilesoregonriversegmentssmallsnakevalleywest
SHARED TOKENS (17): "additional", "boise", "business", "central", "community", "different", "garden", "idaho", "major", "miles", "oregon", "river", "segments", "small", "snake", "valley", "west".
0.300
broadercoverscreatingdevelopeddevelopmentdirecteconomiceconomyenvironmentalexperienceexperiencesformformsgrowthimprovingmanagementmeansorganizationorganizationsprograms
SHARED TOKENS (24): "broader", "covers", "creating", "developed", "development", "direct", "economic", "economy", "environmental", "experience", "experiences", "form", "forms", "growth", "improving", "management", "means", "organization", "organizations", "programs"....
0.300
foodformpeoplerequiresrestaurants
SHARED TOKENS (5): "food", "form", "people", "requires", "restaurants". | EXACT TITLE in tourism_hospitality: "Culinary arts".
0.300
activitiesconditionsdifferentemergencyenterequipmentevenformformsprotectionprovidesafetysmallspecializedsupportthemwaterwest
SHARED TOKENS (18): "activities", "conditions", "different", "emergency", "enter", "equipment", "even", "form", "forms", "protection", "provide", "safety", "small", "specialized", "support", "them", "water", "west".
0.300
activityamongapproximatelyboisebureaucanyoncapacitycenterconservationcreatesdirectlyedgefederalfeetformationidahoimportantlocalmilesnampa
SHARED TOKENS (36): "activity", "among", "approximately", "boise", "bureau", "canyon", "capacity", "center", "conservation", "creates", "directly", "edge", "federal", "feet", "formation", "idaho", "important", "local", "miles", "nampa"....
0.300
approximatelyequestrianfeetformhikingmilemilesmountainnationalnearofficialoregonparkparksscenicstatussystemtrailtrailswestern
SHARED TOKENS (20): "approximately", "equestrian", "feet", "form", "hiking", "mile", "miles", "mountain", "national", "near", "official", "oregon", "park", "parks", "scenic", "status", "system", "trail", "trails", "western".
0.300
Trailhead ↗ Q7832815 KW CROSS HIGH
accessdistributionhikingmajormapsmountainoutdoorparkingpointrestroomsspacetraffictrailtrailswalking
SHARED TOKENS (15): "access", "distribution", "hiking", "major", "maps", "mountain", "outdoor", "parking", "point", "restrooms", "space", "traffic", "trail", "trails", "walking".
0.300
accessibilityactivityapproximatelybecomebenefitsdistributionenvironmentalexpansionmaintenanceoperatingoperationalphysicalprovidepublicregulatoryrentalservingsystemsystemstraffic
SHARED TOKENS (22): "accessibility", "activity", "approximately", "become", "benefits", "distribution", "environmental", "expansion", "maintenance", "operating", "operational", "physical", "provide", "public", "regulatory", "rental", "serving", "system", "systems", "traffic"....
0.300
activityanotherassetsbusinesscapitalcentralcontrolcreatedepartmentdescribeddirectentitiesfederalgovernedgovernmentlawmanagementmarketoperatingoperations
SHARED TOKENS (25): "activity", "another", "assets", "business", "capital", "central", "control", "create", "department", "described", "direct", "entities", "federal", "governed", "government", "law", "management", "market", "operating", "operations"....
0.300
accessauthoritiesdevelopmenteconomicestateexactfinancialformsgovernmenthistoricalinfrastructurelocalmunicipalnetworknorthoperatedoperatingoperationaloperationsoperators
SHARED TOKENS (38): "access", "authorities", "development", "economic", "estate", "exact", "financial", "forms", "government", "historical", "infrastructure", "local", "municipal", "network", "north", "operated", "operating", "operational", "operations", "operators"....
0.300
changeconnectconservationconstructioncontrolcorridoremphasizesenvironmentalevenfoodhabitatimportantlandlocalmanagementnationalplaceprotectionresourceriver
SHARED TOKENS (25): "change", "connect", "conservation", "construction", "control", "corridor", "emphasizes", "environmental", "even", "food", "habitat", "important", "land", "local", "management", "national", "place", "protection", "resource", "river"....
0.300
Boise Art Museum ↗ KW CROSS HIGH
administrationbeganboisecentercollectingdevelopmentfederalidaholocalmajoropeningparkpeopleprogrammingpublicspacetreasurevalley
SHARED TOKENS (18): "administration", "began", "boise", "center", "collecting", "development", "federal", "idaho", "local", "major", "opening", "park", "people", "programming", "public", "space", "treasure", "valley".
0.300
Travel agency ↗ Q217107 KW CROSS HIGH
accommodationagenciesbureaucabinschangedestinationdifferenteventgrouporganizationoutdoorprivateproductsprovidepublicrecreationregionrentalsroleselling
SHARED TOKENS (21): "accommodation", "agencies", "bureau", "cabins", "change", "destination", "different", "event", "group", "organization", "outdoor", "private", "products", "provide", "public", "recreation", "region", "rentals", "role", "selling"....
0.300
authoritiescountrycreatedecisionsdestinationeventgovernmentinformationinfrastructureleisurelocalmajormanagementmarketingorganizationorganizationsprivatepromotesproviderole
SHARED TOKENS (26): "authorities", "country", "create", "decisions", "destination", "event", "government", "information", "infrastructure", "leisure", "local", "major", "management", "marketing", "organization", "organizations", "private", "promotes", "provide", "role"....
0.300
activitiesagenciesapproximatelyauthoritybusinesscapacityconstructioncontroldepartmentdesigndirectdirectlyeconomyenvironmentenvironmentalfacilitiesfederalfloatingformgovernment
SHARED TOKENS (41): "activities", "agencies", "approximately", "authority", "business", "capacity", "construction", "control", "department", "design", "direct", "directly", "economy", "environment", "environmental", "facilities", "federal", "floating", "form", "government"....
0.300
administrationassetsbusinesscapitalcommercialcontrolequipmentestatefinancialinformationlandmaintenancemanagementphysicalpublicrealrentalrolesystemsuseful
SHARED TOKENS (20): "administration", "assets", "business", "capital", "commercial", "control", "equipment", "estate", "financial", "information", "land", "maintenance", "management", "physical", "public", "real", "rental", "role", "systems", "useful".
0.300
benefitsbeyondbusinesseseconomiceconomyenvironmenteventeventsexposurefinancialgrowthinfrastructuremajorsportingsportsthemselvestourismtravelvisitors
SHARED TOKENS (19): "benefits", "beyond", "businesses", "economic", "economy", "environment", "event", "events", "exposure", "financial", "growth", "infrastructure", "major", "sporting", "sports", "themselves", "tourism", "travel", "visitors".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorycontroldescribeddevelopmentexpansionfinanciallong-termmanagementmanagingoperationalownershipprivateproductsprovidepublicratherrolespecialized
SHARED TOKENS (20): "business", "capital", "category", "control", "described", "development", "expansion", "financial", "long-term", "management", "managing", "operational", "ownership", "private", "products", "provide", "public", "rather", "role", "specialized".
0.300
anotherbecomebecomescontextdevelopeddevelopmentdiscoveryfinancialformsinformationmaintenancemajormultiplenewsoperatorsplatformproductsrestaurantssimplysingle
SHARED TOKENS (24): "another", "become", "becomes", "context", "developed", "development", "discovery", "financial", "forms", "information", "maintenance", "major", "multiple", "news", "operators", "platform", "products", "restaurants", "simply", "single"....
0.300
chainconservationcreatesdevelopmentestatefederalfinancialgovernmentgrowthhabitatlandlandslocalmarketorganizationownershipplaceprivateprotectpublic
SHARED TOKENS (26): "chain", "conservation", "creates", "development", "estate", "federal", "financial", "government", "growth", "habitat", "land", "lands", "local", "market", "organization", "ownership", "place", "private", "protect", "public"....
0.300
businesschaingardenleisuretravelers
SHARED TOKENS (5): "business", "chain", "garden", "leisure", "travelers". | EXACT TITLE in tourism_hospitality: "Hilton Garden Inn".
0.300
categoriescountrymountainstrongertrail
SHARED TOKENS (5): "categories", "country", "mountain", "stronger", "trail". | EXACT TITLE in outdoor_recreation: "Mountain biking".
🫐 BERRY89 edges
0.280
businessesformslicenseofficial
SHARED TOKENS (4): "businesses", "forms", "license", "official". | EXACT TITLE in tourism_hospitality: "Liquor license".
0.280
Protected area ↗ KW CROSS HIGH
approximatelybeyondconservationframeworkhabitatlandlocalmultiplenationalproductsprotectprotectionresourceswater
SHARED TOKENS (14): "approximately", "beyond", "conservation", "framework", "habitat", "land", "local", "multiple", "national", "products", "protect", "protection", "resources", "water".
0.280
centerinformationphysicalvisitor
SHARED TOKENS (4): "center", "information", "physical", "visitor". | EXACT TITLE in tourism_hospitality: "Visitor center".
0.280
Airbnb ↗ Q63327 EXACT TITLE
experiencesoperatingplatformrentals
SHARED TOKENS (4): "experiences", "operating", "platform", "rentals". | EXACT TITLE in tourism_hospitality: "Airbnb".
0.280
kayakoperatedrentaltravel
SHARED TOKENS (4): "kayak", "operated", "rental", "travel". | EXACT TITLE in tourism_hospitality: "Kayak (company)". | EXACT TITLE in outdoor_recreation: "Kayak (company)".
0.280
Winery ↗ Q156362 EXACT TITLE
businessequipmentmakesplace
SHARED TOKENS (4): "business", "equipment", "makes", "place". | EXACT TITLE in tourism_hospitality: "Winery".
0.280
activitiesconservationmanagementwildlife
SHARED TOKENS (4): "activities", "conservation", "management", "wildlife". | EXACT TITLE in outdoor_recreation: "Wildlife management area".
0.280
licensepeoplesystemtraining
SHARED TOKENS (4): "license", "people", "system", "training". | EXACT TITLE in tourism_hospitality: "Apprenticeship".
0.280
Splash pad ↗ Q7578390 EXACT TITLE
parkpublicrecreationwater
SHARED TOKENS (4): "park", "public", "recreation", "water". | EXACT TITLE in outdoor_recreation: "Splash pad".
0.280
additionalchaindevelopmentjune
SHARED TOKENS (4): "additional", "chain", "development", "june". | EXACT TITLE in tourism_hospitality: "Residence Inn by Marriott".
0.280
activityrecreationthemselveswater
SHARED TOKENS (4): "activity", "recreation", "themselves", "water". | EXACT TITLE in outdoor_recreation: "Tubing (recreation)".
0.280
classificationconditionsdefinedifferenteventeventsformformshistorymountainsnearpatternstatusstructures
SHARED TOKENS (14): "classification", "conditions", "define", "different", "event", "events", "form", "forms", "history", "mountains", "near", "pattern", "status", "structures".
0.280
activityagenciesbusinessdepartmentsgovernmentlicenselicenseslocalmultipleoperatingpermitsphysicalrequiressingle
SHARED TOKENS (14): "activity", "agencies", "business", "departments", "government", "license", "licenses", "local", "multiple", "operating", "permits", "physical", "requires", "single".
0.270
departmentfishidahomanagingpreservingwildlife
SHARED TOKENS (6): "department", "fish", "idaho", "managing", "preserving", "wildlife". | URL->B (1): https://idfg.idaho.gov/.
0.260
chainoperatedsuite
SHARED TOKENS (3): "chain", "operated", "suite". | EXACT TITLE in tourism_hospitality: "SpringHill Suites".
0.260
eagleidahopark
SHARED TOKENS (3): "eagle", "idaho", "park". | EXACT TITLE in outdoor_recreation: "Eagle Island State Park".
0.260
administrationbusinesscountrycoversdepartmentdestinationhospitalitymanagementmarketingorganizationsparksrestaurantstourism
SHARED TOKENS (13): "administration", "business", "country", "covers", "department", "destination", "hospitality", "management", "marketing", "organizations", "parks", "restaurants", "tourism".
0.260
Sagebrush steppe ↗ KW CROSS HIGH
basinbecomecommunityformhabitatimportantlandlocalrecreationsourcewaterwestwildlife
SHARED TOKENS (13): "basin", "become", "community", "form", "habitat", "important", "land", "local", "recreation", "source", "water", "west", "wildlife".
0.260
becomeregionspecialized
SHARED TOKENS (3): "become", "region", "specialized". | EXACT TITLE in tourism_hospitality: "Wine tasting".
0.260
departmentidahopublic
SHARED TOKENS (3): "department", "idaho", "public". | EXACT TITLE in tourism_hospitality: "Idaho Department of Health and Welfare".
0.260
Hotel manager ↗ KW CROSS HIGH
businessdepartmentdepartmentsfacilitiesfinancialmanagementmanagersmanagingmarketingoperationsownershipresortrevenue
SHARED TOKENS (13): "business", "department", "departments", "facilities", "financial", "management", "managers", "managing", "marketing", "operations", "ownership", "resort", "revenue".
0.260
businessbusinessesmarketing
SHARED TOKENS (3): "business", "businesses", "marketing". | EXACT TITLE in tourism_hospitality: "Loyalty program".
0.260
Tourist tax ↗ Q96410506 KW CROSS HIGH
destinationdirectlyeconomyenvironmentaleventsforminfrastructuremarketportalprovidepublicrevenuetourism
SHARED TOKENS (13): "destination", "directly", "economy", "environmental", "events", "form", "infrastructure", "market", "portal", "provide", "public", "revenue", "tourism".
0.260
Vrbo ↗ Q17091141 EXACT TITLE
grouprentalrentals
SHARED TOKENS (3): "group", "rental", "rentals". | EXACT TITLE in tourism_hospitality: "Vrbo".
0.260
Disc golf ↗ Q876737 EXACT TITLE
differentrulestoward
SHARED TOKENS (3): "different", "rules", "toward". | EXACT TITLE in outdoor_recreation: "Disc golf".
0.260
Kayaking ↗ Q2094083 EXACT TITLE
kayaksidewater
SHARED TOKENS (3): "kayak", "side", "water". | EXACT TITLE in outdoor_recreation: "Kayaking".
0.240
culturedirectlyeconomylocalmarketmarketsphysicalproductspublicretailstructuresyear-round
SHARED TOKENS (12): "culture", "directly", "economy", "local", "market", "markets", "physical", "products", "public", "retail", "structures", "year-round".
0.240
approximatelyboisebuiltcapacitycentralcurrentdowntownfeetidahomillionstreetwestern
SHARED TOKENS (12): "approximately", "boise", "built", "capacity", "central", "current", "downtown", "feet", "idaho", "million", "street", "western".
0.240
approximatelyboisecapacitycommunitycurrenteventsfeetidahoshowsspacewestwestern
SHARED TOKENS (12): "approximately", "boise", "capacity", "community", "current", "events", "feet", "idaho", "shows", "space", "west", "western".
0.240
Tour guide ↗ Q1039099 KW CROSS HIGH
authorityfishingheritagehikinghistoricalinformationmajoroutdoorpeopleprovidesitesvisitors
SHARED TOKENS (12): "authority", "fishing", "heritage", "hiking", "historical", "information", "major", "outdoor", "people", "provide", "sites", "visitors".
0.220
communitydifferentequipmentexperiencekayakleisurenorthoutdoorrequiresriverwater
SHARED TOKENS (11): "community", "different", "equipment", "experience", "kayak", "leisure", "north", "outdoor", "requires", "river", "water".
0.220
Vineyard ↗ Q22715 EXACT TITLE
itselfplace
SHARED TOKENS (2): "itself", "place". | EXACT TITLE in tourism_hospitality: "Vineyard".
0.220
boisecanyonidahomajormilesoregonriverscenicsnakespringsvalley
SHARED TOKENS (11): "boise", "canyon", "idaho", "major", "miles", "oregon", "river", "scenic", "snake", "springs", "valley".
0.220
contextcontinuousequipmentfeetmountainpointsecondsidesinglestrongertravel
SHARED TOKENS (11): "context", "continuous", "equipment", "feet", "mountain", "point", "second", "side", "single", "stronger", "travel".
0.220
Viator ↗ Q1444040 EXACT TITLE
communityplace
SHARED TOKENS (2): "community", "place". | EXACT TITLE in tourism_hospitality: "Viator".
0.220
benefitscategoriescontrolequipmentlicensinglocalphysicalrathersafetythemtouring
SHARED TOKENS (11): "benefits", "categories", "control", "equipment", "licensing", "local", "physical", "rather", "safety", "them", "touring".
0.220
rentalrentals
SHARED TOKENS (2): "rental", "rentals". | EXACT TITLE in tourism_hospitality: "Short-term rental".
0.220
officialregion
SHARED TOKENS (2): "official", "region". | EXACT TITLE in tourism_hospitality: "American Viticultural Area".
0.220
activitiesbusinessenvironmentgovernmentleisureorganizationorganizationspeopleplacestourismtravel
SHARED TOKENS (11): "activities", "business", "environment", "government", "leisure", "organization", "organizations", "people", "places", "tourism", "travel".
0.220
idahooregon
SHARED TOKENS (2): "idaho", "oregon". | EXACT TITLE in tourism_hospitality: "Interstate 84".
0.220
Hostel ↗ Q654772 KW CROSS HIGH
countryfoodformformsgrowthlocallymarketoperatedpeopleprivatetravel
SHARED TOKENS (11): "country", "food", "form", "forms", "growth", "locally", "market", "operated", "people", "private", "travel".
0.220
Skiing ↗ Q130949 EXACT TITLE
activityevents
SHARED TOKENS (2): "activity", "events". | EXACT TITLE in outdoor_recreation: "Skiing".
0.220
Cycling ↗ Q53121 EXACT TITLE
activityrecreation
SHARED TOKENS (2): "activity", "recreation". | EXACT TITLE in outdoor_recreation: "Cycling".
0.220
boisedowntownidahomajormilesmountainnearoregonriverroutessnake
SHARED TOKENS (11): "boise", "downtown", "idaho", "major", "miles", "mountain", "near", "oregon", "river", "routes", "snake".
0.200
activitydatadistributionequipmenthabitatinformationrecreationreportingspecializedwildlife
SHARED TOKENS (10): "activity", "data", "distribution", "equipment", "habitat", "information", "recreation", "reporting", "specialized", "wildlife".
0.200
Leave No Trace ↗ Q559348 KW CROSS HIGH
centerconservationcreateframeworkoutdoorrecreationresourcesresponsetravelwildlife
SHARED TOKENS (10): "center", "conservation", "create", "framework", "outdoor", "recreation", "resources", "response", "travel", "wildlife".
0.200
Bartender ↗ Q808266 KW CROSS HIGH
alcoholcorecreateprivateprofilerequirementsrestaurantsservingthemvalue
SHARED TOKENS (10): "alcohol", "core", "create", "private", "profile", "requirements", "restaurants", "serving", "them", "value".
0.200
becomeconservationeducationenvironmentenvironmentallocalnationalparkstourismwildlife
SHARED TOKENS (10): "become", "conservation", "education", "environment", "environmental", "local", "national", "parks", "tourism", "wildlife".
0.180
amongboisechainhistoryidaholocaloutdoorparkwestern
SHARED TOKENS (9): "among", "boise", "chain", "history", "idaho", "local", "outdoor", "park", "western".
0.180
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
boisecanyonidahomeridianmilesnampasecondwestwestern
SHARED TOKENS (9): "boise", "canyon", "idaho", "meridian", "miles", "nampa", "second", "west", "western".
0.180
Snowshoe ↗ Q214724 KW CROSS HIGH
equipmentoutdoorratherrecreationrolespecializedthemtravelwalking
SHARED TOKENS (9): "equipment", "outdoor", "rather", "recreation", "role", "specialized", "them", "travel", "walking".
0.180
eventlicensingmanagementmanagingmarketingpricingretailrevenueselling
SHARED TOKENS (9): "event", "licensing", "management", "managing", "marketing", "pricing", "retail", "revenue", "selling".
0.180
Brewery ↗ Q131734 KW CROSS HIGH
builtbusinesscommercialequipmentmakesplaceprotectionscaleselling
SHARED TOKENS (9): "built", "business", "commercial", "equipment", "makes", "place", "protection", "scale", "selling".
0.180
chainexperiencesitselfmanagementmarketmarketingmarketsrelationshiprelationships
SHARED TOKENS (9): "chain", "experiences", "itself", "management", "market", "marketing", "markets", "relationship", "relationships".
0.180
creatingdepartmentdifferentevengroupsprovidetrailstravelurban
SHARED TOKENS (9): "creating", "department", "different", "even", "groups", "provide", "trails", "travel", "urban".
0.180
Fly fishing ↗ Q898886 KW CROSS HIGH
differentfishfishingformshabitatnorthsmallspecializedwater
SHARED TOKENS (9): "different", "fish", "fishing", "forms", "habitat", "north", "small", "specialized", "water".
0.180
Green belt ↗ KW CROSS HIGH
developmentgreenbeltlandparkplanningsmallspaceurbanwildlife
SHARED TOKENS (9): "development", "greenbelt", "land", "park", "planning", "small", "space", "urban", "wildlife".
0.180
Package tour ↗ Q926780 KW CROSS HIGH
accommodationactivitiesformoperatoroperatorsrentaltogethertourismtravel
SHARED TOKENS (9): "accommodation", "activities", "form", "operator", "operators", "rental", "together", "tourism", "travel".
0.180
approximatelyboisecaldwellcanyonidaholocallymilesoregonwest
SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "idaho", "locally", "miles", "oregon", "west".
0.180
acresboisebuiltbusinesscenterconservationfacilitiesidahoorganization
SHARED TOKENS (9): "acres", "boise", "built", "business", "center", "conservation", "facilities", "idaho", "organization".
0.160
begandevelopmentidahomountainmountainsoregonriverwest
SHARED TOKENS (8): "began", "development", "idaho", "mountain", "mountains", "oregon", "river", "west".
0.160
Booking.com ↗ Q4035313 KW CROSS HIGH
activitiesagenciesapproximatelycommarketsmillionreservationtravel
SHARED TOKENS (8): "activities", "agencies", "approximately", "com", "markets", "million", "reservation", "travel".
0.160
activityfishingfloatingformoutdoorsportingthemselveswater
SHARED TOKENS (8): "activity", "fishing", "floating", "form", "outdoor", "sporting", "themselves", "water".
0.160
Nordic skiing ↗ Q216613 KW CROSS HIGH
attachedeventeventsrequirementsrequiresrulessportstraining
SHARED TOKENS (8): "attached", "event", "events", "requirements", "requires", "rules", "sports", "training".
0.160
groupinformationmountainnationalpeoplepromotesurbanwater
SHARED TOKENS (8): "group", "information", "mountain", "national", "people", "promotes", "urban", "water".
0.160
Water right ↗ Q7973730 KW CROSS HIGH
differentlawphysicalriversourcesystemstreatwater
SHARED TOKENS (8): "different", "law", "physical", "river", "source", "systems", "treat", "water".
0.160
accommodationbuiltevenlong-termmonthspeoplesystemthem
SHARED TOKENS (8): "accommodation", "built", "even", "long-term", "months", "people", "system", "them".
0.160
departmentfederalfishgovernmentmanagementpeopleprotectwildlife
SHARED TOKENS (8): "department", "federal", "fish", "government", "management", "people", "protect", "wildlife".
0.160
activitiescommercialfishinglicenselicensinglocalmanagementwestern
SHARED TOKENS (8): "activities", "commercial", "fishing", "license", "licensing", "local", "management", "western".
0.140
businessbusinessescountryreportingroletourismtravel
SHARED TOKENS (7): "business", "businesses", "country", "reporting", "role", "tourism", "travel".
0.140
boisebuiltfeetidahomilenationalplaces
SHARED TOKENS (7): "boise", "built", "feet", "idaho", "mile", "national", "places".
0.140
coversidaholandmajormilesriversnake
SHARED TOKENS (7): "covers", "idaho", "land", "major", "miles", "river", "snake".
0.140
Expedia Group ↗ Q8085893 KW CROSS HIGH
comenginesfacilitiesgroupmillionoperatestravel
SHARED TOKENS (7): "com", "engines", "facilities", "group", "million", "operates", "travel".
0.140
Viticulture ↗ Q253140 KW CROSS HIGH
developmenthistorymanagementmonthsprovidesitewestern
SHARED TOKENS (7): "development", "history", "management", "months", "provide", "site", "western".
0.140
accommodationactivitiesamongexperiencefoodtourismtravel
SHARED TOKENS (7): "accommodation", "activities", "among", "experience", "food", "tourism", "travel".
0.140
Bicycle safety ↗ Q516366 KW CROSS HIGH
environmenteventinfrastructuremultipleroadsafetytraffic
SHARED TOKENS (7): "environment", "event", "infrastructure", "multiple", "road", "safety", "traffic".
0.140
Swimming hole ↗ Q7658373 KW CROSS HIGH
activitybecomehistoryplaceriverspringwater
SHARED TOKENS (7): "activity", "become", "history", "place", "river", "spring", "water".
0.120
activitiesbeyondconstructioneventstrailstransportation
SHARED TOKENS (6): "activities", "beyond", "construction", "events", "trails", "transportation".
0.120
AC Hotels ↗ Q5653536 KW CROSS HIGH
businesschainjuneleisureservingtravelers
SHARED TOKENS (6): "business", "chain", "june", "leisure", "serving", "travelers".
0.120
decisionsexperienceformproductssitesthemselves
SHARED TOKENS (6): "decisions", "experience", "form", "products", "sites", "themselves".
0.120
boisecenterculturehistoryidahoinstitution
SHARED TOKENS (6): "boise", "center", "culture", "history", "idaho", "institution".
0.120
Native species ↗ Q169480 KW CROSS HIGH
economicenvironmentalhistorylocalplaceregion
SHARED TOKENS (6): "economic", "environmental", "history", "local", "place", "region".
0.120
Star, Idaho ↗ Q1516815 KW CROSS HIGH
boisecanyondistrictidahotravelerswest
SHARED TOKENS (6): "boise", "canyon", "district", "idaho", "travelers", "west".
0.120
idahomilesnationaloregonparkwest
SHARED TOKENS (6): "idaho", "miles", "national", "oregon", "park", "west".
0.100
Streamflow ↗ Q29425295 KW CROSS HIGH
capacitychannelslandmajorwater
SHARED TOKENS (5): "capacity", "channels", "land", "major", "water".
0.100
Septic tank ↗ Q386300 KW CROSS HIGH
environmentfacilityflowssystemsystems
SHARED TOKENS (5): "environment", "facility", "flows", "system", "systems".
0.100
additionalamenitieschaineconomyjune
SHARED TOKENS (5): "additional", "amenities", "chain", "economy", "june".
0.100
Wine tourism ↗ Q2180552 KW CROSS HIGH
activitiesformsnearsourcetourism
SHARED TOKENS (5): "activities", "forms", "near", "source", "tourism".
0.100
Wild camping ↗ Q2755308 KW CROSS HIGH
dispersedformmeanssitestrail
SHARED TOKENS (5): "dispersed", "form", "means", "sites", "trail".
◈ Frequently Asked Questions
Tourism Hospitality × Outdoor Recreation — Treasure Valley
HAIKU · HIGH GATE
How do Boise accommodations support visitors traveling to Bogus Basin and Boise National Forest?
Hotels and lodging in Boise serve as primary bases for guests accessing Bogus Basin's skiing and Boise National Forest's hiking trails within 30-40 miles west of the capital. Tourism businesses in Ada County coordinate transportation and package deals that connect urban accommodations to these outdoor recreation destinations, extending visitor stays beyond day trips.
What role do Treasure Valley campsites play in hospitality for outdoor recreation visitors?
Campsites throughout Ada County and Canyon County function as hospitality infrastructure for hiking, fishing, and birdwatching activities in Boise National Forest and along the Boise River. These facilities enable multi-day recreation visits while generating economic activity that sustains local tourism operations in Boise, Meridian, and Eagle.
How does the Boise River Greenbelt connect tourism services in Garden City and Boise to outdoor recreation activity?
The Boise River Greenbelt's trail system attracts visitors who use hotels and restaurants in Boise and Garden City while hiking, fishing, and birdwatching along approximately 25 miles of maintained pathways. This integration allows tourism hospitality businesses to serve recreation participants without requiring travel to Bogus Basin or Boise National Forest.
Why do tourism operators in Ada County promote trail access information alongside lodging services?
Hiking and fishing on Boise National Forest trails and the Boise River generate visitor demand that tourism businesses in Boise, Meridian, and Eagle address through coordinated marketing of nearby campsites and accommodations. Hotels and hospitality providers recognize that outdoor recreation activity in the Treasure Valley directly determines occupancy rates and repeat visitor patterns.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Tourism Hospitality × Outdoor Recreation 16 QID bridges 216 edges 5,678 ext links 2026-07-17 23:36:43 UTC 2d206eac056a7d42
Tourism Hospitality corridor ↗ Outdoor Recreation corridor ↗ Outdoor Recreation × Tourism Hospitality ↗ boisestandard.org/standard ↗
Parent Corridors
Tourism Hospitality × All Other Verticals