—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Pets ↔ relates to ↔ Biotech Life Sciences

8 Wikipedia bridge articles confirmed in both vertical ledgers. 193 deterministic cross-vertical edges. 5,429 external source links harvested. Every edge provenance-stamped. Every claim auditable.

8 QID Bridge Articles
193 Cross Edges
5,429 External Sources
217 Wikipedia Articles
8 🌲 Evergreen
115 🌿 Branch
MEDIUM SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Pets
× Biotech Life Sciences
QID Bridge Articles
8
confirmed Wikipedia overlap
Total Cross Edges
193
External Sources Harvested
5,429
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
medium
Schema summary only
Strongest Edge
Veterinary medicine
score: 1.0000  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (8)
Veterinary medicineTreasure ValleyBoise, IdahoNampa, IdahoAda County, IdahoCanyon County, IdahoMeridian, IdahoCaldwell, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadahomecanyonlocalrivertreasurevalleywesternmeridiannampacaldwellmakingaffectanimalanimalscarecontrol
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:37:20 UTC
Content Hash
f2b67c7d3ba48cac
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
8 BRIDGES
Veterinary medicine
Q170201 EXACT TITLE 1.000
QID OVERLAP: Q170201 in pets (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (21): "affect", "animal", "animals", "care", "control", "different", "disease", "food", "health", "livestock", "management", "medical", "medicine", "roles", "safety", "supply", "treatment", "veterinarians", "veterinary", "welfare".... | EXACT TITLE in pets: "Veterinary medicine".
affectanimalanimalscarecontroldifferentdiseasefoodhealthlivestockmanagementmedicalmedicinerolessafetysupplytreatmentveterinariansveterinarywelfarework
t, diagnosis, and treatment of disease, disorder, and injury in non-human animals. Its scope is wide, covering all animal species, both domesticated and wild, with a wide range of conditions that can affect different species. Veterinary medicine is practiced both with and without professional supervision. Professional care is most often led by a veterinary physician (also known as a veterinarian, veterinary surgeon, or "vet"), but also by paraveterinary workers, including veterinary nurses, veterinary technicians, and veterinary assistants. Other paraprofessionals may have specialized roles, such as animal physiotherapy or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
ary surgeon, or "vet"), but also by paraveterinary workers, including veterinary nurses, veterinary technicians, and veterinary assistants. Other paraprofessionals may have specialized roles, such as animal physiotherapy or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
y or dentistry, and species-relevant roles such as farriers. Veterinary science helps human health through the monitoring and control of zoonotic disease (infectious disease transmitted from nonhuman animals to humans), food safety, and through human applications via medical research. They also help to maintain food supply through livestock health monitoring and treatment, and mental health by keeping pets healthy and long-living. Veterinary scientists often collaborate with epidemiologists and other health or natural scientists, depending on type of work. Ethically, veterinarians are usually obliged to look after animal welfare.
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in pets (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "agricultural", "boise", "idaho", "land", "local", "region", "river", "treasure", "valley", "western". | EXACT TITLE in pets: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
agriculturalboiseidaholandlocalregionrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 QID OVERLAP 0.680
QID OVERLAP: Q35775 in pets (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (9): "ada", "boise", "home", "idaho", "major", "population", "river", "treasure", "valley".
adaboisehomeidahomajorpopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.660
QID OVERLAP: Q622633 in pets (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "boise", "canyon", "home", "idaho", "meridian", "nampa", "population", "western".
boisecanyonhomeidahomeridiannampapopulationwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.660
QID OVERLAP: Q109820 in pets (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (8): "ada", "boise", "home", "idaho", "jurisdiction", "local", "population", "private".
adaboisehomeidahojurisdictionlocalpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in pets (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in pets (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (6): "ada", "boise", "idaho", "making", "meridian", "population".
adaboiseidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.600
QID OVERLAP: Q849592 in pets (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "population".
boisecaldwellcanyonidahopopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
185 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP185 edges
🌿 BRANCH115 edges
0.500
Antibody ↗ Q79460 EXACT TITLE
animalbecomecapacityclassificationdeliverydescribesdifferentdirectlydiseasefunctiongenerallargelessmajormodelsmultipleratherresultingsizespace
SHARED TOKENS (23): "animal", "become", "capacity", "classification", "delivery", "describes", "different", "directly", "disease", "function", "general", "large", "less", "major", "models", "multiple", "rather", "resulting", "size", "space".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
animalanimalsanotherbasiccoreculturedevelopmentdirectlyhigherimportantimproveknowledgelifelivestockmeansmedicalmedicinenationaloperationspeople
SHARED TOKENS (32): "animal", "animals", "another", "basic", "core", "culture", "development", "directly", "higher", "important", "improve", "knowledge", "life", "livestock", "means", "medical", "medicine", "national", "operations", "people".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalbestboiseearlyeconomygeographicidaholandnationalofficialpeoplepopulationproductsrelativelyriversmallsupplieswestern
SHARED TOKENS (18): "agricultural", "best", "boise", "early", "economy", "geographic", "idaho", "land", "national", "official", "people", "population", "products", "relatively", "river", "small", "supplies", "western". | EXACT TITLE in pets: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
0.500
contractcostsdevelopmententryinstitutionslargelifemanagementmedicalneedorganizationprovidequalityrealreducerequiredsmallstaffsupportwork
SHARED TOKENS (20): "contract", "costs", "development", "entry", "institutions", "large", "life", "management", "medical", "need", "organization", "provide", "quality", "real", "reduce", "required", "small", "staff", "support", "work". | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
advancedanimalbuildingcategoryclassificationcomplexcomponentsdifferentdirectlygeneralmarketmedicalmedicinepharmaceuticalsproductsrathersmallsourcesurroundingthem
SHARED TOKENS (22): "advanced", "animal", "building", "category", "classification", "complex", "components", "different", "directly", "general", "market", "medical", "medicine", "pharmaceuticals", "products", "rather", "small", "source", "surrounding", "them".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
basicchangecollectiondecisionsdiseasefunctiongeneralhealthhealthcareknowledgemajorpatternspeoplepolicypopulationpracticepublicriskthereforetreatment
SHARED TOKENS (21): "basic", "change", "collection", "decisions", "disease", "function", "general", "health", "healthcare", "knowledge", "major", "patterns", "people", "policy", "population", "practice", "public", "risk", "therefore", "treatment".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
Immunology ↗ Q101929 EXACT TITLE
advancedbecomecomponentsearlyembeddedhealthimportantmedicinephysicalrathersmallsurroundingsystemsystemsthemwork
SHARED TOKENS (16): "advanced", "become", "components", "early", "embedded", "health", "important", "medicine", "physical", "rather", "small", "surrounding", "system", "systems", "them", "work". | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
advancedanimalsbehaviorcenteredcomplexdiscoverydiseaseearlyfunctionhighermedicalmedicinemodelorganizationphysicalstructuresystemsthemwork
SHARED TOKENS (19): "advanced", "animals", "behavior", "centered", "complex", "discovery", "disease", "early", "function", "higher", "medical", "medicine", "model", "organization", "physical", "structure", "systems", "them", "work". | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Virology ↗ Q7215 EXACT TITLE
animalanimalsbeginningbroadclassificationculturedetectiondifferentdiseasehealthmedicalmedicineofficialsourcestructurethemveterinarywelfare
SHARED TOKENS (18): "animal", "animals", "beginning", "broad", "classification", "culture", "detection", "different", "disease", "health", "medical", "medicine", "official", "source", "structure", "them", "veterinary", "welfare". | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
anotherbecomecompletecontroldecisionsdevelopmentearlyemployeesentityfinancefinancingfundinggrowthinstitutionalmarketmodeloperatingoperationsownershippoint
SHARED TOKENS (32): "another", "become", "complete", "control", "decisions", "development", "early", "employees", "entity", "finance", "financing", "funding", "growth", "institutional", "market", "model", "operating", "operations", "ownership", "point".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
behaviorcarecodesdeterminehealthindependentinstitutioninstitutionalinvolvingmainmedicalnationalpeoplephysicalprivateprotocolsrequiredsafetywelfare
SHARED TOKENS (19): "behavior", "care", "codes", "determine", "health", "independent", "institution", "institutional", "involving", "main", "medical", "national", "people", "physical", "private", "protocols", "required", "safety", "welfare". | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
affordablebecomecarecommunitydirecthealthinstitutionallinkspracticeproductsrolessafetysuppliesthereforework
SHARED TOKENS (15): "affordable", "become", "care", "community", "direct", "health", "institutional", "links", "practice", "products", "roles", "safety", "supplies", "therefore", "work". | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
beginningchannelscomponentscontroldeterminedevelopmenthundredsmeansmediapracticalprocessreducessmallsupplysystemsystemstransport
SHARED TOKENS (17): "beginning", "channels", "components", "control", "determine", "development", "hundreds", "means", "media", "practical", "process", "reduces", "small", "supply", "system", "systems", "transport". | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
agriculturalcontrolcreatediagnosticdiseaseequipmentimproveknowledgemassmedicalprocessproductsrapidspacesystems
SHARED TOKENS (15): "agricultural", "control", "create", "diagnostic", "disease", "equipment", "improve", "knowledge", "mass", "medical", "process", "products", "rapid", "space", "systems". | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
anothercaredevelopmentdiagnosticdifferentfunctiongrowthlargematerialmedicalmedicineproductssystemsystemstissue
SHARED TOKENS (15): "another", "care", "development", "diagnostic", "different", "function", "growth", "large", "material", "medical", "medicine", "products", "system", "systems", "tissue". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
administrationcommunitydepartmentenforcementestablishedgovernmentintelligenceinvolvingjurisdictionlawnationaloperationsprotectionratherreportsresponsible
SHARED TOKENS (16): "administration", "community", "department", "enforcement", "established", "government", "intelligence", "involving", "jurisdiction", "law", "national", "operations", "protection", "rather", "reports", "responsible". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
becomecentercenterscentralcollectioncompletecontractcostsdevelopmentgeneratehealthmedicalmedicinemultipleorganizationpartnerprocessrequireresponsiblerisk
SHARED TOKENS (25): "become", "center", "centers", "central", "collection", "complete", "contract", "costs", "development", "generate", "health", "medical", "medicine", "multiple", "organization", "partner", "process", "require", "responsible", "risk".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
Rabbit ↗ Q9394 EXACT TITLE
affectanimalanimalsculturedensitydiseasefamilyfoundhundredslargelivestockmajorpracticeproblemsproductsprovideseensmallstructurethem
SHARED TOKENS (20): "affect", "animal", "animals", "culture", "density", "disease", "family", "found", "hundreds", "large", "livestock", "major", "practice", "problems", "products", "provide", "seen", "small", "structure", "them". | EXACT TITLE in pets: "Rabbit".
0.500
4-H ↗ Q238139 EXACT TITLE
changecommunityconsumercreatedepartmentdevelopmentfamilyfoodhealthlocalnationaloperatesorganizationprovidestaffsystemworkyouth
SHARED TOKENS (18): "change", "community", "consumer", "create", "department", "development", "family", "food", "health", "local", "national", "operates", "organization", "provide", "staff", "system", "work", "youth". | EXACT TITLE in pets: "4-H".
0.500
broadcarecurrentdevelopmentdiagnosticequipmentgrowthhealthhealthcarehospitalsindustrymaintenancemakingmanagementmedicalmedicinerelevantroleroutinetissue
SHARED TOKENS (22): "broad", "care", "current", "development", "diagnostic", "equipment", "growth", "health", "healthcare", "hospitals", "industry", "maintenance", "making", "management", "medical", "medicine", "relevant", "role", "routine", "tissue".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
Livestock ↗ Q103459 EXACT TITLE
agriculturalanimalanimalscommercialcommunitiesenvironmentgeneralhealthlaborlivestockmaintenancemajormaterialproductsprovidepublicrolesourcewelfare
SHARED TOKENS (19): "agricultural", "animal", "animals", "commercial", "communities", "environment", "general", "health", "labor", "livestock", "maintenance", "major", "material", "products", "provide", "public", "role", "source", "welfare". | EXACT TITLE in pets: "Livestock". | EXACT TITLE in biotech_life_sciences: "Livestock".
0.500
complexdiscoveryestablishedfoodgeneralgovernmentsincreaselifemajormarketmedicaloversightrequiredrisksafetysize
SHARED TOKENS (16): "complex", "discovery", "established", "food", "general", "governments", "increase", "life", "major", "market", "medical", "oversight", "required", "risk", "safety", "size". | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
Rabies ↗ Q39222 EXACT TITLE
animalanimalscarecentralcontrolcostsdependsdirectdiseaseearlyfoundlessmedicalpeoplepopulationreducereportedreportingrisksource
SHARED TOKENS (24): "animal", "animals", "care", "central", "control", "costs", "depends", "direct", "disease", "early", "found", "less", "medical", "people", "population", "reduce", "reported", "reporting", "risk", "source".... | EXACT TITLE in pets: "Rabies".
0.500
advancedbasicchangescomponentsdevelopmentdiagnosticdifferentdiseasedivisionhealthhealthcareimportantinterfaceknowledgemainmedicalmedicinepracticeprocessprovide
SHARED TOKENS (27): "advanced", "basic", "changes", "components", "development", "diagnostic", "different", "disease", "division", "health", "healthcare", "important", "interface", "knowledge", "main", "medical", "medicine", "practice", "process", "provide".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
adaboisecanyoncommunitydevelopmenteducationidaholargenampapopulationpublicreportedresidentstreasurevalleywesternworkforce
SHARED TOKENS (17): "ada", "boise", "canyon", "community", "development", "education", "idaho", "large", "nampa", "population", "public", "reported", "residents", "treasure", "valley", "western", "workforce". | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
0.500
administrationanimalcontrolcurrentdepartmentdirectlyemployeesfeedfoodhealthmedicalproductspublicreportsresponsiblesafetyveterinarywork
SHARED TOKENS (18): "administration", "animal", "control", "current", "department", "directly", "employees", "feed", "food", "health", "medical", "products", "public", "reports", "responsible", "safety", "veterinary", "work". | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
capacitycostsdetailsdirectlyearlygrowthimportantinstitutionallegalmarketprivateprocessprovidepublicpubliclythereforevalue
SHARED TOKENS (17): "capacity", "costs", "details", "directly", "early", "growth", "important", "institutional", "legal", "market", "private", "process", "provide", "public", "publicly", "therefore", "value". | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
Horse ↗ Q726 EXACT TITLE
animalbehaviorcentralcontroldevelopmentdifferentequipmentfamilygenerallargelifepharmaceuticalsproductssizesmallthemtrainingwork
SHARED TOKENS (18): "animal", "behavior", "central", "control", "development", "different", "equipment", "family", "general", "large", "life", "pharmaceuticals", "products", "size", "small", "them", "training", "work". | EXACT TITLE in pets: "Horse".
0.480
administrationclassificationcontroldecisionsdetermineenforcementfoodlawlistingmedicalnationalpolicyrequiredtreatment
SHARED TOKENS (14): "administration", "classification", "control", "decisions", "determine", "enforcement", "food", "law", "listing", "medical", "national", "policy", "required", "treatment". | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.480
Pathology ↗ Q7208 EXACT TITLE
changescomponentsdevelopmentdifferentdiseasegeneralmajormedicalphysicalpracticespecialtiessystemstissuetreatment
SHARED TOKENS (14): "changes", "components", "development", "different", "disease", "general", "major", "medical", "physical", "practice", "specialties", "systems", "tissue", "treatment". | EXACT TITLE in biotech_life_sciences: "Pathology".
0.480
Biochemistry ↗ Q7094 EXACT TITLE
becomecontroldependsdiseaseenvironmentfunctionhealthlifemedicineprovidesmallstructuresystemsturn
SHARED TOKENS (14): "become", "control", "depends", "disease", "environment", "function", "health", "life", "medicine", "provide", "small", "structure", "systems", "turn". | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.460
Coyote ↗ Q44299 EXACT TITLE
animalchangescultureenvironmentsfamilygeographyhomeimproveorganizationpublicseenshowsmaller
SHARED TOKENS (13): "animal", "changes", "culture", "environments", "family", "geography", "home", "improve", "organization", "public", "seen", "show", "smaller". | EXACT TITLE in pets: "Coyote".
0.460
Vaccine ↗ Q134808 EXACT TITLE
administrationdevelopmentdifferentdiseasehealthlicensedorganizationpracticereportsresponsiblesafetysystemverified
SHARED TOKENS (13): "administration", "development", "different", "disease", "health", "licensed", "organization", "practice", "reports", "responsible", "safety", "system", "verified". | EXACT TITLE in pets: "Vaccine". | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.460
Pet insurance ↗ EXACT TITLE
carecostsexpectationshealthhigherinsurancemarketmedicalmedicinepoliciesstandardtreatmentveterinary
SHARED TOKENS (13): "care", "costs", "expectations", "health", "higher", "insurance", "market", "medical", "medicine", "policies", "standard", "treatment", "veterinary". | EXACT TITLE in pets: "Pet insurance".
0.460
businessescategorycreateinnovationlandlawlegalmainownershippeopleproblemssystemsthem
SHARED TOKENS (13): "businesses", "category", "create", "innovation", "land", "law", "legal", "main", "ownership", "people", "problems", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.460
Microbiology ↗ Q7193 EXACT TITLE
complexculturecurrentenvironmentslesslifematerialmeansmedicalsearchsmallthemwork
SHARED TOKENS (13): "complex", "culture", "current", "environments", "less", "life", "material", "means", "medical", "search", "small", "them", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.460
Dog ↗ Q144 EXACT TITLE
behaviorbestdevelopmentdistributedenvironmentpeoplephysicalpopulationprocessprotectionrolessizethem
SHARED TOKENS (13): "behavior", "best", "development", "distributed", "environment", "people", "physical", "population", "process", "protection", "roles", "size", "them". | EXACT TITLE in pets: "Dog".
0.460
affectanimalanimalsbehaviorbestcarediseasefoodlifeproblemsqualitythereforewelfare
SHARED TOKENS (13): "affect", "animal", "animals", "behavior", "best", "care", "disease", "food", "life", "problems", "quality", "therefore", "welfare". | EXACT TITLE in pets: "Animal welfare".
0.460
commercialdevelopmentdiagnosticsdifferentgovernmentincreaseproceduresprocessqualityreducerequiredroutinetimes
SHARED TOKENS (13): "commercial", "development", "diagnostics", "different", "government", "increase", "procedures", "process", "quality", "reduce", "required", "routine", "times". | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.450
govgovernmenthealthmedicinenational
SHARED TOKENS (5): "gov", "government", "health", "medicine", "national". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
Microscopy ↗ Q1074953 EXACT TITLE
anothercollectioncreatedevelopmenthigherinsidelifephysicalprocessseensmallstandard
SHARED TOKENS (12): "another", "collection", "create", "development", "higher", "inside", "life", "physical", "process", "seen", "small", "standard". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.440
adaboisecanyonhomeidahomainmeridiannampanearlypopulationtreasurevalley
SHARED TOKENS (12): "ada", "boise", "canyon", "home", "idaho", "main", "meridian", "nampa", "nearly", "population", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
0.440
agriculturalanotherenvironmentfacilityindustrymainmunicipalperformsprocessresultingtreatmentwaste
SHARED TOKENS (12): "agricultural", "another", "environment", "facility", "industry", "main", "municipal", "performs", "process", "resulting", "treatment", "waste". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.440
agriculturalbuildingcomplexdevelopmentdiseaseimportantlargemodelsnetworksprocessrolesystems
SHARED TOKENS (12): "agricultural", "building", "complex", "development", "disease", "important", "large", "models", "networks", "process", "role", "systems". | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.420
administrationapplyfoodlawprivateprotectionpublicqualityrequiredsystemsystems
SHARED TOKENS (11): "administration", "apply", "food", "law", "private", "protection", "public", "quality", "required", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.420
behaviorcomplexcurrentdepartmentfacilitiesfacilityidahoknowledgenationalpeoplewestern
SHARED TOKENS (11): "behavior", "complex", "current", "department", "facilities", "facility", "idaho", "knowledge", "national", "people", "western". | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.420
animalanimalscontroldiseasehealthmanagementmedicalmedicineroleveterinariansveterinary
SHARED TOKENS (11): "animal", "animals", "control", "disease", "health", "management", "medical", "medicine", "role", "veterinarians", "veterinary". | EXACT TITLE in pets: "Veterinarian". | EXACT TITLE in biotech_life_sciences: "Veterinarian".
0.420
adoptionanimalanimalscurrentdeterminedifferentfamilyhomemedicalneedprovide
SHARED TOKENS (11): "adoption", "animal", "animals", "current", "determine", "different", "family", "home", "medical", "need", "provide". | EXACT TITLE in pets: "Pet adoption".
0.420
Patent ↗ Q253623 EXACT TITLE
lawlegalmakingmodelsnationalorganizationprivateprotectionpublicratherrequirements
SHARED TOKENS (11): "law", "legal", "making", "models", "national", "organization", "private", "protection", "public", "rather", "requirements". | EXACT TITLE in biotech_life_sciences: "Patent".
0.420
agriculturalanimalsculturediagnosticsdifferentgrowthinvolvingproductssizetimestissue
SHARED TOKENS (11): "agricultural", "animals", "culture", "diagnostics", "different", "growth", "involving", "products", "size", "times", "tissue". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.420
departmentfundinghealthinstitutionalinstitutionsinvolvingnearlyoversightpublicstandardwelfare
SHARED TOKENS (11): "department", "funding", "health", "institutional", "institutions", "involving", "nearly", "oversight", "public", "standard", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.420
changesdevelopmentdiseaseinterfacemajormedicalmedicinephysicalrolestructurework
SHARED TOKENS (11): "changes", "development", "disease", "interface", "major", "medical", "medicine", "physical", "role", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.420
centercentraleducationhigherinstitutionsknowledgelifeprivatepublicrathervalue
SHARED TOKENS (11): "center", "central", "education", "higher", "institutions", "knowledge", "life", "private", "public", "rather", "value". | EXACT TITLE in biotech_life_sciences: "Research university".
0.400
animalanimalsfunctionpeoplepoliciespublicregionsupporttrainedtraining
SHARED TOKENS (10): "animal", "animals", "function", "people", "policies", "public", "region", "support", "trained", "training". | EXACT TITLE in pets: "Service animal".
0.400
dependsdirectlydiseasefoodhealthmajorpeoplephysicalrequiredwork
SHARED TOKENS (10): "depends", "directly", "disease", "food", "health", "major", "people", "physical", "required", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.400
Pet store ↗ Q220142 EXACT TITLE
animalanimalscarecleaningfoodproductsprovidepublicsuppliestraining
SHARED TOKENS (10): "animal", "animals", "care", "cleaning", "food", "products", "provide", "public", "supplies", "training". | EXACT TITLE in pets: "Pet store".
0.400
adoptionanimalanimalsdedicatedenvironmentgeneralorganizationprocessthemwelfare
SHARED TOKENS (10): "adoption", "animal", "animals", "dedicated", "environment", "general", "organization", "process", "them", "welfare". | EXACT TITLE in pets: "Animal rescue".
0.400
addadministrationcontrolfoodlawmedicalnationalrequirementssafetytimes
SHARED TOKENS (10): "add", "administration", "control", "food", "law", "medical", "national", "requirements", "safety", "times". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.400
Cell biology ↗ Q7141 EXACT TITLE
basicbehaviorcomponentsculturefunctionlifemedicalresponsiblestructurework
SHARED TOKENS (10): "basic", "behavior", "components", "culture", "function", "life", "medical", "responsible", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.400
Biosensor ↗ Q669391 EXACT TITLE
anothercombinesconnectsdetectiondifferentgeneratematerialresponsibleresultingtissue
SHARED TOKENS (10): "another", "combines", "connects", "detection", "different", "generate", "material", "responsible", "resulting", "tissue". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.400
affectcomponentscostsdifferenthighermaterialprocesssmallersystemthem
SHARED TOKENS (10): "affect", "components", "costs", "different", "higher", "material", "process", "smaller", "system", "them". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.400
Tick ↗ Q10304508 EXACT TITLE
affectanimalsbecomedistributedenvironmentfamilyfeedlifemajorstructure
SHARED TOKENS (10): "affect", "animals", "become", "distributed", "environment", "family", "feed", "life", "major", "structure". | EXACT TITLE in pets: "Tick".
0.400
boisedivisioneconomicseducationhealthidahoindependentinstitutionpublicreported
SHARED TOKENS (10): "boise", "division", "economics", "education", "health", "idaho", "independent", "institution", "public", "reported". | EXACT TITLE in biotech_life_sciences: "Boise State University".
0.380
Pet food ↗ Q6648982 EXACT TITLE
animalanimalschangefeedfoodgeneralindustrymajormarket
SHARED TOKENS (9): "animal", "animals", "change", "feed", "food", "general", "industry", "major", "market". | EXACT TITLE in pets: "Pet food".
0.380
agriculturalcentraldevelopmentdirectlyearlyfoodlifeproductssafety
SHARED TOKENS (9): "agricultural", "central", "development", "directly", "early", "food", "life", "products", "safety". | EXACT TITLE in biotech_life_sciences: "Food science".
0.360
administrationapplycommunitydemandhospitalhospitalsproviderising
SHARED TOKENS (8): "administration", "apply", "community", "demand", "hospital", "hospitals", "provide", "rising". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.360
becomecomplexdeterminedifferentfunctionmassstructurethem
SHARED TOKENS (8): "become", "complex", "determine", "different", "function", "mass", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.360
boisedepartmentgovernmentidahomainqualityregionalresponsible
SHARED TOKENS (8): "boise", "department", "government", "idaho", "main", "quality", "regional", "responsible". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.360
adoptioncarecommunitydescribeslocalmeansresidentssystem
SHARED TOKENS (8): "adoption", "care", "community", "describes", "local", "means", "residents", "system". | EXACT TITLE in pets: "Community cat".
0.360
Cat ↗ Q146 EXACT TITLE
controleventsfamilyintelligencepopulationproblemsrangessmall
SHARED TOKENS (8): "control", "events", "family", "intelligence", "population", "problems", "ranges", "small". | EXACT TITLE in pets: "Cat". | EXACT TITLE in biotech_life_sciences: "Cat".
0.340
boisedivisionestablishedidahomainoperatespublic
SHARED TOKENS (7): "boise", "division", "established", "idaho", "main", "operates", "public". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
0.340
Ann Morrison Park ↗ EXACT TITLE
boisedepartmenteventsfacilitiesidahopeopleriver
SHARED TOKENS (7): "boise", "department", "events", "facilities", "idaho", "people", "river". | EXACT TITLE in pets: "Ann Morrison Park".
0.340
Cleanroom ↗ Q794827 EXACT TITLE
facilitiesinsidematerialsizesmallerspacework
SHARED TOKENS (7): "facilities", "inside", "material", "size", "smaller", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.340
departmentdevelopmentidahoinsurancelaborresponsibleworkforce
SHARED TOKENS (7): "department", "development", "idaho", "insurance", "labor", "responsible", "workforce". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.340
applybroadcontrolfoundmaterialsystemsthem
SHARED TOKENS (7): "apply", "broad", "control", "found", "material", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.340
animalsdifferentfacilitymaterialmedicalpeopletissue
SHARED TOKENS (7): "animals", "different", "facility", "material", "medical", "people", "tissue". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.320
Farrier ↗ Q694579 EXACT TITLE
becomecarecombinesequineknowledgespecialist
SHARED TOKENS (6): "become", "care", "combines", "equine", "knowledge", "specialist". | EXACT TITLE in pets: "Farrier".
0.320
behaviorcombinesdifferentexpandedmedicinesystem
SHARED TOKENS (6): "behavior", "combines", "different", "expanded", "medicine", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.320
agriculturalanimalanimalscommunitieslivestockpolicy
SHARED TOKENS (6): "agricultural", "animal", "animals", "communities", "livestock", "policy". | EXACT TITLE in pets: "Animal shelter".
0.320
animalanimalshealthcareindustrymarketproducts
SHARED TOKENS (6): "animal", "animals", "healthcare", "industry", "market", "products". | EXACT TITLE in pets: "Pet industry".
0.320
Phlebotomy ↗ Q3595842 EXACT TITLE
involvingmakingmedicalperformsprocesstreatment
SHARED TOKENS (6): "involving", "making", "medical", "performs", "process", "treatment". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.300
Hazardous waste ↗ EXACT TITLE
environmenthealthlocalnationalwaste
SHARED TOKENS (5): "environment", "health", "local", "national", "waste". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.300
centersindustryinnovationorganizationserves
SHARED TOKENS (5): "centers", "industry", "innovation", "organization", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.300
beyondcommercialcomponentsdevelopmentdifferentenvironmentsequipmentfacilitiesinfrastructuremanagementmedicinemultipleoperationsplanningprocessrequiredsupportsystemsystemstimes
SHARED TOKENS (21): "beyond", "commercial", "components", "development", "different", "environments", "equipment", "facilities", "infrastructure", "management", "medicine", "multiple", "operations", "planning", "process", "required", "support", "system", "systems", "times"....
0.300
agriculturalanimalbeginningcommerciallycontroldirectearlygeneralgrowthhealthimportantincreaseindustrylargelivestockrolescaleseensmallsystems
SHARED TOKENS (22): "agricultural", "animal", "beginning", "commercially", "control", "direct", "early", "general", "growth", "health", "important", "increase", "industry", "large", "livestock", "role", "scale", "seen", "small", "systems"....
0.300
anotherapplycapacitydecisionshealthcareimmediateinstitutionalissuelawlegalmakingmarchmedicalnationalnearlyprocessproviderelevantrequiredrisk
SHARED TOKENS (24): "another", "apply", "capacity", "decisions", "healthcare", "immediate", "institutional", "issue", "law", "legal", "making", "march", "medical", "national", "nearly", "process", "provide", "relevant", "required", "risk"....
0.300
administrationapplycommercialcompletecontrolfoodinstitutionalknowledgeneedqualityrecordsreportsrequirerequiredrequirementsrequiresrisksafetysmallsupport
SHARED TOKENS (21): "administration", "apply", "commercial", "complete", "control", "food", "institutional", "knowledge", "need", "quality", "records", "reports", "require", "required", "requirements", "requires", "risk", "safety", "small", "support"....
0.300
adoptionanimalbestorganizationwelfare
SHARED TOKENS (5): "adoption", "animal", "best", "organization", "welfare". | EXACT TITLE in pets: "Best Friends Animal Society".
0.300
additionaladvancedanimalsbroaddifferentgeneralimportantjurisdictionmanagementmasspracticeproceduresroutinesystemtissuetreatmentveterinariansveterinary
SHARED TOKENS (18): "additional", "advanced", "animals", "broad", "different", "general", "important", "jurisdiction", "management", "mass", "practice", "procedures", "routine", "system", "tissue", "treatment", "veterinarians", "veterinary".
0.300
Forage ↗ Q13377214 EXACT TITLE
animalsbroaddirectlylivestockmaterial
SHARED TOKENS (5): "animals", "broad", "directly", "livestock", "material". | EXACT TITLE in biotech_life_sciences: "Forage".
0.300
animalanimalsbasiccostsdifferenteducationfoodgovernissuelifepeopleproductsprotectionroutinestatustreatmentwelfare
SHARED TOKENS (17): "animal", "animals", "basic", "costs", "different", "education", "food", "govern", "issue", "life", "people", "products", "protection", "routine", "status", "treatment", "welfare".
0.300
additionalanimalbeginningbeyondcarecompleteeducationentrygeneralimportantmedicinenationalpracticeproviderequirerequiresroleseenspecialistspecialties
SHARED TOKENS (26): "additional", "animal", "beginning", "beyond", "care", "complete", "education", "entry", "general", "important", "medicine", "national", "practice", "provide", "require", "requires", "role", "seen", "specialist", "specialties"....
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagriculturalanimalscenterscomplexcreatedeterminedevelopmentdifferentdiseaseenvironmentsfoodgovernmentgrowinghigherimportantimproveindustryinstitutionsknowledge
SHARED TOKENS (24): "additional", "agricultural", "animals", "centers", "complex", "create", "determine", "development", "different", "disease", "environments", "food", "government", "growing", "higher", "important", "improve", "industry", "institutions", "knowledge"....
0.300
Toxicology ↗ Q7218 EXACT TITLE
environmentmedicinepracticetreatmentturn
SHARED TOKENS (5): "environment", "medicine", "practice", "treatment", "turn". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.300
accessadministrationcapacitycenterschangescontroldepartmentdiseasefebruaryfoodgovernmenthealthimproveinstitutionalmainmajormedicalnationalorganizationplanned
SHARED TOKENS (23): "access", "administration", "capacity", "centers", "changes", "control", "department", "disease", "february", "food", "government", "health", "improve", "institutional", "main", "major", "medical", "national", "organization", "planned"....
0.300
codehealthlawpublicwelfare
SHARED TOKENS (5): "code", "health", "law", "public", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.300
affectbecomebuildingcategorycommercialcommunitycontroldecisionsdevelopmentdifferentestatefoundgoverngrowthjurisdictionlandlargelawlegallife
SHARED TOKENS (35): "affect", "become", "building", "category", "commercial", "community", "control", "decisions", "development", "different", "estate", "found", "govern", "growth", "jurisdiction", "land", "large", "law", "legal", "life"....
0.300
adoptionanimalbestcommunitiescommunitycostsdirectfeedfoodfoundgrowinggrowthincreaselandlifemainmeansmedicalpeoplepopulation
SHARED TOKENS (28): "adoption", "animal", "best", "communities", "community", "costs", "direct", "feed", "food", "found", "growing", "growth", "increase", "land", "life", "main", "means", "medical", "people", "population"....
0.300
accessbusinessesdevelopmentdiscoverydiseaseeducationfundinggoverngrowthhealthindustryissuelargemajormarketmedicalpolicypublicresultingsafety
SHARED TOKENS (21): "access", "businesses", "development", "discovery", "disease", "education", "funding", "govern", "growth", "health", "industry", "issue", "large", "major", "market", "medical", "policy", "public", "resulting", "safety"....
0.300
adoptionanimalanimalsbehaviorcarecommercialcontractdedicateddifferentenvironmentfacilityfoundgeneralgovernmentshandlinghomejoblawlocalmedical
SHARED TOKENS (39): "adoption", "animal", "animals", "behavior", "care", "commercial", "contract", "dedicated", "different", "environment", "facility", "found", "general", "governments", "handling", "home", "job", "law", "local", "medical"....
0.300
anothercentralcontrolcreatedepartmentdirectentitygovernmentlawlegalmanagementmarketoperatingoperationsorganizationownershiprequirerequiressize
SHARED TOKENS (19): "another", "central", "control", "create", "department", "direct", "entity", "government", "law", "legal", "management", "market", "operating", "operations", "organization", "ownership", "require", "requires", "size".
0.300
animalsbasicbecomecommercialcomplexdevelopmentdiscoveryentityfundinggovernmentsgrantshealthincreaseindustrylargemarketmeansmedicinenationalneed
SHARED TOKENS (32): "animals", "basic", "become", "commercial", "complex", "development", "discovery", "entity", "funding", "governments", "grants", "health", "increase", "industry", "large", "market", "means", "medicine", "national", "need"....
0.300
animalanimalscareclinicsemergencyenvironmentfacilitiesgeneralgeneratehealthhealthcarehomehospitalhospitalsinvolvingmaterialmedicaloperatingrequiresupplies
SHARED TOKENS (25): "animal", "animals", "care", "clinics", "emergency", "environment", "facilities", "general", "generate", "health", "healthcare", "home", "hospital", "hospitals", "involving", "material", "medical", "operating", "require", "supplies"....
0.300
accesscenterscontroldiseaseequipmentestablishedfacilitiesfacilityhealthhighermultiplepositiveproceduresprotectionprotocolsreportsrequiredsystemstraining
SHARED TOKENS (19): "access", "centers", "control", "disease", "equipment", "established", "facilities", "facility", "health", "higher", "multiple", "positive", "procedures", "protection", "protocols", "reports", "required", "systems", "training".
0.300
Estray ↗ Q3930015 KW CROSS HIGH
animalanimalscarecostsearlyfoundgenerallargelawlivestocklocalownershipplacesprocesspublicratherreportedrequiredthemvalue
SHARED TOKENS (20): "animal", "animals", "care", "costs", "early", "found", "general", "large", "law", "livestock", "local", "ownership", "places", "process", "public", "rather", "reported", "required", "them", "value".
0.300
administrationcarecentersdepartmentfacilitiesfinancinggovgovernmentshealthhealthcarehomeinsuranceoversightprocessqualityreportssystem
SHARED TOKENS (17): "administration", "care", "centers", "department", "facilities", "financing", "gov", "governments", "health", "healthcare", "home", "insurance", "oversight", "process", "quality", "reports", "system".
0.300
Histology ↗ Q7168 EXACT TITLE
animalsmedicineplacestissuevisible
SHARED TOKENS (5): "animals", "medicine", "places", "tissue", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
categorychangescontroldevelopmentfinancefinancinggeneralmanagementownershippartnershipsprivateproductsprovidepublicratherrole
SHARED TOKENS (16): "category", "changes", "control", "development", "finance", "financing", "general", "management", "ownership", "partnerships", "private", "products", "provide", "public", "rather", "role".
0.300
communityentityfinancegeneratehospitalsinstitutionlocaloperatesoperationsorganizationprivatepublicratherrevenuestatus
SHARED TOKENS (15): "community", "entity", "finance", "generate", "hospitals", "institution", "local", "operates", "operations", "organization", "private", "public", "rather", "revenue", "status".
0.300
Boise River ↗ Q891080 EXACT TITLE
agriculturalboiseidahoriverwestern
SHARED TOKENS (5): "agricultural", "boise", "idaho", "river", "western". | EXACT TITLE in biotech_life_sciences: "Boise River".
0.300
anotherbehaviorcentercompletecomplexcomponentscreatedifferentdiseasefunctionknowledgemeansmodelmodelsmultiplenetworksprotocolsratherrequiressystem
SHARED TOKENS (23): "another", "behavior", "center", "complete", "complex", "components", "create", "different", "disease", "function", "knowledge", "means", "model", "models", "multiple", "networks", "protocols", "rather", "requires", "system"....
0.300
Technology transfer ↗ KW CROSS HIGH
anothercapacitycommercialcontrolcoredevelopmentenvironmentfundinggovernmentimportantinnovationinstitutionsknowledgelicensingmarketmeansorganizationownershipprivateprocess
SHARED TOKENS (25): "another", "capacity", "commercial", "control", "core", "development", "environment", "funding", "government", "important", "innovation", "institutions", "knowledge", "licensing", "market", "means", "organization", "ownership", "private", "process"....
0.300
Animal feed ↗ Q2836947 KW CROSS HIGH
agriculturalanimalanimalsbasicchangedemandenvironmentfeedfoodgrowingimportantimprovelandlargelivestockmainmakesmakingneedprices
SHARED TOKENS (24): "agricultural", "animal", "animals", "basic", "change", "demand", "environment", "feed", "food", "growing", "important", "improve", "land", "large", "livestock", "main", "makes", "making", "need", "prices"....
0.300
decisionsdevelopmentdiagnosticdifferentdiseasehealthmedicalmedicinemodelnationalpeopleproductsproviderisksystemsthereforetreatment
SHARED TOKENS (17): "decisions", "development", "diagnostic", "different", "disease", "health", "medical", "medicine", "model", "national", "people", "products", "provide", "risk", "systems", "therefore", "treatment".
🫐 BERRY70 edges
0.280
careclassificationdiagnosticdiseaseexplainshealthcaremajormedicalpatternsphysicalpointproceduresprocessrequired
SHARED TOKENS (14): "care", "classification", "diagnostic", "disease", "explains", "healthcare", "major", "medical", "patterns", "physical", "point", "procedures", "process", "required".
0.280
anotherbecomechangecreatecurrentdevelopmentfoundimportantmajormedicalphysicalproblemsrelevantsystems
SHARED TOKENS (14): "another", "become", "change", "create", "current", "development", "found", "important", "major", "medical", "physical", "problems", "relevant", "systems".
0.280
idahomainmeridianpublic
SHARED TOKENS (4): "idaho", "main", "meridian", "public". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
0.280
departmenteducationemployeesenforcementgovernmentgovernmentsindependentlegallocalmattersnationalprotectionpublicregional
SHARED TOKENS (14): "department", "education", "employees", "enforcement", "government", "governments", "independent", "legal", "local", "matters", "national", "protection", "public", "regional".
0.280
behaviordevelopmentphysicalwelfare
SHARED TOKENS (4): "behavior", "development", "physical", "welfare". | EXACT TITLE in pets: "Dog behavior".
0.280
functionoperatesstructuresystems
SHARED TOKENS (4): "function", "operates", "structure", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.280
animalcontrolpopulationwork
SHARED TOKENS (4): "animal", "control", "population", "work". | EXACT TITLE in pets: "Animal control".
0.280
animalanimalslifeprovide
SHARED TOKENS (4): "animal", "animals", "life", "provide". | EXACT TITLE in pets: "Humane society".
0.280
careclinicsfacilitieshealthhealthcarehomehospitalhospitalsidahooperatesoperatingpeoplesupportsystem
SHARED TOKENS (14): "care", "clinics", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "operates", "operating", "people", "support", "system".
0.280
affectanimalsdiseasemanagement
SHARED TOKENS (4): "affect", "animals", "disease", "management". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.270
governmenthealthmedicalmedicinenationalreports
SHARED TOKENS (6): "government", "health", "medical", "medicine", "national", "reports". | URL->B (1): http://clinicaltrials.gov/.
0.260
Photography ↗ Q11633 KW CROSS HIGH
basecapturecreatedirectinsidemassmaterialmeansoperatespositivepracticerealvisible
SHARED TOKENS (13): "base", "capture", "create", "direct", "inside", "mass", "material", "means", "operates", "positive", "practice", "real", "visible".
0.260
centersdevelopmentemploymentgovernmenthigherinstitutionslocalnetworksplacesprivatepublicrevenuevalley
SHARED TOKENS (13): "centers", "development", "employment", "government", "higher", "institutions", "local", "networks", "places", "private", "public", "revenue", "valley".
0.260
Pharmacology ↗ Q128406 KW CROSS HIGH
broadcaredeterminediagnosticsdiscoveryfunctionhealthmainmedicalpharmaceuticalspracticerolesystems
SHARED TOKENS (13): "broad", "care", "determine", "diagnostics", "discovery", "function", "health", "main", "medical", "pharmaceuticals", "practice", "role", "systems".
0.260
animalanimalscapacitylawlifemedicalprotocolspublicqualityrequiredsafetysystemwork
SHARED TOKENS (13): "animal", "animals", "capacity", "law", "life", "medical", "protocols", "public", "quality", "required", "safety", "system", "work".
0.260
Alfalfa ↗ Q156106 EXACT TITLE
familyimportantlivestock
SHARED TOKENS (3): "family", "important", "livestock". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.260
Cell culture ↗ Q189082 KW CROSS HIGH
animalculturedevelopmentenvironmentgrowthneedpopulationpracticeprocessrequiresourcesuppliestissue
SHARED TOKENS (13): "animal", "culture", "development", "environment", "growth", "need", "population", "practice", "process", "require", "source", "supplies", "tissue".
0.260
administrationcenterchangescomplianceentityeventsfacilitiesfoodlegallicenseproductsreportsrequirements
SHARED TOKENS (13): "administration", "center", "changes", "compliance", "entity", "events", "facilities", "food", "legal", "license", "products", "reports", "requirements".
0.260
Dog training ↗ Q38490 KW CROSS HIGH
animalbehaviorenvironmenteventsfoundlesslifepositivepracticerolestimestrainedtraining
SHARED TOKENS (13): "animal", "behavior", "environment", "events", "found", "less", "life", "positive", "practice", "roles", "times", "trained", "training".
0.260
carecommunitiescurrenteconomyfinancehealthhealthcareindustrymedicalpharmaceuticalsproductsrequirementssystem
SHARED TOKENS (13): "care", "communities", "current", "economy", "finance", "health", "healthcare", "industry", "medical", "pharmaceuticals", "products", "requirements", "system".
0.260
Dog breed ↗ KW CROSS HIGH
behaviordifferentfunctionnationalorganizationphysicalroleshowshowssizesmallstandardthem
SHARED TOKENS (13): "behavior", "different", "function", "national", "organization", "physical", "role", "show", "shows", "size", "small", "standard", "them".
0.260
applycodeexpandedfoundfunctiongeneralimproveknowledgemarketmedicineprocessstructurevalue
SHARED TOKENS (13): "apply", "code", "expanded", "found", "function", "general", "improve", "knowledge", "market", "medicine", "process", "structure", "value".
0.260
agriculturalcommercialcommunitiescurrentdepartmentdirectlyfebruaryfoodgovernmentlivestocknationalreportssafety
SHARED TOKENS (13): "agricultural", "commercial", "communities", "current", "department", "directly", "february", "food", "government", "livestock", "national", "reports", "safety".
0.260
administrationcostsdepartmenteducationemploymentestablishedhealthlaborlawoutreachreducesafetytraining
SHARED TOKENS (13): "administration", "costs", "department", "education", "employment", "established", "health", "labor", "law", "outreach", "reduce", "safety", "training".
0.260
Dog grooming ↗ Q38479 KW CROSS HIGH
animalscarecleaningdifferentfoundknowledgephysicalprocessproviderequireresponsibletrainedwork
SHARED TOKENS (13): "animals", "care", "cleaning", "different", "found", "knowledge", "physical", "process", "provide", "require", "responsible", "trained", "work".
0.260
businessesonlineprocess
SHARED TOKENS (3): "businesses", "online", "process". | EXACT TITLE in pets: "Fundraising".
0.240
animalanimalshealthhealthcareneedpeoplepositiverequiredrequirementsrulessupporttrained
SHARED TOKENS (12): "animal", "animals", "health", "healthcare", "need", "people", "positive", "required", "requirements", "rules", "support", "trained".
0.240
animalbehaviordifferentenvironmenthealthimportantmedicalphysicalproblemsratherspacestatus
SHARED TOKENS (12): "animal", "behavior", "different", "environment", "health", "important", "medical", "physical", "problems", "rather", "space", "status".
0.240
broaddifferentformationimproveinvolvingmedicalmedicinepracticerequiresupportsystemtissue
SHARED TOKENS (12): "broad", "different", "formation", "improve", "involving", "medical", "medicine", "practice", "require", "support", "system", "tissue".
0.240
beyondbusinessesearlyfundinggrowinggrowthlargemodelprivatepublicrapiduncertainty
SHARED TOKENS (12): "beyond", "businesses", "early", "funding", "growing", "growth", "large", "model", "private", "public", "rapid", "uncertainty".
0.240
Raw feeding ↗ KW CROSS HIGH
animalschangecommercialculturefeedfoodhealthpeoplepracticeproductsrisksurrounding
SHARED TOKENS (12): "animals", "change", "commercial", "culture", "feed", "food", "health", "people", "practice", "products", "risk", "surrounding".
0.240
becomebroadbuildingchangesdetectiondifferentmainmedicalproceduresprocessregionsmall
SHARED TOKENS (12): "become", "broad", "building", "changes", "detection", "different", "main", "medical", "procedures", "process", "region", "small".
0.240
Cold chain ↗ KW CROSS HIGH
agriculturaldistributedequipmentfoodmanagementpharmaceuticalsproductsqualityrequiressafetysupplywaste
SHARED TOKENS (12): "agricultural", "distributed", "equipment", "food", "management", "pharmaceuticals", "products", "quality", "requires", "safety", "supply", "waste".
0.220
animalanimalseducationfoodmedicalmedicineorganizationproductssupportsveterinariansveterinary
SHARED TOKENS (11): "animal", "animals", "education", "food", "medical", "medicine", "organization", "products", "supports", "veterinarians", "veterinary".
0.220
Proteomics ↗ Q471857 KW CROSS HIGH
expandedfoodformationimportantlargemassrequirementsscalestructuresystemtissue
SHARED TOKENS (11): "expanded", "food", "formation", "important", "large", "mass", "requirements", "scale", "structure", "system", "tissue".
0.220
lawwaste
SHARED TOKENS (2): "law", "waste". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.220
animalscarediseaseequinemedicalmedicineroutinespecialtiestreatmentveterinarywork
SHARED TOKENS (11): "animals", "care", "disease", "equine", "medical", "medicine", "routine", "specialties", "treatment", "veterinary", "work".
0.220
Petfinder ↗ Q7178304 KW CROSS HIGH
adoptionanimalanimalscommerciallivestocknearlyonlineoperatesreportsservingsmall
SHARED TOKENS (11): "adoption", "animal", "animals", "commercial", "livestock", "nearly", "online", "operates", "reports", "serving", "small".
0.220
applybasic
SHARED TOKENS (2): "apply", "basic". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.220
animalsanotherfoodhealthlifemajormedicinephysicalqualityscalestandard
SHARED TOKENS (11): "animals", "another", "food", "health", "life", "major", "medicine", "physical", "quality", "scale", "standard".
0.210
Serology ↗ Q502159 EXACT TITLE
disease
SHARED TOKENS (1): "disease". | EXACT TITLE in biotech_life_sciences: "Serology".
0.210
systems
SHARED TOKENS (1): "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.210
Dog park ↗ Q38516 EXACT TITLE
environment
SHARED TOKENS (1): "environment". | EXACT TITLE in pets: "Dog park".
0.200
animalhealthjobmedicineperformspracticeproceduresrolesystemveterinary
SHARED TOKENS (10): "animal", "health", "job", "medicine", "performs", "practice", "procedures", "role", "system", "veterinary".
0.200
basiccomponentsdetectionfunctionhealthphysicalpopulationpracticeprocesssize
SHARED TOKENS (10): "basic", "components", "detection", "function", "health", "physical", "population", "practice", "process", "size".
0.200
EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.200
Biophysics ↗ Q7100 EXACT TITLE
EXACT TITLE in biotech_life_sciences: "Biophysics".
0.200
Biomarker ↗ EXACT TITLE
indicatornormalresponsessoft
EXACT TITLE in biotech_life_sciences: "Biomarker".
0.180
animalanimalscontrolentitygovernmenthealthimportantpublicsafety
SHARED TOKENS (9): "animal", "animals", "control", "entity", "government", "health", "important", "public", "safety".
0.180
affectdiseaseestablishedhealthlessmultipleproblemsqualityrisk
SHARED TOKENS (9): "affect", "disease", "established", "health", "less", "multiple", "problems", "quality", "risk".
0.180
Feral cat ↗ Q2404562 KW CROSS HIGH
animalanimalsbecomecontrolenvironmentsfeedlocalpeoplethem
SHARED TOKENS (9): "animal", "animals", "become", "control", "environments", "feed", "local", "people", "them".
0.180
Dog licence ↗ Q38683 KW CROSS HIGH
additionalanimalcurrentfoundlicensingorganizationrequirerequiredsmall
SHARED TOKENS (9): "additional", "animal", "current", "found", "licensing", "organization", "require", "required", "small".
0.160
adaboisegovernmentidahomainmunicipalnearlypopulation
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "main", "municipal", "nearly", "population".
0.160
Volunteering ↗ Q188844 KW CROSS HIGH
communityeducationemergencylabormedicineprovidetrainingwork
SHARED TOKENS (8): "community", "education", "emergency", "labor", "medicine", "provide", "training", "work".
0.140
animalanimalsenvironmentmajormedicinetreatmentveterinary
SHARED TOKENS (7): "animal", "animals", "environment", "major", "medicine", "treatment", "veterinary".
0.140
Exotic pet ↗ Q3247163 KW CROSS HIGH
animalanimalsbecomecultureestablishedratherrelatively
SHARED TOKENS (7): "animal", "animals", "become", "culture", "established", "rather", "relatively".
0.140
Medical test ↗ Q2671652 KW CROSS HIGH
determinediagnosticdiagnosticsdiseasemedicalphysicaltreatment
SHARED TOKENS (7): "determine", "diagnostic", "diagnostics", "disease", "medical", "physical", "treatment".
0.140
consumergeneralhighermultipleonlineprocessproducts
SHARED TOKENS (7): "consumer", "general", "higher", "multiple", "online", "process", "products".
0.140
Water quality ↗ Q625376 KW CROSS HIGH
compliancehealthphysicalqualitysafetysupplytreatment
SHARED TOKENS (7): "compliance", "health", "physical", "quality", "safety", "supply", "treatment".
0.140
administrationdedicatedfoodmodelsplacespointseen
SHARED TOKENS (7): "administration", "dedicated", "food", "models", "places", "point", "seen".
0.140
centerconsumerfinancingmedicalonlineproductsveterinary
SHARED TOKENS (7): "center", "consumer", "financing", "medical", "online", "products", "veterinary".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahonearlypopulation
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "nearly", "population".
0.120
animalscomplexmainmodelmodelsplaces
SHARED TOKENS (6): "animals", "complex", "main", "model", "models", "places".
0.120
animalanimalsdedicatedmeansorganizationprovide
SHARED TOKENS (6): "animal", "animals", "dedicated", "means", "organization", "provide".
0.120
becomecapabilitydifferentmedicinemultipletreatment
SHARED TOKENS (6): "become", "capability", "different", "medicine", "multiple", "treatment".
0.120
Pet sitting ↗ Q13414620 KW CROSS HIGH
anothercarehomeorganizationrequiredtraining
SHARED TOKENS (6): "another", "care", "home", "organization", "required", "training".
0.120
Seed testing ↗ Q7445654 KW CROSS HIGH
commerciallydedicateddetermineevaluatequalitytrained
SHARED TOKENS (6): "commercially", "dedicated", "determine", "evaluate", "quality", "trained".
0.100
Neutering ↗ Q3482590 KW CROSS HIGH
animalanimalslargerequiresystem
SHARED TOKENS (5): "animal", "animals", "large", "require", "system".
0.100
agriculturalidaholandmajorriver
SHARED TOKENS (5): "agricultural", "idaho", "land", "major", "river".
0.100
Select agent ↗ KW CROSS HIGH
departmenthealthlawpublicsafety
SHARED TOKENS (5): "department", "health", "law", "public", "safety".
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Pets × Biotech Life Sciences 8 QID bridges 193 edges 5,429 ext links 2026-07-17 22:37:20 UTC b449b934e37a9574
Pets corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Pets ↗ boisestandard.org/standard ↗
Parent Corridors
Pets × All Other Verticals