—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Staffing Recruiting ↔ relates to ↔ Water Rights

12 Wikipedia bridge articles confirmed in both vertical ledgers. 255 deterministic cross-vertical edges. 6,776 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
255 Cross Edges
6,776 External Sources
290 Wikipedia Articles
14 🌲 Evergreen
190 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Staffing Recruiting
× Water Rights
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
255
External Sources Harvested
6,776
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Treasure Valley
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (12)
Treasure ValleyUrbanizationFood processingCivil engineeringNampa, IdahoBoise, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, IdahoKuna, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanadamakinglocallycanyonnorthwestcapitaleastagriculturallandlocalresourcestreasurevalleywesternapproximatelymajor
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:23:05 UTC
Content Hash
2eb1834ace3bcc6d
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in staffing_recruiting (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (15): "agricultural", "boise", "eastern", "historically", "idaho", "land", "local", "lower", "metropolitan", "primarily", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in staffing_recruiting: "Treasure Valley". | EXACT TITLE in water_rights: "Treasure Valley".
agriculturalboiseeasternhistoricallyidaholandlocallowermetropolitanprimarilyregionresourcestreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Urbanization
Q161078 EXACT TITLE 1.000
QID OVERLAP: Q161078 in staffing_recruiting (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (39): "administrative", "approximately", "become", "change", "classified", "create", "creates", "current", "describes", "developed", "development", "economic", "education", "essential", "growth", "increase", "increased", "institutional", "land", "larger".... | EXACT TITLE in water_rights: "Urbanization".
administrativeapproximatelybecomechangeclassifiedcreatecreatescurrentdescribesdevelopeddevelopmenteconomiceducationessentialgrowthincreaseincreasedinstitutionallandlargermajormerelynationalplanningpolicypopulationpowerprocessprovidepublic+9
ing, geography, sociology, architecture, economics, education, statistics, and public health. The phenomenon has been closely linked to globalization, modernization, industrialization, marketization, administrative/institutional power, and the sociological process of rationalization. Urbanization can be seen as a specific condition at a set time (e.g. the proportion of total population or area in cities or towns), or as an increase in that condition over time. Therefore, urbanization can be quantified either in terms of the level of urban development relative to the overall population, or as the rate at which the urban proportion of the population is increasing. Urbanization creates enormous social, economic and environmental challenges, which provide an opportunity for sustainability with the "potential to use resources much less or more efficiently, to create more sustainable land use and to protect the biodiversity of natural ecosystems." However, current urbanization trends have shown that massive urbanization has led to unsustainable ways of living. Developing urban resilience and urban sustainability in the face of increased urbanization is at the centre of international policy in Sustainable Development Goal 11 "Sustainable cities and communities." Urbanization is not merely a modern phenomenon, but a rapid and historic transformation of human social roots on a global scale, whereby predominantly rural culture is being rapidly replaced by predominantly urban culture. The first major change in settlement patterns was the accumulation of hunter-gatherers into villages many thousands of years ago. Village culture is characterized by common bloodlines, intimate relationships, and communal behaviour, whereas urban culture is characterized by distant bloodlines, unfamiliar relations, and competitive behaviour. This unprecedented movement of people is forecast to continue and intensify during the next few decades, mushrooming cities to sizes unthinkable only a century ago.
predicted to generate artificial scarcities of land, lack of drinking water, playgrounds and other essential resources for most urban dwellers. The predicted urban population growth is equivalent to approximately 3 billion urbanites by 2050, much of which will occur in Africa and Asia. Notably, the United Nations has also recently projected that nearly all global population growth from 2017 to 2030 will take place in cities, with about 1.1 billion new urbanites over the next 10 years. In the long term, urbanization is expected to significantly impact the quality of life in negative ways. Urbanization is relevant to a range of disciplines, including urban planning, geography, sociology, architecture, economics, education, statistics, and public health. The phenomenon has been closely linked to globalization, modernization, industrialization, marketization, administrative/institutional power, and the sociological process of rationalization. Urbanization can be seen as a specific condition at a set time (e.g. the proportion of total population or area in cities or towns), or as an increase in that condition over time. Therefore, urbanization can be quantified either in terms of the level of urban development relative to the overall population, or as the rate at which the urban proportion of the population is increasing. Urbanization creates enormous social, economic and environmental challenges, which provide an opportunity for sustainability with the "potential to use resources much less or more efficiently, to create more sustainable land use and to protect the biodiversity of natural ecosystems." However, current urbanization trends have shown that massive urbanization has led to unsustainable ways of living. Developing urban resilience and urban sustainability in the face of increased urbanization is at the centre of international policy in Sustainable Development Goal 11 "Sustainable cities and communities." Urbanization is not merely a modern phenomenon, but a rapid and historic transformation of human social roots on a global scale, whereby predominantly rural culture is being rapidly replaced by predominantly urban culture. The first major change in settlement patterns was the accumulation of hunter-gatherers into villages many thousands of years ago. Village culture is characterized by common bloodlines, intimate relationships, and communal behaviour, whereas urban culture is characterized by distant bloodlines, unfamiliar relations, and competitive behaviour. This unprecedented movement of people is forecast to continue and intensify during the next few decades, mushrooming cities to sizes unthinkable only a century ago.
Urbanization (or urbanisation in British English) is the process by which human settlements are formed and become larger as more people live, recreate and work in cities and towns. It describes the population shift from rural to urban areas, the corresponding decrease in the proportion of people living in rural areas, and the ways in which societies and culture adapt to this change. Rather than strictly referring to the absolute number of people living in urban environments, Urbanization refers to the proportion of the total national population living in areas classified as urban. It is predicted that by 2050, about 64% of the developing world and 86% of the developed world will be urbanized. This is predicted to generate artificial scarcities of land, lack of drinking water, playgrounds and other essential resources for most urban dwellers. The predicted urban population growth is equivalent to approximately 3 billion urbanites by 2050, much of which will occur in Africa and Asia. Notably, the United Nations has also recently projected that nearly all global population growth from 2017 to 2030 will take place in cities, with about 1.1 billion new urbanites over the next 10 years. In the long term, urbanization is expected to significantly impact the quality of life in negative ways. Urbanization is relevant to a range of disciplines, including urban planning, geography, sociology, architecture, economics, education, statistics, and public health. The phenomenon has been closely linked to globalization, modernization, industrialization, marketization, administrative/institutional power, and the sociological process of rationalization. Urbanization can be seen as a specific condition at a set time (e.g. the proportion of total population or area in cities or towns), or as an increase in that condition over time. Therefore, urbanization can be quantified either in terms of the level of urban development relative to the overall population, or as the rate at which the urban proportion of the population is increasing. Urbanization creates enormous social, economic and environmental challenges, which provide an opportunity for sustainability with the "potential to use resources much less or more efficiently, to create more sustainable land use and to protect the biodiversity of natural ecosystems." However, current urbanization trends have shown that massive urbanization has led to unsustainable ways of living. Developing urban resilience and urban sustainability in the face of increased urbanization is at the centre of international policy in Sustainable Development Goal 11 "Sustainable cities and communities." Urbanization is not merely a modern phenomenon, but a rapid and historic transformation of human social roots on a global scale, whereby predominantly rural culture is being rapidly replaced by predominantly urban culture. The first major change in settlement patterns was the accumulation of hunter-gatherers into villages many thousands of years ago. Village culture is characterized by common bloodlines, intimate relationships, and communal behaviour, whereas urban culture is characterized by distant bloodlines, unfamiliar relations, and competitive behaviour. This unprecedented movement of people is forecast to continue and intensify during the next few decades, mushrooming cities to sizes unthinkable only a century ago.
Food processing
Q627371 EXACT TITLE 1.000
QID OVERLAP: Q627371 in staffing_recruiting (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (16): "according", "agricultural", "agriculture", "changes", "classification", "containing", "different", "food", "form", "forms", "industrial", "making", "methods", "physical", "processing", "required". | EXACT TITLE in staffing_recruiting: "Food processing". | EXACT TITLE in water_rights: "Food processing".
accordingagriculturalagriculturechangesclassificationcontainingdifferentfoodformformsindustrialmakingmethodsphysicalprocessingrequired
portant roles in reducing food waste and improving food preservation, thus reducing the total environmental impact of agriculture and improving food security. Food Processing Levels (FPL) are defined according to physical and chemical changes occurring during food treatments. FPL are required in processed food classifications, such as the Nova classification, to categorise processed foods according to their FPL for different purposes. Primary food processing is necessary to make most foods edible while secondary food processing turns ingredients into familiar foods, such as bread.
defined according to physical and chemical changes occurring during food treatments. FPL are required in processed food classifications, such as the Nova classification, to categorise processed foods according to their FPL for different purposes. Primary food processing is necessary to make most foods edible while secondary food processing turns ingredients into familiar foods, such as bread.
Tertiary food processing Tertiary food processing is the commercial production of what is commonly called processed food. It covers further processing of multiple ingredients in the manufacturing of fabricated foods, such as the ultra-processed foods category of the Nova classification. Many of these are ready-to-eat or heat-and-serve foods, such as frozen meals and re-heated airline meals. Food processing level Food processing level (FPL) is a parameter used for grouping of food processing according to physical and (bio)chemical changes taking place in food materials during processing. Definition of the extent of processing benefits from the use of an ordinal level of measurement. Arbitrary grouping of processed food using nominal scales, such as extent of change, nature of change, raw material sources, ingredients used, place of processing, purpose of processing, traditional, novel and other type of treatments is often criticised. Ranking of food processing at an ordinal scale at any stage from food production in agriculture to eating by consumer describes the extent of food processing using the order of the different levels of processing. Processed food classifications often identify processing as a criterion for the grouping of processed foods. Some processed food classifications, such as the Nova classification, emphasise the role of processing in the development of obesity and noncommunicable diseases.
Civil engineering
Q77590 EXACT TITLE 1.000
QID OVERLAP: Q77590 in staffing_recruiting (tier:evergreen) and water_rights (tier:branch). | SHARED TOKENS (22): "agencies", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public".... | EXACT TITLE in staffing_recruiting: "Civil engineering".
agenciescivilcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicsectorsystems
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
Civil engineering is a professional engineering discipline that deals with the design, construction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (13): "according", "boise", "canyon", "college", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "student", "western".
accordingboisecanyoncollegeidahomeridianmetropolitannampanorthwestpopulationprincipalstudentwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (13): "ada", "boise", "capital", "counties", "east", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "treasure", "valley".
adaboisecapitalcountieseastidaholocallymajormanufacturingmetropolitanpopulationtreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "east", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
adaboisecapitaleastidahojurisdictionlocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "population".
adaadditionalboiseidahokunametropolitanpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in staffing_recruiting (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population".
adaboiseidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
243 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP243 edges
🌲 EVERGREEN2 edges
0.650
agenciesagencybureaubusinessesconditionscurrentdatadepartmenteconomicessentialfederalgovernmentlaborlocalmajormanagementneedofficeprincipalprocesses
SHARED TOKENS (26): "agencies", "agency", "bureau", "businesses", "conditions", "current", "data", "department", "economic", "essential", "federal", "government", "labor", "local", "major", "management", "need", "office", "principal", "processes".... | URL->A (1): https://www.bls.gov/lau/. | EXACT TITLE in staffing_recruiting: "Bureau of Labor Statistics".
0.650
adaboisebureaucompletedconstructioncontroldirectlyeastengineersfederalformsidahooperatingoperationalpowerprimarilyprivatesouthernwestern
SHARED TOKENS (19): "ada", "boise", "bureau", "completed", "construction", "control", "directly", "east", "engineers", "federal", "forms", "idaho", "operating", "operational", "power", "primarily", "private", "southern", "western". | URL->B (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
🌿 BRANCH190 edges
0.530
agencydepartmentdevelopmenteconomicidaholaborprocessesresponsibleworkforce
SHARED TOKENS (9): "agency", "department", "development", "economic", "idaho", "labor", "processes", "responsible", "workforce". | URL->A (1): https://www.labor.idaho.gov/. | EXACT TITLE in staffing_recruiting: "Idaho Department of Labor". | EXACT TITLE in water_rights: "Idaho Department of Labor".
0.500
amongapproximatelyboiseclassifieddivisionidaholateroperatesprimarilyproductionprofessionalpublicresearchschoolsstatewide
SHARED TOKENS (15): "among", "approximately", "boise", "classified", "division", "idaho", "later", "operates", "primarily", "production", "professional", "public", "research", "schools", "statewide". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessageanotherbeginscompletedconstructioncontainscreatecreatedhistoricallymethodspointproviderequireresourcessitestructuresupplytreatmentuses
SHARED TOKENS (20): "access", "age", "another", "begins", "completed", "construction", "contains", "create", "created", "historically", "methods", "point", "provide", "require", "resources", "site", "structure", "supply", "treatment", "uses". | EXACT TITLE in staffing_recruiting: "Well". | EXACT TITLE in water_rights: "Well".
0.500
Résumé ↗ Q950511 EXACT TITLE
anotherapplicationapplybusinesscontainscovercreateddatadocumenteasteducationemploymentexperienceindividualrequiresouthstatus
SHARED TOKENS (17): "another", "application", "apply", "business", "contains", "cover", "created", "data", "document", "east", "education", "employment", "experience", "individual", "require", "south", "status". | EXACT TITLE in staffing_recruiting: "Résumé".
0.500
Land use ↗ Q1165944 EXACT TITLE
agriculturalanotherchangechangesclassificationcoverdatadirectlyenvironmenthistoricallylandmajormanagementmethodsmodelingpermanentpracticespreviouslyresourcesrisk
SHARED TOKENS (23): "agricultural", "another", "change", "changes", "classification", "cover", "data", "directly", "environment", "historically", "land", "major", "management", "methods", "modeling", "permanent", "practices", "previously", "resources", "risk".... | EXACT TITLE in staffing_recruiting: "Land use". | EXACT TITLE in water_rights: "Land use".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistincteasteasterneconomygeographicidahoisolatedlandmanufacturingmethodsnationalnorthwestofficial
SHARED TOKENS (28): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "east", "eastern", "economy", "geographic", "idaho", "isolated", "land", "manufacturing", "methods", "national", "northwest", "official".... | EXACT TITLE in staffing_recruiting: "Idaho". | EXACT TITLE in water_rights: "Idaho".
0.500
additionalagriculturalapplicationscapacityconditionscostcostsdepartmentenergyformationheatingindustrialpowerprocessesratereduceresourcessourcespacesupply
SHARED TOKENS (20): "additional", "agricultural", "applications", "capacity", "conditions", "cost", "costs", "department", "energy", "formation", "heating", "industrial", "power", "processes", "rate", "reduce", "resources", "source", "space", "supply". | EXACT TITLE in water_rights: "Geothermal energy".
0.500
anothercommonlydesigndevelopeddistributionenergyengineeringflowgoverninglocalmaintainedplacesqualitystudysuppliessystemsystemsthough
SHARED TOKENS (18): "another", "commonly", "design", "developed", "distribution", "energy", "engineering", "flow", "governing", "local", "maintained", "places", "quality", "study", "supplies", "system", "systems", "though". | EXACT TITLE in water_rights: "Hydrogeology".
0.500
accountingagencyanotherassignmentscontractsdevelopmentdifferenteconomyemployeeemploymentengineeringfieldsfirmhighlyincreasinglyindividualjobslaborlimitedmarket
SHARED TOKENS (38): "accounting", "agency", "another", "assignments", "contracts", "development", "different", "economy", "employee", "employment", "engineering", "fields", "firm", "highly", "increasingly", "individual", "jobs", "labor", "limited", "market".... | EXACT TITLE in staffing_recruiting: "Temporary work".
0.500
Wheat ↗ Q15645384 EXACT TITLE
demandessentialfoodgeneralgrouplandlargermajormakingpopulationproductionqualityrecordsourcesupplying
SHARED TOKENS (15): "demand", "essential", "food", "general", "group", "land", "larger", "major", "making", "population", "production", "quality", "record", "source", "supplying". | EXACT TITLE in water_rights: "Wheat".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomecapacitycentralchangecommonlycontainsdistributionformformationindustriallandmajormunicipaloperatingprocessprovidepublicsolely
SHARED TOKENS (27): "agricultural", "agriculture", "become", "capacity", "central", "change", "commonly", "contains", "distribution", "form", "formation", "industrial", "land", "major", "municipal", "operating", "process", "provide", "public", "solely".... | EXACT TITLE in water_rights: "Groundwater".
0.500
actamongauthoritybureauconstructioncontractscreateddepartmentfederallandlaterlawmaintenancemajormeridiannationalprogramprojectprojectsprovisions
SHARED TOKENS (27): "act", "among", "authority", "bureau", "construction", "contracts", "created", "department", "federal", "land", "later", "law", "maintenance", "major", "meridian", "national", "program", "project", "projects", "provisions".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
Commuting ↗ Q48442 EXACT TITLE
administrativeallowingboundarycommunitycoredifferentevenincreasinglyinfrastructurelargelargerlegalmunicipalnationalphysicalprocessratherremainrequiresstudy
SHARED TOKENS (24): "administrative", "allowing", "boundary", "community", "core", "different", "even", "increasingly", "infrastructure", "large", "larger", "legal", "municipal", "national", "physical", "process", "rather", "remain", "requires", "study".... | EXACT TITLE in staffing_recruiting: "Commuting".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdeterminedevelopeddevelopmentdifferentexceptionsformgoverngovernmentgrowthindustriallandlocalplacesplanningpolicyregulationsregulatoryrules
SHARED TOKENS (23): "allowing", "building", "determine", "developed", "development", "different", "exceptions", "form", "govern", "government", "growth", "industrial", "land", "local", "places", "planning", "policy", "regulations", "regulatory", "rules".... | EXACT TITLE in staffing_recruiting: "Zoning". | EXACT TITLE in water_rights: "Zoning".
0.500
Farmworker ↗ Q5060555 EXACT TITLE
addressagriculturalagricultureassociatedconditionscontexteconomiclaborlawproductionrelatedrightsshortagesvalleyworkworking
SHARED TOKENS (16): "address", "agricultural", "agriculture", "associated", "conditions", "context", "economic", "labor", "law", "production", "related", "rights", "shortages", "valley", "work", "working". | EXACT TITLE in staffing_recruiting: "Farmworker".
0.500
actagencybecomebureaudeliverydepartmentdevelopmentfederalgovernmentlawmanagementoperationpowerprogramprojectsprovidingprovisionssourcesupplythroughout
SHARED TOKENS (21): "act", "agency", "become", "bureau", "delivery", "department", "development", "federal", "government", "law", "management", "operation", "power", "program", "projects", "providing", "provisions", "source", "supply", "throughout".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
Nitrate ↗ Q49916468 EXACT TITLE
absenceagriculturalapplicationsassociatedcomponentscontainingcreationdirectenergyenvironmenthistoricallymanufacturingmeansprocessesproducedproductionsource
SHARED TOKENS (17): "absence", "agricultural", "applications", "associated", "components", "containing", "creation", "direct", "energy", "environment", "historically", "manufacturing", "means", "processes", "produced", "production", "source". | EXACT TITLE in water_rights: "Nitrate".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationavailabilitybuildingclassifiedconstructioncreationcriticaldesigndevelopedengineeringflowfunctionsgoverningincreaseindustriallandlargemaintenancemanagement
SHARED TOKENS (36): "additional", "application", "availability", "building", "classified", "construction", "creation", "critical", "design", "developed", "engineering", "flow", "functions", "governing", "increase", "industrial", "land", "large", "maintenance", "management".... | EXACT TITLE in water_rights: "Dam".
0.500
actualagriculturalalongsidechangedevelopeddevelopmentdirectdueenvironmentgroupgrowthincreaseincreasedindividuallimitedpolicypopulationprocessprojectionsprojects
SHARED TOKENS (25): "actual", "agricultural", "alongside", "change", "developed", "development", "direct", "due", "environment", "group", "growth", "increase", "increased", "individual", "limited", "policy", "population", "process", "projections", "projects".... | EXACT TITLE in staffing_recruiting: "Population growth". | EXACT TITLE in water_rights: "Population growth".
0.500
Drought ↗ Q43059 EXACT TITLE
agricultureavailabilitybecomechangeconditionscostsdirectlydueeconomiceconomyexperienceexperiencedfoodincreaseincreasedincreaseslargelargerlocallower
SHARED TOKENS (28): "agriculture", "availability", "become", "change", "conditions", "costs", "directly", "due", "economic", "economy", "experience", "experienced", "food", "increase", "increased", "increases", "large", "larger", "local", "lower".... | EXACT TITLE in water_rights: "Drought".
0.500
approximatelybecomesbusinessesclientscompliancedevelopmentfilingfirmlegalmanagementoperatingpracticeprocessingprofessionalprovidingrecordregulatoryresponsiblerisksafety
SHARED TOKENS (23): "approximately", "becomes", "businesses", "clients", "compliance", "development", "filing", "firm", "legal", "management", "operating", "practice", "processing", "professional", "providing", "record", "regulatory", "responsible", "risk", "safety".... | EXACT TITLE in staffing_recruiting: "Professional employer organization".
0.500
agriculturalanotherbodydomesticenvironmentfacilityindustrialmunicipalphaseprocessprocessesreturnseparationtreatmentuses
SHARED TOKENS (15): "agricultural", "another", "body", "domestic", "environment", "facility", "industrial", "municipal", "phase", "process", "processes", "return", "separation", "treatment", "uses". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
applicationbusinesscommonlycreatedatadevelopeddevicesdistributionengineeringequipmentgenerallygroupinformationlimitedmaintenancemanagementmethodsobjectivesoperatedplanning
SHARED TOKENS (35): "application", "business", "commonly", "create", "data", "developed", "devices", "distribution", "engineering", "equipment", "generally", "group", "information", "limited", "maintenance", "management", "methods", "objectives", "operated", "planning".... | EXACT TITLE in staffing_recruiting: "Information technology".
0.500
becomebeginscommonlycomponentscreationdesigneconomyengineeringequipmentfabricationfinalindividualindustrialintermediarylaborlargemanufacturingprocessprocessingproducing
SHARED TOKENS (25): "become", "begins", "commonly", "components", "creation", "design", "economy", "engineering", "equipment", "fabrication", "final", "individual", "industrial", "intermediary", "labor", "large", "manufacturing", "process", "processing", "producing".... | EXACT TITLE in staffing_recruiting: "Manufacturing". | EXACT TITLE in water_rights: "Manufacturing".
0.500
apprenticeshipcertificationcompleteexperiencedlaborlicenseoutsidepermanentplacementpracticeprofessionalregulatedstudysystemtradestrainingworking
SHARED TOKENS (17): "apprenticeship", "certification", "complete", "experienced", "labor", "license", "outside", "permanent", "placement", "practice", "professional", "regulated", "study", "system", "trades", "training", "working". | EXACT TITLE in staffing_recruiting: "Apprenticeship". | EXACT TITLE in water_rights: "Apprenticeship".
0.500
Hydrology ↗ Q42250 EXACT TITLE
civildatadistributionengineeringfieldsmanagementmethodsphysicalplanningpolicyqualityrelatedresearchresourcesstudy
SHARED TOKENS (15): "civil", "data", "distribution", "engineering", "fields", "management", "methods", "physical", "planning", "policy", "quality", "related", "research", "resources", "study". | EXACT TITLE in water_rights: "Hydrology".
0.500
Social work ↗ Q205398 EXACT TITLE
administrationagenciesbecomechangecommunityconductdevelopeddevelopmentdirectlyeducationgovernmentgroupindividualindustriallaborlargerlawmanagementorganizationspolicy
SHARED TOKENS (33): "administration", "agencies", "become", "change", "community", "conduct", "developed", "development", "directly", "education", "government", "group", "individual", "industrial", "labor", "larger", "law", "management", "organizations", "policy".... | EXACT TITLE in staffing_recruiting: "Social work".
0.500
changechangescharacteristicsconditionsconsumerevenincreaseindividuallaborlowermakesmarketneedpreviouslyproductionratereducedrepresentationrequirementsearch
SHARED TOKENS (27): "change", "changes", "characteristics", "conditions", "consumer", "even", "increase", "individual", "labor", "lower", "makes", "market", "need", "previously", "production", "rate", "reduced", "representation", "requirement", "search".... | EXACT TITLE in staffing_recruiting: "Reservation wage".
0.500
ageagenciesbeyondcareercollegecontinuingdevelopmentdifferentdivisiondueeconomiceducationformsfrequentlygeneralgovernmentinstitutionalintendedoperationprofessional
SHARED TOKENS (27): "age", "agencies", "beyond", "career", "college", "continuing", "development", "different", "division", "due", "economic", "education", "forms", "frequently", "general", "government", "institutional", "intended", "operation", "professional".... | EXACT TITLE in staffing_recruiting: "Continuing education". | EXACT TITLE in water_rights: "Continuing education".
0.500
Easement ↗ Q448405 EXACT TITLE
accessamonganotherenteritselflandlawlimitedownedprovidingpublicrealrightsroadstated
SHARED TOKENS (15): "access", "among", "another", "enter", "itself", "land", "law", "limited", "owned", "providing", "public", "real", "rights", "road", "stated". | EXACT TITLE in water_rights: "Easement".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondcharacteristicsclassifiedenvironmentflowformationindustriallandlayermajorpressureregionrelatedsourcestudyunderlying
SHARED TOKENS (16): "beyond", "characteristics", "classified", "environment", "flow", "formation", "industrial", "land", "layer", "major", "pressure", "region", "related", "source", "study", "underlying". | EXACT TITLE in water_rights: "Aquifer".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordingacquiringanotherchaincivilcostsequipmentfacilityfieldsflowfoodinformationmanagementmodeloperationalphysicalplanningpointproductionprofessional
SHARED TOKENS (29): "according", "acquiring", "another", "chain", "civil", "costs", "equipment", "facility", "fields", "flow", "food", "information", "management", "model", "operational", "physical", "planning", "point", "production", "professional".... | EXACT TITLE in staffing_recruiting: "Logistics".
0.500
customerdemandenvironmentinformationinfrastructurelong-termmaintainsmanagementmanagesmodelproviderresponsibilitysectorsystemstechnical
SHARED TOKENS (15): "customer", "demand", "environment", "information", "infrastructure", "long-term", "maintains", "management", "manages", "model", "provider", "responsibility", "sector", "systems", "technical". | EXACT TITLE in staffing_recruiting: "Managed services".
0.500
applyapprenticeshipbarcareercivildifferentdistincteducationevenformlawlegalmajorofficeprofessionalsrequirementstructurestudysystemsthem
SHARED TOKENS (20): "apply", "apprenticeship", "bar", "career", "civil", "different", "distinct", "education", "even", "form", "law", "legal", "major", "office", "professionals", "requirement", "structure", "study", "systems", "them". | EXACT TITLE in staffing_recruiting: "Legal profession".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinessdifferententityestategeneralgovernmentintendedlandlawlegalmeansnonprofitownedownershipprivatepublicrealresourcesstatus
SHARED TOKENS (22): "acquisition", "business", "different", "entity", "estate", "general", "government", "intended", "land", "law", "legal", "means", "nonprofit", "owned", "ownership", "private", "public", "real", "resources", "status".... | EXACT TITLE in staffing_recruiting: "Real estate". | EXACT TITLE in water_rights: "Real estate".
0.500
Water treatment ↗ EXACT TITLE
advancedbecomescomponentsdevelopeddueenergyenvironmentflowincreasedindustrialmaintenancemethodsprocessprocessesqualityreceivingrecreationsupplysystemstreatment
SHARED TOKENS (21): "advanced", "becomes", "components", "developed", "due", "energy", "environment", "flow", "increased", "industrial", "maintenance", "methods", "process", "processes", "quality", "receiving", "recreation", "supply", "systems", "treatment".... | EXACT TITLE in water_rights: "Water treatment".
0.500
Telemetry ↗ Q209867 EXACT TITLE
commonlycontrolcostdatadevicesequipmentinstructionsmechanismsneednetworkoperatephysicalpowerreceivingrequiresystemstransfer
SHARED TOKENS (17): "commonly", "control", "cost", "data", "devices", "equipment", "instructions", "mechanisms", "need", "network", "operate", "physical", "power", "receiving", "require", "systems", "transfer". | EXACT TITLE in water_rights: "Telemetry".
0.500
Snake River ↗ Q272074 EXACT TITLE
ageagenciescanyoncentralconstructioncontrolcreateddevelopedeasteasternidaholargelimitedlowermajornationalnorthwestpolicyprivateprograms
SHARED TOKENS (34): "age", "agencies", "canyon", "central", "construction", "control", "created", "developed", "east", "eastern", "idaho", "large", "limited", "lower", "major", "national", "northwest", "policy", "private", "programs".... | EXACT TITLE in water_rights: "Snake River".
0.500
actavailabilitybusinessescontactdatademandemploymentfewerfirmfirmshighlyidentifiedindividualintermediaryjobsmarketmarketsmoveorganizationsprivate
SHARED TOKENS (29): "act", "availability", "businesses", "contact", "data", "demand", "employment", "fewer", "firm", "firms", "highly", "identified", "individual", "intermediary", "jobs", "market", "markets", "move", "organizations", "private".... | EXACT TITLE in staffing_recruiting: "Executive search".
0.500
additionalapproximatelyboardbodyboisecollegecommunitycomprehensivecountieseasterngovernedidaholargeprogramspublicregionsouthernstudenttechnicaltogether
SHARED TOKENS (22): "additional", "approximately", "board", "body", "boise", "college", "community", "comprehensive", "counties", "eastern", "governed", "idaho", "large", "programs", "public", "region", "southern", "student", "technical", "together".... | EXACT TITLE in staffing_recruiting: "College of Southern Idaho".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscivilcomponentsconstructiondevelopmentengineeringenvironmentequipmentestablishformsgovernmentlandlawlegalownershipplanningprofessionalrequiredresearchthem
SHARED TOKENS (22): "analysis", "civil", "components", "construction", "development", "engineering", "environment", "equipment", "establish", "forms", "government", "land", "law", "legal", "ownership", "planning", "professional", "required", "research", "them".... | EXACT TITLE in water_rights: "Surveying".
0.500
Indeed ↗ Q1045367 EXACT TITLE
additionalallowingapplyassociationsbecomecareercentralcomdirectlyemploymentfirmsindependentjobslistingrecruitsearchsinglesitestaffingvertical
SHARED TOKENS (20): "additional", "allowing", "apply", "associations", "become", "career", "central", "com", "directly", "employment", "firms", "independent", "jobs", "listing", "recruit", "search", "single", "site", "staffing", "vertical". | EXACT TITLE in staffing_recruiting: "Indeed".
0.500
Retail ↗ Q126793 EXACT TITLE
accessagealongsideanalysisbroaderbusinesschaincommonlycorecostscustomerdecisionsdeliverydescribeddesigndirectlyexperiencefinalfirmsinstitutional
SHARED TOKENS (40): "access", "age", "alongside", "analysis", "broader", "business", "chain", "commonly", "core", "costs", "customer", "decisions", "delivery", "described", "design", "directly", "experience", "final", "firms", "institutional".... | EXACT TITLE in staffing_recruiting: "Retail".
0.500
amongboisebusinessclassifiedcollegedivisioneducationengineeringidahoindependentinstitutionprogramprogramspublicreportedresearch
SHARED TOKENS (16): "among", "boise", "business", "classified", "college", "division", "education", "engineering", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research". | EXACT TITLE in water_rights: "Boise State University".
0.500
actaddressaddressingadministeredagencychangescontroldirectlyengineersfederalformgoverninglawmajorownedphysicalprimarilyprotectionprovidingprovisions
SHARED TOKENS (25): "act", "address", "addressing", "administered", "agency", "changes", "control", "directly", "engineers", "federal", "form", "governing", "law", "major", "owned", "physical", "primarily", "protection", "providing", "provisions".... | EXACT TITLE in water_rights: "Clean Water Act".
0.500
affectsbusinesscertificationconsumercreatescustomerdueeconomicentryformfrequentlygeneralgovernmentgrowthindividuallawlicenselicensinglicensuremarket
SHARED TOKENS (39): "affects", "business", "certification", "consumer", "creates", "customer", "due", "economic", "entry", "form", "frequently", "general", "government", "growth", "individual", "law", "license", "licensing", "licensure", "market".... | EXACT TITLE in staffing_recruiting: "Occupational licensing".
0.500
ageamongconditionscostdemanddeterminedifferentdirectlyeconomicemploymentestablishingevenfunctionsgovernmentincreaseincreasesindividuallaborlowermarket
SHARED TOKENS (29): "age", "among", "conditions", "cost", "demand", "determine", "different", "directly", "economic", "employment", "establishing", "even", "functions", "government", "increase", "increases", "individual", "labor", "lower", "market".... | EXACT TITLE in staffing_recruiting: "Minimum wage".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddevicesdirectlydistributionduefieldsflowformgrowthinstallation
SHARED TOKENS (42): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "devices", "directly", "distribution", "due", "fields", "flow", "form", "growth", "installation".... | EXACT TITLE in water_rights: "Irrigation".
0.500
becomecareerclassroomcompletioncreatesdevelopeddocumentsemployeeenvironmentequipmentexperienceexperiencedformgrowthhighlyindividualinstructionsmanagemanagementparticipants
SHARED TOKENS (29): "become", "career", "classroom", "completion", "creates", "developed", "documents", "employee", "environment", "equipment", "experience", "experienced", "form", "growth", "highly", "individual", "instructions", "manage", "management", "participants".... | EXACT TITLE in staffing_recruiting: "On-the-job training".
0.500
contractorscontroldescribedenvironmentequipmentevaluationmanageobjectivespressureprocessproducedproducingprofileregulatedrequiredsearchthroughout
SHARED TOKENS (17): "contractors", "control", "described", "environment", "equipment", "evaluation", "manage", "objectives", "pressure", "process", "produced", "producing", "profile", "regulated", "required", "search", "throughout". | EXACT TITLE in water_rights: "Well drilling".
0.500
Agriculture ↗ Q11451 EXACT TITLE
agriculturalagricultureapproximatelybroaderbusinesseschangecreateddirectfewerfoodincreasedindependentlyindustriallandlargelargermajorpracticepracticesproduction
SHARED TOKENS (23): "agricultural", "agriculture", "approximately", "broader", "businesses", "change", "created", "direct", "fewer", "food", "increased", "independently", "industrial", "land", "large", "larger", "major", "practice", "practices", "production".... | EXACT TITLE in staffing_recruiting: "Agriculture". | EXACT TITLE in water_rights: "Agriculture".
0.500
Franchising ↗ Q171947 EXACT TITLE
anotherbusinesscapitalchaincircumstancesconditionscorporatedirecteconomicentityexpansionfeesgrowthhighlyindividuallargelegallicenseslicensingmarket
SHARED TOKENS (33): "another", "business", "capital", "chain", "circumstances", "conditions", "corporate", "direct", "economic", "entity", "expansion", "fees", "growth", "highly", "individual", "large", "legal", "licenses", "licensing", "market".... | EXACT TITLE in staffing_recruiting: "Franchising".
0.500
actapplicationbecomesdueenterexpresslyflowgenerallyincreasesneedpointqualityrequirementsreturnrisksupplieduses
SHARED TOKENS (17): "act", "application", "becomes", "due", "enter", "expressly", "flow", "generally", "increases", "need", "point", "quality", "requirements", "return", "risk", "supplied", "uses". | EXACT TITLE in water_rights: "Return flow".
0.500
actagricultureapproximatelyboardboisebureaucapacitycompletedcompletionconstructiondesignexperiencedidahoincreasedlaborlawnationaloperatedpowerprojects
SHARED TOKENS (28): "act", "agriculture", "approximately", "board", "boise", "bureau", "capacity", "completed", "completion", "construction", "design", "experienced", "idaho", "increased", "labor", "law", "national", "operated", "power", "projects".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
adaboardboisecanyoncareercollegecommunitycomprehensivecountiescwidevelopmenteasterneducationgovernedidaholargenampapopulationprogramspublic
SHARED TOKENS (31): "ada", "board", "boise", "canyon", "career", "college", "community", "comprehensive", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public".... | EXACT TITLE in staffing_recruiting: "College of Western Idaho". | EXACT TITLE in water_rights: "College of Western Idaho".
0.500
agriculturecapitalcommunitycostcostsdifferentenergyinstitutionallargelargerpersonnelpolicypracticepressureprimarilyproviderspublicqualityresponsibilityseparate
SHARED TOKENS (25): "agriculture", "capital", "community", "cost", "costs", "different", "energy", "institutional", "large", "larger", "personnel", "policy", "practice", "pressure", "primarily", "providers", "public", "quality", "responsibility", "separate".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectsagencyapplicationsclassifiedcontainingdeterminedevicesessentialformformsgrouplargerproductionproposedprotectionresearchriskrolesemiconductorsites
SHARED TOKENS (21): "affects", "agency", "applications", "classified", "containing", "determine", "devices", "essential", "form", "forms", "group", "larger", "production", "proposed", "protection", "research", "risk", "role", "semiconductor", "sites".... | EXACT TITLE in water_rights: "Arsenic".
0.480
alongsidecontainsenergyformindustriallandlargemajorpermanentproducedrecreationreportstreatmentuses
SHARED TOKENS (14): "alongside", "contains", "energy", "form", "industrial", "land", "large", "major", "permanent", "produced", "recreation", "reports", "treatment", "uses". | EXACT TITLE in water_rights: "Surface water".
0.480
associatedbuildingconstructiondesigndevelopmentdomesticeconomicfacilitiesindustrialinfrastructuremaintenanceplanningprocesswork
SHARED TOKENS (14): "associated", "building", "construction", "design", "development", "domestic", "economic", "facilities", "industrial", "infrastructure", "maintenance", "planning", "process", "work". | EXACT TITLE in staffing_recruiting: "Construction". | EXACT TITLE in water_rights: "Construction".
0.480
advancedapprenticeshipassociationsconnectsdepartmentinstructionlabororganizationspaidprogramprovidereflectsregisteredworkers
SHARED TOKENS (14): "advanced", "apprenticeship", "associations", "connects", "department", "instruction", "labor", "organizations", "paid", "program", "provide", "reflects", "registered", "workers". | EXACT TITLE in staffing_recruiting: "Registered apprenticeship". | EXACT TITLE in water_rights: "Registered apprenticeship".
0.480
accordingbureaucontractorsemploymentformindependentlaborlimitedrelationshipstaffingtemporaryworkworkersworkforce
SHARED TOKENS (14): "according", "bureau", "contractors", "employment", "form", "independent", "labor", "limited", "relationship", "staffing", "temporary", "work", "workers", "workforce". | EXACT TITLE in staffing_recruiting: "Contingent work".
0.480
MODFLOW ↗ Q6716996 EXACT TITLE
beyondboundarycodeconditionsdefinedevelopedflowmodeloperatingprimarilyprogrampublicsourcesystems
SHARED TOKENS (14): "beyond", "boundary", "code", "conditions", "define", "developed", "flow", "model", "operating", "primarily", "program", "public", "source", "systems". | EXACT TITLE in water_rights: "MODFLOW".
0.480
accountingacquisitionaggregationbusinessconsolidatedconsolidationcontextentitiesentitygrouplargertogethertransfertreatment
SHARED TOKENS (14): "accounting", "acquisition", "aggregation", "business", "consolidated", "consolidation", "context", "entities", "entity", "group", "larger", "together", "transfer", "treatment". | EXACT TITLE in staffing_recruiting: "Consolidation (business)". | EXACT TITLE in water_rights: "Consolidation (business)".
0.480
amongappliesclaimcompletecomprehensivedatabaseeducationemploymentindividualmethodsprocessrecordsearchverify
SHARED TOKENS (14): "among", "applies", "claim", "complete", "comprehensive", "database", "education", "employment", "individual", "methods", "process", "record", "search", "verify". | EXACT TITLE in staffing_recruiting: "Background check".
0.480
Overtime ↗ Q667022 EXACT TITLE
accountbeyondeconomyemploymentevenlawnationalpracticesraterequiresupplyworkworkersworking
SHARED TOKENS (14): "account", "beyond", "economy", "employment", "even", "law", "national", "practices", "rate", "require", "supply", "work", "workers", "working". | EXACT TITLE in staffing_recruiting: "Overtime".
0.460
ageanotherchaincurrentdifferentenergyevenformsmakingprocessratesinglethough
SHARED TOKENS (13): "age", "another", "chain", "current", "different", "energy", "even", "forms", "making", "process", "rate", "single", "though". | EXACT TITLE in water_rights: "Radionuclide".
0.460
agricultureboisebureaucivilcountieseastengineeringengineersidahonationaloperatedprovidewestern
SHARED TOKENS (13): "agriculture", "boise", "bureau", "civil", "counties", "east", "engineering", "engineers", "idaho", "national", "operated", "provide", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.460
collegecommunitydifferenteducationeducationalformgenerallyinstitutioninstitutionspolicyprogramstransferworkforce
SHARED TOKENS (13): "college", "community", "different", "education", "educational", "form", "generally", "institution", "institutions", "policy", "programs", "transfer", "workforce". | EXACT TITLE in staffing_recruiting: "Community college".
0.440
Ditch ↗ Q2048319 EXACT TITLE
alongsidecommonlyconditionscreatedeasternfieldsmajorproviderequiredsourcethemwhose
SHARED TOKENS (12): "alongside", "commonly", "conditions", "created", "eastern", "fields", "major", "provide", "required", "source", "them", "whose". | EXACT TITLE in water_rights: "Ditch".
0.440
anotherbodycommonlyengineeringlandpermanentplacespointrathersinglesystemthough
SHARED TOKENS (12): "another", "body", "commonly", "engineering", "land", "permanent", "places", "point", "rather", "single", "system", "though". | EXACT TITLE in water_rights: "Drainage basin".
0.440
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlylandlargemajorpopulationreducerelatedtreatment
SHARED TOKENS (12): "become", "create", "demand", "developed", "directly", "land", "large", "major", "population", "reduce", "related", "treatment". | EXACT TITLE in water_rights: "Stormwater".
0.440
adaboisebureaucanyoncompletedcountiesengineersidahooperatedtreasurevalleywestern
SHARED TOKENS (12): "ada", "boise", "bureau", "canyon", "completed", "counties", "engineers", "idaho", "operated", "treasure", "valley", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.440
assessmentcharacteristicscompliancecontactfrequentlygenerallyphysicalqualitysafetystandardssupplytreatment
SHARED TOKENS (12): "assessment", "characteristics", "compliance", "contact", "frequently", "generally", "physical", "quality", "safety", "standards", "supply", "treatment". | EXACT TITLE in water_rights: "Water quality".
0.440
applicationapplicationsapproximatelycapacitycontainsdirectenergyevenformationheatingsourcetarget
SHARED TOKENS (12): "application", "applications", "approximately", "capacity", "contains", "direct", "energy", "even", "formation", "heating", "source", "target". | EXACT TITLE in water_rights: "Geothermal heating".
0.440
Aerospace ↗ Q2876213 EXACT TITLE
accordingapplicationsbodydesignengineeringindustrialoperateorganizationsphysicalproposedresearchspace
SHARED TOKENS (12): "according", "applications", "body", "design", "engineering", "industrial", "operate", "organizations", "physical", "proposed", "research", "space". | EXACT TITLE in staffing_recruiting: "Aerospace".
0.430
Spherion ↗ Q7389970 EXACT TITLE
agencyoperatestemporarywork
SHARED TOKENS (4): "agency", "operates", "temporary", "work". | URL->A (1): https://www.spherion.com/. | EXACT TITLE in staffing_recruiting: "Spherion".
0.420
ageconditionsdependsdirectlyfoodformmajorphysicalrequiredsuppliedwork
SHARED TOKENS (11): "age", "conditions", "depends", "directly", "food", "form", "major", "physical", "required", "supplied", "work". | EXACT TITLE in water_rights: "Drinking water".
0.420
Employment ↗ Q656365 EXACT TITLE
conditionsemployeeemploymententitypaidpowerraterelationshipreturnsectorwork
SHARED TOKENS (11): "conditions", "employee", "employment", "entity", "paid", "power", "rate", "relationship", "return", "sector", "work". | EXACT TITLE in staffing_recruiting: "Employment". | EXACT TITLE in water_rights: "Employment".
0.420
agencyboisedepartmentfederalgovernmentidahomaintainedqualityregionalregulationsresponsible
SHARED TOKENS (11): "agency", "boise", "department", "federal", "government", "idaho", "maintained", "quality", "regional", "regulations", "responsible". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.420
administrationagencyassociateddepartmenteconomicfederalmanagesnationalofficeresourcesresponsible
SHARED TOKENS (11): "administration", "agency", "associated", "department", "economic", "federal", "manages", "national", "office", "resources", "responsible". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.420
Snowpack ↗ Q18575846 EXACT TITLE
agriculturechangeclassificationconditionscontextcoverdifferentformationphysicalprovidestudy
SHARED TOKENS (11): "agriculture", "change", "classification", "conditions", "context", "cover", "different", "formation", "physical", "provide", "study". | EXACT TITLE in water_rights: "Snowpack".
0.400
agriculturalapproximatelychangeflowindustrialproducedresourcessourcesouthsupply
SHARED TOKENS (10): "agricultural", "approximately", "change", "flow", "industrial", "produced", "resources", "source", "south", "supply". | EXACT TITLE in water_rights: "Water resources".
0.400
businesscustomerdevelopedlargemarketnetrateresearchreviewsingle
SHARED TOKENS (10): "business", "customer", "developed", "large", "market", "net", "rate", "research", "review", "single". | EXACT TITLE in staffing_recruiting: "Net promoter score".
0.400
accessanotherdescribingestateevenlegalrightsthoughtitleunderlying
SHARED TOKENS (10): "access", "another", "describing", "estate", "even", "legal", "rights", "though", "title", "underlying". | EXACT TITLE in water_rights: "Beneficial use".
0.400
approximatelyboisedataevengovernmentidaholowerpopulationsinglesouth
SHARED TOKENS (10): "approximately", "boise", "data", "even", "government", "idaho", "lower", "population", "single", "south". | EXACT TITLE in water_rights: "Idaho Legislature".
0.400
adaapproximatelyboisecanyoncapacityidahosystemtreasurevalleywestern
SHARED TOKENS (10): "ada", "approximately", "boise", "canyon", "capacity", "idaho", "system", "treasure", "valley", "western". | EXACT TITLE in water_rights: "New York Canal".
0.400
formgenerallygovernmentincreasinglyorganizationsownershippolicyqualitysingleworkforce
SHARED TOKENS (10): "form", "generally", "government", "increasingly", "organizations", "ownership", "policy", "quality", "single", "workforce". | EXACT TITLE in staffing_recruiting: "Workforce housing".
0.400
Recruitment ↗ Q899277 EXACT TITLE
agenciesemploymentidentifyingjobsmanagerspermanentprocessrecruitmentsearchtemporary
SHARED TOKENS (10): "agencies", "employment", "identifying", "jobs", "managers", "permanent", "process", "recruitment", "search", "temporary". | EXACT TITLE in staffing_recruiting: "Recruitment". | EXACT TITLE in water_rights: "Recruitment".
0.400
Onboarding ↗ Q7091744 EXACT TITLE
becomedocumentedeffectiveemployeemanagementoccupationaloperationsprocesstrainingworkers
SHARED TOKENS (10): "become", "documented", "effective", "employee", "management", "occupational", "operations", "process", "training", "workers". | EXACT TITLE in staffing_recruiting: "Onboarding".
0.400
administrativeagencydecisionsdepartmentidahoindustriallaborresponsiblesystemworkers
SHARED TOKENS (10): "administrative", "agency", "decisions", "department", "idaho", "industrial", "labor", "responsible", "system", "workers". | EXACT TITLE in staffing_recruiting: "Idaho Industrial Commission".
0.380
Workforce ↗ Q13440398 EXACT TITLE
cannotemploymentpoolpopulationratestatedworkworkforceworking
SHARED TOKENS (9): "cannot", "employment", "pool", "population", "rate", "stated", "work", "workforce", "working". | EXACT TITLE in staffing_recruiting: "Workforce". | EXACT TITLE in water_rights: "Workforce".
0.380
directlydueindustrialinfrastructureseparateservingsystemsystemstreatment
SHARED TOKENS (9): "directly", "due", "industrial", "infrastructure", "separate", "serving", "system", "systems", "treatment". | EXACT TITLE in water_rights: "Sanitary sewer".
0.360
collegecommunitycountiesedgepublictreasurevalleywestern
SHARED TOKENS (8): "college", "community", "counties", "edge", "public", "treasure", "valley", "western". | EXACT TITLE in staffing_recruiting: "Treasure Valley Community College".
0.340
Reservoir ↗ Q131681 EXACT TITLE
bodybuildingcreatedformpowerretainingspace
SHARED TOKENS (7): "body", "building", "created", "form", "power", "retaining", "space". | EXACT TITLE in water_rights: "Reservoir".
0.340
evaluatedlegalobligationsprocessprocessesrightsshows
SHARED TOKENS (7): "evaluated", "legal", "obligations", "process", "processes", "rights", "shows". | EXACT TITLE in water_rights: "Adjudication".
0.340
actagenciesagencybusinessesdevelopedemploymentprivate
SHARED TOKENS (7): "act", "agencies", "agency", "businesses", "developed", "employment", "private". | EXACT TITLE in staffing_recruiting: "Employment agency".
0.340
Sugar beet ↗ Q151964 EXACT TITLE
classifiedcontainsgroupproducedproductiontogetherwhose
SHARED TOKENS (7): "classified", "contains", "group", "produced", "production", "together", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.340
differentgenerallylawlegalphysicalsourcesystems
SHARED TOKENS (7): "different", "generally", "law", "legal", "physical", "source", "systems". | EXACT TITLE in water_rights: "Water right".
0.340
capacitydeliveryfeepracticereturnrightstransfers
SHARED TOKENS (7): "capacity", "delivery", "fee", "practice", "return", "rights", "transfers". | EXACT TITLE in water_rights: "Water banking".
0.320
agriculturebuildingdevelopmentestatelandreal
SHARED TOKENS (6): "agriculture", "building", "development", "estate", "land", "real". | EXACT TITLE in water_rights: "Land development".
0.320
Adecco ↗ Q353494 EXACT TITLE
firmgroupproviderresourcesstaffingtemporary
SHARED TOKENS (6): "firm", "group", "provider", "resources", "staffing", "temporary". | EXACT TITLE in staffing_recruiting: "Adecco".
0.320
Unemployment ↗ Q41171 EXACT TITLE
ageemploymentpaidrateratherwork
SHARED TOKENS (6): "age", "employment", "paid", "rate", "rather", "work". | EXACT TITLE in staffing_recruiting: "Unemployment".
0.320
businesscapitaleconomyresourcessectorworkforce
SHARED TOKENS (6): "business", "capital", "economy", "resources", "sector", "workforce". | EXACT TITLE in staffing_recruiting: "Human resources".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboisehighlyidahowestern
SHARED TOKENS (6): "agricultural", "approximately", "boise", "highly", "idaho", "western". | EXACT TITLE in water_rights: "Boise River".
0.300
amongassessmentassociatedautomatedbusinessconditionscurrentcustomerdatadefiningdetermineemployeegovernmenthistoricalindividuallargelawmanufacturingmarketingmodeling
SHARED TOKENS (25): "among", "assessment", "associated", "automated", "business", "conditions", "current", "customer", "data", "defining", "determine", "employee", "government", "historical", "individual", "large", "law", "manufacturing", "marketing", "modeling"....
0.300
accordingconsumerdesigndevelopmentdevicesfabricationgrowthindependentlyinstrumentslawmakingmarketpowerproducingproductionrapidrecordresearchsemiconductorsingle
SHARED TOKENS (20): "according", "consumer", "design", "development", "devices", "fabrication", "growth", "independently", "instruments", "law", "making", "market", "power", "producing", "production", "rapid", "record", "research", "semiconductor", "single".
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalagriculturecreatedfieldsformhistoricalimportancemaintainedmanagementmethodsoperatedpracticeregionsouthernsystemsthroughout
SHARED TOKENS (16): "agricultural", "agriculture", "created", "fields", "form", "historical", "importance", "maintained", "management", "methods", "operated", "practice", "region", "southern", "systems", "throughout".
0.300
administrationautomatedbusinessdatadatabasesdecisionseconomiceducationeducationalemploymentlawlegalprocessprocessingpublicrequiringsystemstechnical
SHARED TOKENS (18): "administration", "automated", "business", "data", "databases", "decisions", "economic", "education", "educational", "employment", "law", "legal", "process", "processing", "public", "requiring", "systems", "technical".
0.300
additionalagecharacteristicscreateemploymentfederalformgroupidentityintendedlawlocalnationaloccupationalphysicalprotectedresponsibilitiesstatustreatment
SHARED TOKENS (19): "additional", "age", "characteristics", "create", "employment", "federal", "form", "group", "identity", "intended", "law", "local", "national", "occupational", "physical", "protected", "responsibilities", "status", "treatment".
0.300
capacityflowlandmajorrecord
SHARED TOKENS (5): "capacity", "flow", "land", "major", "record". | EXACT TITLE in water_rights: "Streamflow".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcorecostsdescribeddevelopmentdueenvironmentexpansionformgeographicgrowthhighlyincreasedindustrialinfrastructurejobsland
SHARED TOKENS (30): "agency", "associated", "become", "building", "core", "costs", "described", "development", "due", "environment", "expansion", "form", "geographic", "growth", "highly", "increased", "industrial", "infrastructure", "jobs", "land"....
0.300
actaffectageagenciesanotherapplicationbusinesscharacteristicscivilclaimscreatecreatingdemonstratesemploymentevenfederalgovernmentgrouplawnational
SHARED TOKENS (37): "act", "affect", "age", "agencies", "another", "application", "business", "characteristics", "civil", "claims", "create", "creating", "demonstrates", "employment", "even", "federal", "government", "group", "law", "national"....
0.300
analysisanotherapplicationsbodybroaderbusinesscoordinatesdatadatabaseengineeringessentialgeographicindexinformationinstitutionalmanagemanagementmethodsoperationsorganizations
SHARED TOKENS (32): "analysis", "another", "applications", "body", "broader", "business", "coordinates", "data", "database", "engineering", "essential", "geographic", "index", "information", "institutional", "manage", "management", "methods", "operations", "organizations"....
0.300
Job interview ↗ Q850171 KW CROSS HIGH
accordingaccurateapplicationsbeginscareercorporatecostsemployeeevaluationidentifyingincreasinglymethodsrequirementsresearchresourcesstafftools
SHARED TOKENS (17): "according", "accurate", "applications", "begins", "career", "corporate", "costs", "employee", "evaluation", "identifying", "increasingly", "methods", "requirements", "research", "resources", "staff", "tools".
0.300
characteristicsconstructioncontractscustomerdocumenteducationemploymentengineeringfieldsfunctionindividualinstitutionsmanufacturingprocurementpublicrelatedrequiredsimply
SHARED TOKENS (18): "characteristics", "construction", "contracts", "customer", "document", "education", "employment", "engineering", "fields", "function", "individual", "institutions", "manufacturing", "procurement", "public", "related", "required", "simply".
0.300
addressingaffectbecomebusinessescodecreateemploymentenvironmentformgeneralgenerallyidentityisolatedlegalorganizationsphysicalprimarilyprivateprofessionalprohibit
SHARED TOKENS (23): "addressing", "affect", "become", "businesses", "code", "create", "employment", "environment", "form", "general", "generally", "identity", "isolated", "legal", "organizations", "physical", "primarily", "private", "professional", "prohibit"....
0.300
advancedapplicationsautomatedcentralcomponentscontrolcreatecreateddevicesenvironmentequipmentfabricationfacilitieshighlyindividualindustrialinsidelargemanufacturingneed
SHARED TOKENS (30): "advanced", "applications", "automated", "central", "components", "control", "create", "created", "devices", "environment", "equipment", "fabrication", "facilities", "highly", "individual", "industrial", "inside", "large", "manufacturing", "need"....
0.300
actapplicationauthoritybillcivildifferentemploymentfinallaborlaterlawnationalpowerprincipallyproposedprotectionpublicregulaterequirementsrights
SHARED TOKENS (22): "act", "application", "authority", "bill", "civil", "different", "employment", "final", "labor", "later", "law", "national", "power", "principally", "proposed", "protection", "public", "regulate", "requirements", "rights"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothercivildevelopedeconomicgenerallygoverninggovernsinteractjurisdictionlandlawlegalmajorownershipprivatepublicrealrelationshipsrights
SHARED TOKENS (23): "acquisition", "another", "civil", "developed", "economic", "generally", "governing", "governs", "interact", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "public", "real", "relationships", "rights"....
0.300
adaaddsboisecanyoncommonlycountiesidaholargermeridianmetropolitannampanorthwestpopulationsectiontreasurevalley
SHARED TOKENS (16): "ada", "adds", "boise", "canyon", "commonly", "counties", "idaho", "larger", "meridian", "metropolitan", "nampa", "northwest", "population", "section", "treasure", "valley".
0.300
advancedagriculturalagriculturebusinessescostcostsdirectdistributioneastfieldsimportanceindustrialmanagementmunicipalpracticeprocessreduceregionremainrequire
SHARED TOKENS (26): "advanced", "agricultural", "agriculture", "businesses", "cost", "costs", "direct", "distribution", "east", "fields", "importance", "industrial", "management", "municipal", "practice", "process", "reduce", "region", "remain", "require"....
0.300
actadministeredagenciesauthoritycodecomprehensiveconsequencedescribeddevelopmentdifferentdirectseconomicfederalgrowthlawmeansmechanismsnationalpointprovisions
SHARED TOKENS (27): "act", "administered", "agencies", "authority", "code", "comprehensive", "consequence", "described", "development", "different", "directs", "economic", "federal", "growth", "law", "means", "mechanisms", "national", "point", "provisions"....
0.300
beyondcivilcommunitycredentialdevelopmenteducationeducationalforminstitutioninstitutionsitselflargeorganizationsreflectsrelatedreportresponsibilitytrainingworkworkers
SHARED TOKENS (20): "beyond", "civil", "community", "credential", "development", "education", "educational", "form", "institution", "institutions", "itself", "large", "organizations", "reflects", "related", "report", "responsibility", "training", "work", "workers".
0.300
administrationadministrativeagenciesanotherchangescivilcontrolcreateddecisionsdivisioneconomiceducationenvironmentgenerallygoverninggovernmentimportanceincreaseitselflaw
SHARED TOKENS (32): "administration", "administrative", "agencies", "another", "changes", "civil", "control", "created", "decisions", "division", "economic", "education", "environment", "generally", "governing", "government", "importance", "increase", "itself", "law"....
0.300
accountadditionalagricultureboisechangechangesdatadescribeddifferentdueexperiencegeneralgenerallyidahoincreaseincreasedincreasesmakesmodelnampa
SHARED TOKENS (26): "account", "additional", "agriculture", "boise", "change", "changes", "data", "described", "different", "due", "experience", "general", "generally", "idaho", "increase", "increased", "increases", "makes", "model", "nampa"....
0.300
additionalapplicationcareercommonlycompletedescribingdetailsdifferentdocumentseducationeducationalemploymentevenexperienceinformationpageprocessesprogramsprovidepublications
SHARED TOKENS (25): "additional", "application", "career", "commonly", "complete", "describing", "details", "different", "documents", "education", "educational", "employment", "even", "experience", "information", "page", "processes", "programs", "provide", "publications"....
0.300
actappliescivildirectformgroupindividuallaborlawmeansprotectedrightsruleshowntitletreatmentunlawful
SHARED TOKENS (17): "act", "applies", "civil", "direct", "form", "group", "individual", "labor", "law", "means", "protected", "rights", "rule", "shown", "title", "treatment", "unlawful".
0.300
actadministrativeagencyauthorityboardbodydecisionsfederalgeneralgovernedgovernmentindependentlaborlawnationalpracticesprotectedregionalrepresentationthroughout
SHARED TOKENS (20): "act", "administrative", "agency", "authority", "board", "body", "decisions", "federal", "general", "governed", "government", "independent", "labor", "law", "national", "practices", "protected", "regional", "representation", "throughout".
0.300
actchaincostscreatingdevelopmentdivisiondomesticdueequipmentfederaljobslawlimitedmanufacturingofficialprojectsprovisionspublicreceivingresearch
SHARED TOKENS (30): "act", "chain", "costs", "creating", "development", "division", "domestic", "due", "equipment", "federal", "jobs", "law", "limited", "manufacturing", "official", "projects", "provisions", "public", "receiving", "research"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
accessaccordingadditionalaffectconditionscostsdecisionsdevelopmenteconomiceconomyfacilitiesfieldsgeneralinformationmaintenancemeansoccupationalorganizationspaidphysical
SHARED TOKENS (33): "access", "according", "additional", "affect", "conditions", "costs", "decisions", "development", "economic", "economy", "facilities", "fields", "general", "information", "maintenance", "means", "occupational", "organizations", "paid", "physical"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturebodycontrolsdescribingdevelopmentenvironmentgeneralgrowthincreasedindustrialpointprocessprogramreducesource
SHARED TOKENS (15): "agriculture", "body", "controls", "describing", "development", "environment", "general", "growth", "increased", "industrial", "point", "process", "program", "reduce", "source".
0.300
careercollegecommunityeconomiceducationeducationalformsgeneralhighlyindividualinstitutionmethodsproviderelatedschoolsspecializedtechnicaltrainingunderlying
SHARED TOKENS (19): "career", "college", "community", "economic", "education", "educational", "forms", "general", "highly", "individual", "institution", "methods", "provide", "related", "schools", "specialized", "technical", "training", "underlying".
0.300
Right of way ↗ KW CROSS HIGH
authoritycreateddifferentestatefacilitygovernmentlandlegallocaloperateownershipphysicalprivaterealretainrightsroadsimplystatusthem
SHARED TOKENS (21): "authority", "created", "different", "estate", "facility", "government", "land", "legal", "local", "operate", "ownership", "physical", "private", "real", "retain", "rights", "road", "simply", "status", "them"....
0.300
accessaddressaddressingalreadyamongbusinessescapacitychangescommunitydevelopmenteconomiceducationevaluatedformformsgovernmenthistoricallyincreasejobsneed
SHARED TOKENS (38): "access", "address", "addressing", "already", "among", "businesses", "capacity", "changes", "community", "development", "economic", "education", "evaluated", "form", "forms", "government", "historically", "increase", "jobs", "need"....
0.300
agenciesbusinessdevelopmenteconomiceligibleentitiesfederalgenerallyinfrastructurelocalmunicipaloperationsprincipallyprivateregulatoryretainutilities
SHARED TOKENS (17): "agencies", "business", "development", "economic", "eligible", "entities", "federal", "generally", "infrastructure", "local", "municipal", "operations", "principally", "private", "regulatory", "retain", "utilities".
0.300
accordingcommunitydescribesdevelopmenteconomicfrequentlygrowthhistoricallyincreasesincreasinglyindividualinfrastructurelocalmarketobjectivespolicyprocessqualityregion
SHARED TOKENS (19): "according", "community", "describes", "development", "economic", "frequently", "growth", "historically", "increases", "increasingly", "individual", "infrastructure", "local", "market", "objectives", "policy", "process", "quality", "region".
0.300
actadministrationcodeconditionscreatedenvironmentfederalgoverninggovernmentlaborlawnationaloccupationalprivateprovidesafetysectortitle
SHARED TOKENS (18): "act", "administration", "code", "conditions", "created", "environment", "federal", "governing", "government", "labor", "law", "national", "occupational", "private", "provide", "safety", "sector", "title".
0.300
actallowingcentralcivilclaimconcerningemployeeemploymentestablishexceptionsgeneralgovernmentjobslaborlawlegalmarketspowerpracticeprotection
SHARED TOKENS (30): "act", "allowing", "central", "civil", "claim", "concerning", "employee", "employment", "establish", "exceptions", "general", "government", "jobs", "labor", "law", "legal", "markets", "power", "practice", "protection"....
0.300
affectsagriculturalagriculturebecomebodybuildingchangesconstructioncontroldifferentflowgenerallylandlargelocalmakingmanagementoperationspointprincipal
SHARED TOKENS (27): "affects", "agricultural", "agriculture", "become", "body", "building", "changes", "construction", "control", "different", "flow", "generally", "land", "large", "local", "making", "management", "operations", "point", "principal"....
0.300
actassociatedauthorizationdevelopmentdivisionengineersindexinfrastructurenationalnetpdfprotectionpublicrequirementsresources
SHARED TOKENS (15): "act", "associated", "authorization", "development", "division", "engineers", "index", "infrastructure", "national", "net", "pdf", "protection", "public", "requirements", "resources".
0.300
additionalcomponentsconnectionsdistributionfacilitiesflowgenerallyindustrialinstitutionlocallyneednetworkpointpressureprivateprovideprovidingpublicratherseparate
SHARED TOKENS (24): "additional", "components", "connections", "distribution", "facilities", "flow", "generally", "industrial", "institution", "locally", "need", "network", "point", "pressure", "private", "provide", "providing", "public", "rather", "separate"....
0.300
amongapproximatelyboisebureaucanyoncapacitycompletedcontainscountiescreatedcreatesdirectlyeastedgefederalformationidaholocallowernampa
SHARED TOKENS (30): "among", "approximately", "boise", "bureau", "canyon", "capacity", "completed", "contains", "counties", "created", "creates", "directly", "east", "edge", "federal", "formation", "idaho", "local", "lower", "nampa"....
0.300
Aquifer test ↗ Q446124 KW CROSS HIGH
applychangecharacteristicsdataengineeringflowincreasemodelpointprimarilyrealresponsesimplysystemtesting
SHARED TOKENS (15): "apply", "change", "characteristics", "data", "engineering", "flow", "increase", "model", "point", "primarily", "real", "response", "simply", "system", "testing".
0.300
analysisassessmentbroaderbuildingchangechangescontroldescribingdueeffectiveengineeringincreaseincreasedindividualinfrastructuremanagemanagementmeasuresmethodspractice
SHARED TOKENS (28): "analysis", "assessment", "broader", "building", "change", "changes", "control", "describing", "due", "effective", "engineering", "increase", "increased", "individual", "infrastructure", "manage", "management", "measures", "methods", "practice"....
0.300
applicationclaimdataeliminategrowthjobsneedprocessrecruitrecruitmentremainsubjectthroughoutworkworkers
SHARED TOKENS (15): "application", "claim", "data", "eliminate", "growth", "jobs", "need", "process", "recruit", "recruitment", "remain", "subject", "throughout", "work", "workers".
0.300
agecapitalchangedecisionsdemanddifferenteconomiceducationfirmsformslabormarketsownershipproductionpublicstudysupplyworkers
SHARED TOKENS (18): "age", "capital", "change", "decisions", "demand", "different", "economic", "education", "firms", "forms", "labor", "markets", "ownership", "production", "public", "study", "supply", "workers".
0.300
acquisitionacquisitionsactanotherassetsbusinesscapitalcentralconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesentityfederalgoverned
SHARED TOKENS (39): "acquisition", "acquisitions", "act", "another", "assets", "business", "capital", "central", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "entity", "federal", "governed"....
0.300
addressingappliescivilconstructioncontrolcreatedesignengineeringengineersenvironmentindustriallawlicensinglocalmanagementmunicipalprofessionalprojectsproposedpublic
SHARED TOKENS (28): "addressing", "applies", "civil", "construction", "control", "create", "design", "engineering", "engineers", "environment", "industrial", "law", "licensing", "local", "management", "municipal", "professional", "projects", "proposed", "public"....
0.300
actanalysisanotherapplicationauthoritybecomecannotchangecreatedatadecisionsdescribesdesigndifferentdueenterevenformsfunctiongeneral
SHARED TOKENS (41): "act", "analysis", "another", "application", "authority", "become", "cannot", "change", "create", "data", "decisions", "describes", "design", "different", "due", "enter", "even", "forms", "function", "general"....
0.300
analysiscivilcoredesigndevelopmentdeviceselectricalengineeringengineersequipmentheatingindustrialmanagementmanufacturingmechanismsphysicalrequiresstudysystemstools
SHARED TOKENS (21): "analysis", "civil", "core", "design", "development", "devices", "electrical", "engineering", "engineers", "equipment", "heating", "industrial", "management", "manufacturing", "mechanisms", "physical", "requires", "study", "systems", "tools"....
0.300
actaddressingamongdecisionsdepartmentdivisioneconomicemployeegroupidentifiedindividualleadershipmeasuresorganizationspaidraterequireresourcestransfersworkers
SHARED TOKENS (21): "act", "addressing", "among", "decisions", "department", "division", "economic", "employee", "group", "identified", "individual", "leadership", "measures", "organizations", "paid", "rate", "require", "resources", "transfers", "workers"....
0.300
applicationautomatedcreatingcustomerdatabasesjobsmanagementmanagerspracticeprocessesprovidingrankingrecruitmentrelationshipsearchsupportsystem
SHARED TOKENS (17): "application", "automated", "creating", "customer", "databases", "jobs", "management", "managers", "practice", "processes", "providing", "ranking", "recruitment", "relationship", "search", "support", "system".
0.300
agencyapprovedassessmentdepartmenteducationemployeeenergyengineersestablishingfederalgovernmentindependentinformationlegallocalmattersmeasuresnationaloperationprograms
SHARED TOKENS (27): "agency", "approved", "assessment", "department", "education", "employee", "energy", "engineers", "establishing", "federal", "government", "independent", "information", "legal", "local", "matters", "measures", "national", "operation", "programs"....
0.300
buildingconstructioncontainscontrolcontrolledcostcreatecriticaldeliverydeviceselectricaleliminateenvironmentequipmentevenfabricationitselfmanufacturingmodeloffice
SHARED TOKENS (34): "building", "construction", "contains", "control", "controlled", "cost", "create", "critical", "delivery", "devices", "electrical", "eliminate", "environment", "equipment", "even", "fabrication", "itself", "manufacturing", "model", "office"....
0.300
agriculturecapacitycentralchangechangesconditionscontextcurrentdemanddevelopmentdifferentdueeconomicexpandingexpansionexperienceflowfunctionincreaseinformation
SHARED TOKENS (35): "agriculture", "capacity", "central", "change", "changes", "conditions", "context", "current", "demand", "development", "different", "due", "economic", "expanding", "expansion", "experience", "flow", "function", "increase", "information"....
0.300
businessbusinessescreateeconomiceconomyexpansionexperiencedformsgrowthhistoricallyincreaseincreasesjobslabormanagemarketmarketsnetworkoperatorsplatform
SHARED TOKENS (29): "business", "businesses", "create", "economic", "economy", "expansion", "experienced", "forms", "growth", "historically", "increase", "increases", "jobs", "labor", "manage", "market", "markets", "network", "operators", "platform"....
0.300
actageappliescivilconcerningconditionsemploymentgeneralinformationlaborlawpublicrequiresrightsstandardstitleworkers
SHARED TOKENS (17): "act", "age", "applies", "civil", "concerning", "conditions", "employment", "general", "information", "labor", "law", "public", "requires", "rights", "standards", "title", "workers".
0.300
affectagricultureanalysisapplicationboundarycharacteristicsdifferentdueedgelandmakingmanagementmeansmechanismsmethodsmodelproducesprotectionpublicquality
SHARED TOKENS (26): "affect", "agriculture", "analysis", "application", "boundary", "characteristics", "different", "due", "edge", "land", "making", "management", "means", "mechanisms", "methods", "model", "produces", "protection", "public", "quality"....
0.300
accountingamongcapacityconstructioncreatingdemanddirectelectricalenergyincreasedlandlargemakingpopulationpowerprincipallyproducedproducesprovideregion
SHARED TOKENS (27): "accounting", "among", "capacity", "construction", "creating", "demand", "direct", "electrical", "energy", "increased", "land", "large", "making", "population", "power", "principally", "produced", "produces", "provide", "region"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
agriculturalbusinesscharacteristicsdevelopedfacilitiesgenerallygrowthhighlyindependentlargelargermaintainsnationalplanningpoolproducedproducesproductionprotectedpublished
SHARED TOKENS (24): "agricultural", "business", "characteristics", "developed", "facilities", "generally", "growth", "highly", "independent", "large", "larger", "maintains", "national", "planning", "pool", "produced", "produces", "production", "protected", "published"....
0.300
actamongbusinesscontroldefinedefinesemployeeemploymententitiesentitylawlegalprovideresponsibilitysingle
SHARED TOKENS (15): "act", "among", "business", "control", "define", "defines", "employee", "employment", "entities", "entity", "law", "legal", "provide", "responsibility", "single".
0.300
amongbusinesscapitalcontextformsfunctionlocalmanagementorganizationsplanningprivatepublicrecruitrequiredresearchretainvalueworkforce
SHARED TOKENS (18): "among", "business", "capital", "context", "forms", "function", "local", "management", "organizations", "planning", "private", "public", "recruit", "required", "research", "retain", "value", "workforce".
0.300
actadabillbusinesschangescharacteristicscivilcostseffectivefinalidentitylaterlawnationalprotectionprovidepublicrequirementsrequiresrights
SHARED TOKENS (20): "act", "ada", "bill", "business", "changes", "characteristics", "civil", "costs", "effective", "final", "identity", "later", "law", "national", "protection", "provide", "public", "requirements", "requires", "rights".
0.300
actaddressesaddressingagenciesagreementschangecomplianceconcerningcontroldevelopmenteconomicenergyenvironmentestablishgrowthintersectsjurisdictionlawlegalmanage
SHARED TOKENS (33): "act", "addresses", "addressing", "agencies", "agreements", "change", "compliance", "concerning", "control", "development", "economic", "energy", "environment", "establish", "growth", "intersects", "jurisdiction", "law", "legal", "manage"....
0.300
actadministrativeageagencycannotcivilclaimsemploymentfederalgovernmentidentityindividualinformationnationalpracticerights
SHARED TOKENS (16): "act", "administrative", "age", "agency", "cannot", "civil", "claims", "employment", "federal", "government", "identity", "individual", "information", "national", "practice", "rights".
0.300
actagenciesagencyapplyauthoritycreateddecisionsenvironmentfederalfinalgovernmentlawnationalpolicypreserveproposedqualityreportsrequirementrequirements
SHARED TOKENS (24): "act", "agencies", "agency", "apply", "authority", "created", "decisions", "environment", "federal", "final", "government", "law", "national", "policy", "preserve", "proposed", "quality", "reports", "requirement", "requirements"....
0.300
accessalreadycannotcharacteristicscompetingcontrolcostsdifferentdueenergyentityessentialfederalformsfrequentlygovernmentinfrastructureinstitutionlargelocal
SHARED TOKENS (34): "access", "already", "cannot", "characteristics", "competing", "control", "costs", "different", "due", "energy", "entity", "essential", "federal", "forms", "frequently", "government", "infrastructure", "institution", "large", "local"....
0.300
actaffectagriculturalanotherapplicationschangecurrentdemanddevelopmentgrowthincreasedlocalmakesmanagemanagementmanufacturingmunicipalpopulationpracticespressure
SHARED TOKENS (26): "act", "affect", "agricultural", "another", "applications", "change", "current", "demand", "development", "growth", "increased", "local", "makes", "manage", "management", "manufacturing", "municipal", "population", "practices", "pressure"....
0.300
associateddemandeconomicformsgenerallygovernmentincreasedincreasesindexlocalmarketsnationalownershipresponsesupply
SHARED TOKENS (15): "associated", "demand", "economic", "forms", "generally", "government", "increased", "increases", "index", "local", "markets", "national", "ownership", "response", "supply".
0.300
actadministeredagenciesapproximatelyauthorityauthorizedbuildingbusinesscapacitycivilcomponentsconductconstructioncontrolcreationdepartmentdesigndirectdirectlyeast
SHARED TOKENS (59): "act", "administered", "agencies", "approximately", "authority", "authorized", "building", "business", "capacity", "civil", "components", "conduct", "construction", "control", "creation", "department", "design", "direct", "directly", "east"....
0.300
agriculturallocalmanagementprocessesrole
SHARED TOKENS (5): "agricultural", "local", "management", "processes", "role". | EXACT TITLE in water_rights: "Evapotranspiration".
0.300
applicationbodycertificationcontroldesigndevelopeddevicesdifferentdistributiondueelectricalengineeringengineersequipmentfieldshistoricallyindividualinstitutionmanagementmanufacturing
SHARED TOKENS (32): "application", "body", "certification", "control", "design", "developed", "devices", "different", "distribution", "due", "electrical", "engineering", "engineers", "equipment", "fields", "historically", "individual", "institution", "management", "manufacturing"....
0.300
actadministrationagencyconditionscostsdepartmenteducationemploymentfederalfirmlaborlawoccupationalprovidingreduceregulationsregulatorysafetyshownstandards
SHARED TOKENS (22): "act", "administration", "agency", "conditions", "costs", "department", "education", "employment", "federal", "firm", "labor", "law", "occupational", "providing", "reduce", "regulations", "regulatory", "safety", "shown", "standards"....
0.300
Nursing ↗ Q121176 KW CROSS HIGH
actadvancedcertificationdemandeducationindependentlypermittedplanpracticeprofessionalsprotectionprovidersprovidingpublicqualityregulationsresponsibilityspecializedsupplysupport
SHARED TOKENS (21): "act", "advanced", "certification", "demand", "education", "independently", "permitted", "plan", "practice", "professionals", "protection", "providers", "providing", "public", "quality", "regulations", "responsibility", "specialized", "supply", "support"....
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalallowinganotherapplicationscontainingcriticalcustomerdemanddesigndevelopmentdifferentenergyequipmentessentialfacilitieshistoricalimportanceinfrastructureinstallationland
SHARED TOKENS (35): "agricultural", "allowing", "another", "applications", "containing", "critical", "customer", "demand", "design", "development", "different", "energy", "equipment", "essential", "facilities", "historical", "importance", "infrastructure", "installation", "land"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedcommonlyconnectdevelopmentevenfeefinalfunctionsgovernmentincreasedlandlaterlegalobtainownersownershippower
SHARED TOKENS (29): "acquisition", "another", "application", "authorized", "commonly", "connect", "development", "even", "fee", "final", "functions", "government", "increased", "land", "later", "legal", "obtain", "owners", "ownership", "power"....
0.300
addressingaffectagriculturalagriculturecentralchangechangesdevelopmentdirecteconomicenterenvironmentfieldsfoodlandlargelocalmajormanagementoperations
SHARED TOKENS (29): "addressing", "affect", "agricultural", "agriculture", "central", "change", "changes", "development", "direct", "economic", "enter", "environment", "fields", "food", "land", "large", "local", "major", "management", "operations"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalchangescontroldescribeddevelopmentexpansionfinancefirmfirmsgenerallimitedlong-termmanagementoperationalownershipprivateprovidepublicrather
SHARED TOKENS (24): "business", "capital", "changes", "control", "described", "development", "expansion", "finance", "firm", "firms", "general", "limited", "long-term", "management", "operational", "ownership", "private", "provide", "public", "rather"....
0.300
applicationsassociatedbeyondbusinessesdevelopeddifferentdistinctdueeconomiceconomyeducationemploymentexperiencehighlyjobslaborlegalmanagementmoveplanning
SHARED TOKENS (38): "applications", "associated", "beyond", "businesses", "developed", "different", "distinct", "due", "economic", "economy", "education", "employment", "experience", "highly", "jobs", "labor", "legal", "management", "move", "planning"....
0.300
Outsourcing ↗ Q61515 KW CROSS HIGH
anotherassetsbusinessclaimscontroldescribeddomesticeconomicentityevenfacilityfirmfunctionsindustrialjobslaterlegallimitedmanagementmanufacturing
SHARED TOKENS (33): "another", "assets", "business", "claims", "control", "described", "domestic", "economic", "entity", "even", "facility", "firm", "functions", "industrial", "jobs", "later", "legal", "limited", "management", "manufacturing"....
0.300
acquisitionsadministrationbusinesscapitalconsolidationcreatingdepartmentsdesigndevelopmentdocumentingdueeffectiveemployeeindustriallabormanagemanagementorganizationsplanningprimarily
SHARED TOKENS (32): "acquisitions", "administration", "business", "capital", "consolidation", "creating", "departments", "design", "development", "documenting", "due", "effective", "employee", "industrial", "labor", "manage", "management", "organizations", "planning", "primarily"....
0.300
boisebureaucapacitycomponentsidaholowernampanationalplacesprogramprojectprovidetreasurevalleywestern
SHARED TOKENS (15): "boise", "bureau", "capacity", "components", "idaho", "lower", "nampa", "national", "places", "program", "project", "provide", "treasure", "valley", "western".
0.300
Maize ↗ Q11575 KW CROSS HIGH
alongsidebecomebecomescontainsessentialfoodincreasedmajorproducedproducesproductionsouthernthroughouttreatmentuses
SHARED TOKENS (15): "alongside", "become", "becomes", "contains", "essential", "food", "increased", "major", "produced", "produces", "production", "southern", "throughout", "treatment", "uses".
0.300
Atmospheric entry ↗ KW CROSS HIGH
advancedcannotcompletecontrolledcreatedevelopeddifferentdueenterentryevenexperienceheatinghighlyitselflowermethodsrequiresimplyspace
SHARED TOKENS (20): "advanced", "cannot", "complete", "controlled", "create", "developed", "different", "due", "enter", "entry", "even", "experience", "heating", "highly", "itself", "lower", "methods", "require", "simply", "space".
0.300
agencycurrentdatadepartmentfederalgovernmentmajormakespublicregulatoryresearchresourcesresponsibilityspacestudywhosework
SHARED TOKENS (17): "agency", "current", "data", "department", "federal", "government", "major", "makes", "public", "regulatory", "research", "resources", "responsibility", "space", "study", "whose", "work".
0.300
actbillcodeconditionsdisputesflowjobslaborlawmeasuresproductionprogramprovisionsqualityraterequiresresourcesresponsibilitysectionstandards
SHARED TOKENS (26): "act", "bill", "code", "conditions", "disputes", "flow", "jobs", "labor", "law", "measures", "production", "program", "provisions", "quality", "rate", "requires", "resources", "responsibility", "section", "standards"....
0.300
administrationbuildingconditionscoverdepartmentdepartmentsdirectlyeconomicemploymentfederalgoverninggovernmentlaboroccupationalregulationsreportsresponsiblerightssafetystandards
SHARED TOKENS (23): "administration", "building", "conditions", "cover", "department", "departments", "directly", "economic", "employment", "federal", "governing", "government", "labor", "occupational", "regulations", "reports", "responsible", "rights", "safety", "standards"....
0.300
accessaddressagreementsalteramongassociatedavailabilitybecomebecomeschangesconditionsconflictscontrolcorporatedescribingdisputeseasteconomicgovernmentincreases
SHARED TOKENS (38): "access", "address", "agreements", "alter", "among", "associated", "availability", "become", "becomes", "changes", "conditions", "conflicts", "control", "corporate", "describing", "disputes", "east", "economic", "government", "increases"....
0.300
acquiringactapprovalapprovedbuildingconstructioncontextcontractorscostscreatescreationdesigndeterminedevelopmentdifferenteconomicengineersestategrowthincrease
SHARED TOKENS (38): "acquiring", "act", "approval", "approved", "building", "construction", "context", "contractors", "costs", "creates", "creation", "design", "determine", "development", "different", "economic", "engineers", "estate", "growth", "increase"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscompletecompletedcurrenteasteasternformidahoincreasinglylowermakingownerspointseparateterritoryvalleywestern
SHARED TOKENS (17): "business", "complete", "completed", "current", "east", "eastern", "form", "idaho", "increasingly", "lower", "making", "owners", "point", "separate", "territory", "valley", "western".
🫐 BERRY51 edges
0.280
Water metering ↗ Q268503 KW CROSS HIGH
buildingdetermineflowmanufacturingoutsidepracticeprocesspublicrequiredrequirementsstandardssuppliedsupplysystem
SHARED TOKENS (14): "building", "determine", "flow", "manufacturing", "outside", "practice", "process", "public", "required", "requirements", "standards", "supplied", "supply", "system".
0.280
agencybusinesscompliancedepartmentemploymentfederalgovernmentlaborofficeprogramsregulationsrequiringresponsibleunderlying
SHARED TOKENS (14): "agency", "business", "compliance", "department", "employment", "federal", "government", "labor", "office", "programs", "regulations", "requiring", "responsible", "underlying".
0.280
adaboisecentralcontainseasternidahoitselfmetropolitannationalpopulationrecreationsectionvalleywestern
SHARED TOKENS (14): "ada", "boise", "central", "contains", "eastern", "idaho", "itself", "metropolitan", "national", "population", "recreation", "section", "valley", "western".
0.280
Acqui-hiring ↗ Q4674764 KW CROSS HIGH
acquiringacquisitionacquisitionscapitaldueemployeefirmsformsgroupprimarilyprocessrecruitreportedretain
SHARED TOKENS (14): "acquiring", "acquisition", "acquisitions", "capital", "due", "employee", "firms", "forms", "group", "primarily", "process", "recruit", "reported", "retain".
0.260
boiseconsumercreateddatademandidahomajormarketownedproducedsemiconductorsouthtogether
SHARED TOKENS (13): "boise", "consumer", "created", "data", "demand", "idaho", "major", "market", "owned", "produced", "semiconductor", "south", "together".
0.260
agencybaridaho
SHARED TOKENS (3): "agency", "bar", "idaho". | EXACT TITLE in water_rights: "Idaho State Bar".
0.260
amongcreatedeconomicemployeeemploymentformgeneralgenerallylimitedoutsideprovidingsystemworkers
SHARED TOKENS (13): "among", "created", "economic", "employee", "employment", "form", "general", "generally", "limited", "outside", "providing", "system", "workers".
0.260
Human capital ↗ Q165687 KW CROSS HIGH
assetsbusinesscapitaleconomiceducationemployeeindividualprocessproductionqualityresearchthroughouttraining
SHARED TOKENS (13): "assets", "business", "capital", "economic", "education", "employee", "individual", "process", "production", "quality", "research", "throughout", "training".
0.260
methodsprocessprocesses
SHARED TOKENS (3): "methods", "process", "processes". | EXACT TITLE in water_rights: "Groundwater recharge".
0.240
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturaldivisioneastidaholargermajornationalprimarilyrecreationsectionsouthvalley
SHARED TOKENS (12): "agricultural", "division", "east", "idaho", "larger", "major", "national", "primarily", "recreation", "section", "south", "valley".
0.240
credentialdemanddueeducationeducationaljobsmarketprocessesprotectionqualityrequirevalue
SHARED TOKENS (12): "credential", "demand", "due", "education", "educational", "jobs", "market", "processes", "protection", "quality", "require", "value".
0.240
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturalagriculturedifferenteconomyfoodidaholandprocessingproducesproductionrolesector
SHARED TOKENS (12): "agricultural", "agriculture", "different", "economy", "food", "idaho", "land", "processing", "produces", "production", "role", "sector".
0.220
Septic tank ↗ Q386300 KW CROSS HIGH
commonlydomesticenvironmentfacilityprocessesratereducesystemsystemsthereforetreatment
SHARED TOKENS (11): "commonly", "domestic", "environment", "facility", "processes", "rate", "reduce", "system", "systems", "therefore", "treatment".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
commonlysouth
SHARED TOKENS (2): "commonly", "south". | EXACT TITLE in water_rights: "Alfalfa".
0.220
addressamongautomateddifferentdueemployeelegalmethodsorganizationspracticeworkers
SHARED TOKENS (11): "address", "among", "automated", "different", "due", "employee", "legal", "methods", "organizations", "practice", "workers".
0.200
Meta Platforms ↗ Q380 KW CROSS HIGH
businessdescribeddevelopmentmarketnetworkoperatesplatformspublicresearchsites
SHARED TOKENS (10): "business", "described", "development", "market", "network", "operates", "platforms", "public", "research", "sites".
0.200
refer
EXACT TITLE in staffing_recruiting: "Subdivision". | EXACT TITLE in water_rights: "Subdivision".
0.200
Abandon ↗ Q397584 EXACT TITLE
refer
EXACT TITLE in water_rights: "Abandon".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
refer
EXACT TITLE in water_rights: "Forfeit".
0.200
Labor mobility ↗ Q282773 KW CROSS HIGH
allocationdistincteducationalevenhistoricallaboroccupationalphysicalresourcesworkers
SHARED TOKENS (10): "allocation", "distinct", "educational", "even", "historical", "labor", "occupational", "physical", "resources", "workers".
0.200
demanddistributiondueflowmaintainedpressurereducedsuppliessystemsystems
SHARED TOKENS (10): "demand", "distribution", "due", "flow", "maintained", "pressure", "reduced", "supplies", "system", "systems".
0.200
authorizedcommonlyconditionscoveringgenerallymakesreceivingsimplystatuswork
SHARED TOKENS (10): "authorized", "commonly", "conditions", "covering", "generally", "makes", "receiving", "simply", "status", "work".
0.200
actappliesclaimcreatesemploymentlaborlawproductionstandardswork
SHARED TOKENS (10): "act", "applies", "claim", "creates", "employment", "labor", "law", "production", "standards", "work".
0.200
creatingdueeffectiveequipmentfieldshighlylandlargesectionsystems
SHARED TOKENS (10): "creating", "due", "effective", "equipment", "fields", "highly", "land", "large", "section", "systems".
0.180
amongeasternlandlawownershippossessrightssimplysystem
SHARED TOKENS (9): "among", "eastern", "land", "law", "ownership", "possess", "rights", "simply", "system".
0.180
adaboisecanyoncountiesidahometropolitanregiontreasurevalley
SHARED TOKENS (9): "ada", "boise", "canyon", "counties", "idaho", "metropolitan", "region", "treasure", "valley".
0.180
bureaucontainseastmajornorthwestsouthsouthernsouthwestwestern
SHARED TOKENS (9): "bureau", "contains", "east", "major", "northwest", "south", "southern", "southwest", "western".
0.180
actapprovedapproximatelycontrolestablishinglawmakingpermanentprograms
SHARED TOKENS (9): "act", "approved", "approximately", "control", "establishing", "law", "making", "permanent", "programs".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahometropolitannampapopulationwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "nampa", "population", "western".
0.180
controldistinctgoverninglawownershipqualityregulationsrelatedresources
SHARED TOKENS (9): "control", "distinct", "governing", "law", "ownership", "quality", "regulations", "related", "resources".
0.180
changesdefinesindividuallawneedphysicalrightssystemthem
SHARED TOKENS (9): "changes", "defines", "individual", "law", "need", "physical", "rights", "system", "them".
0.180
Wage theft ↗ Q7959502 KW CROSS HIGH
amongcontractorsemployeeindependentlawprovidesimplythemwork
SHARED TOKENS (9): "among", "contractors", "employee", "independent", "law", "provide", "simply", "them", "work".
0.160
agencydepartmentdevelopmenteconomicgrowthidahopublicresources
SHARED TOKENS (8): "agency", "department", "development", "economic", "growth", "idaho", "public", "resources".
0.160
agriculturalindustriallegalmerelyownershiprightssourcesystem
SHARED TOKENS (8): "agricultural", "industrial", "legal", "merely", "ownership", "rights", "source", "system".
0.160
businesscostsemployeeraterecruitmentretaintrainingworkforce
SHARED TOKENS (8): "business", "costs", "employee", "rate", "recruitment", "retain", "training", "workforce".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyoneastidahometropolitanpopulationschools
SHARED TOKENS (8): "ada", "boise", "canyon", "east", "idaho", "metropolitan", "population", "schools".
0.160
Gig economy ↗ Q51711208 KW CROSS HIGH
corporateeconomiceconomyentitiessectorsystemworkersworkforce
SHARED TOKENS (8): "corporate", "economic", "economy", "entities", "sector", "system", "workers", "workforce".
0.160
actcodedevelopmentfederallawpowerprojectstitle
SHARED TOKENS (8): "act", "code", "development", "federal", "law", "power", "projects", "title".
0.140
allowingdirectlymaintainednetworkoperatedsystemsystems
SHARED TOKENS (7): "allowing", "directly", "maintained", "network", "operated", "system", "systems".
0.140
foodidahomakingpopulationregionsourcesouthern
SHARED TOKENS (7): "food", "idaho", "making", "population", "region", "source", "southern".
0.140
describingeconomicgraphjobsprocessrulessearch
SHARED TOKENS (7): "describing", "economic", "graph", "jobs", "process", "rules", "search".
0.140
agencycontinuingdepartmentfederalgovernmentmanagementworking
SHARED TOKENS (7): "agency", "continuing", "department", "federal", "government", "management", "working".
0.120
distributionformmanagementpracticesthereforethroughout
SHARED TOKENS (6): "distribution", "form", "management", "practices", "therefore", "throughout".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
agencyestatefieldsfoodplanningreal
SHARED TOKENS (6): "agency", "estate", "fields", "food", "planning", "real".
0.120
agencycertificationeducationalprofessionalpublicsimply
SHARED TOKENS (6): "agency", "certification", "educational", "professional", "public", "simply".
0.120
Water table ↗ Q3342272 KW CROSS HIGH
actualdefineflowlowerpressuresimply
SHARED TOKENS (6): "actual", "define", "flow", "lower", "pressure", "simply".
0.120
actdatageneralinformationpageprotection
SHARED TOKENS (6): "act", "data", "general", "information", "page", "protection".
0.100
associatedidahonorthwestsouthernwestern
SHARED TOKENS (5): "associated", "idaho", "northwest", "southern", "western".
0.100
Job fair ↗ Q446643 KW CROSS HIGH
careercommonlycontactinformationschools
SHARED TOKENS (5): "career", "commonly", "contact", "information", "schools".
0.100
Job hunting ↗ Q629194 KW CROSS HIGH
actcurrentdueemploymentobtain
SHARED TOKENS (5): "act", "current", "due", "employment", "obtain".
◈ Frequently Asked Questions
Staffing Recruiting × Water Rights — Treasure Valley
HAIKU · HIGH GATE
Why do food processing companies in Nampa and Caldwell struggle to recruit local workers in Canyon County?
Food processing facilities require year-round staffing but compete with agricultural employers whose labor demand fluctuates with water availability and irrigation seasons. Water rights allocations in Canyon County directly affect the seasonal workforce needs of both sectors, making consistent recruitment difficult when water deliveries restrict planting and harvest cycles.
How do civil engineering projects in Ada County relate to staffing needs for water rights administration?
Civil engineering firms in Boise and Meridian increasingly recruit specialized staff to manage water infrastructure projects tied to Idaho water rights compliance. Ada County's rapid urbanization has expanded demand for engineers who understand both construction management and state water law requirements.
What staffing challenges does urbanization create for water rights management agencies serving the Treasure Valley?
Boise, Nampa, and Eagle have experienced rapid metropolitan population growth that increased water demand while the number of qualified water rights specialists has remained limited. Local recruiting firms report difficulty filling positions for water rights adjudicators and compliance officers needed by Canyon County and Ada County water districts.
How do agricultural employers in the Treasure Valley use staffing recruiting to adapt to changing water allocations?
Food processing operations and farms across Caldwell and Nampa recruit seasonal workers strategically based on water rights availability announced by Idaho Department of Water Resources. Staffing agencies in the Treasure Valley now employ water law expertise to match temporary labor pools with employers whose production capacity depends on annual water allocation decisions.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Staffing Recruiting × Water Rights 12 QID bridges 255 edges 6,776 ext links 2026-07-17 23:23:05 UTC 3e76323d7c9c09f8
Staffing Recruiting corridor ↗ Water Rights corridor ↗ Water Rights × Staffing Recruiting ↗ boisestandard.org/standard ↗
Parent Corridors
Staffing Recruiting × All Other Verticals