—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Military ↔ relates to ↔ Transportation Infrastructure

17 Wikipedia bridge articles confirmed in both vertical ledgers. 246 deterministic cross-vertical edges. 6,478 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
246 Cross Edges
6,478 External Sources
274 Wikipedia Articles
23 🌲 Evergreen
174 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Military
× Transportation Infrastructure
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
246
External Sources Harvested
6,478
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  35 shared tokens
QID Bridge Titles (17)
IdahoZoningTreasure ValleyLand-use planningFederal Aviation AdministrationBoise State UniversityBoise AirportEmergency medical servicesCollege of Western IdahoNampa, IdahoEnvironmental impact assessmentDangerous goodsBoise, IdahoCaldwell, IdahoAda County, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanmileswesternpublicadacapitallandoregonwestdevelopmentcollegecanyonmillionnorthwestriveruseslocal
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:09:44 UTC
Content Hash
40cd66db821aa310
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (35): "approximately", "associated", "boise", "capital", "contains", "distinct", "economy", "forest", "idaho", "land", "linked", "manufacturing", "miles", "million", "mining", "mountain", "national", "northwest", "official", "oregon".... | EXACT TITLE in military: "Idaho". | EXACT TITLE in transportation_infrastructure: "Idaho".
approximatelyassociatedboisecapitalcontainsdistincteconomyforestidaholandlinkedmanufacturingmilesmillionminingmountainnationalnorthwestofficialoregonpopulationpriorriversectorseparatesharessignificantsmallsouthsupplies+5
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (30): "allowing", "buildings", "compatible", "density", "developed", "development", "different", "form", "government", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "property", "regulations", "regulatory".... | EXACT TITLE in military: "Zoning". | EXACT TITLE in transportation_infrastructure: "Zoning".
allowingbuildingscompatibledensitydevelopeddevelopmentdifferentformgovernmentgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesinglesizesystemsurbanuseszoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (18): "boise", "chambers", "commerce", "historically", "idaho", "land", "local", "metropolitan", "opportunities", "oregon", "primarily", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in military: "Treasure Valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley".
boisechamberscommercehistoricallyidaholandlocalmetropolitanopportunitiesoregonprimarilyregionresourcesriverruraltreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in military (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (44): "act", "american", "authority", "central", "changes", "communities", "community", "conditions", "costs", "creating", "depends", "design", "development", "districts", "environmental", "essential", "exposure", "facilities", "function", "future".... | EXACT TITLE in military: "Land-use planning".
actamericanauthoritycentralchangescommunitiescommunityconditionscostscreatingdependsdesigndevelopmentdistrictsenvironmentalessentialexposurefacilitiesfunctionfuturehealthinstitutejurisdictionslandland-usemeansneedspatternsphysicalplan+14
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Federal Aviation Administration
Q335357 EXACT TITLE 1.000
QID OVERLAP: Q335357 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (23): "administration", "air", "aircraft", "assets", "authority", "aviation", "certification", "civil", "commercial", "control", "created", "department", "faa", "federal", "government", "organization", "personnel", "setting", "space", "standards".... | EXACT TITLE in military: "Federal Aviation Administration". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
administrationairaircraftassetsauthorityaviationcertificationcivilcommercialcontrolcreateddepartmentfaafederalgovernmentorganizationpersonnelsettingspacestandardssurroundingtransportationvehicles
The Federal Aviation Administration (FAA) is a U.S. federal government agency within the U.S. Department of Transportation that regulates civil aviation in the United States and surrounding international waters. Its powers include air traffic control, certification of personnel and aircraft, setting standards for airports, and protection of U.S. assets during the launch or re-entry of commercial space vehicles. Powers over neighboring international waters were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S.
s were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (23): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "health", "idaho", "master", "million", "mountain", "program", "programs", "public", "reported", "research".... | EXACT TITLE in military: "Boise State University". | EXACT TITLE in transportation_infrastructure: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringhealthidahomastermillionmountainprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (37): "ada", "air", "aircraft", "airport", "aviation", "base", "boi", "boise", "center", "combined", "commercial", "department", "faa", "facility", "field", "forest", "functions", "general", "gowen", "idaho".... | EXACT TITLE in military: "Boise Airport". | EXACT TITLE in transportation_infrastructure: "Boise Airport".
adaairaircraftairportaviationbaseboiboisecentercombinedcommercialdepartmentfaafacilityfieldforestfunctionsgeneralgowenidahointeragencymilesmilitarymillionnationaloperatedoperatespassengerreceiverequiring+7
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Emergency medical services
Q860447 EXACT TITLE 1.000
QID OVERLAP: Q860447 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (44): "additional", "advanced", "agencies", "aircraft", "ambulance", "authorities", "businesses", "care", "contact", "corps", "department", "developing", "emergency", "ems", "facilities", "historically", "hospital", "medical", "model", "operate".... | EXACT TITLE in military: "Emergency medical services".
additionaladvancedagenciesaircraftambulanceauthoritiesbusinessescarecontactcorpsdepartmentdevelopingemergencyemsfacilitieshistoricallyhospitalmedicalmodeloperatepersonnelplacespresentprimaryprovideprovidingpublicqualificationrescueresources+14
ave personnel who retain at least basic life support (BLS) certifications. In English-speaking countries, they are known as emergency medical technicians (EMTs) and paramedics, with the latter having additional training such as advanced life support (ALS) skills. Physicians and nurses may also provide pre-hospital care to varying degrees in certain countries, a model which is popular in Europe. History Precursors Emergency care in the field has been rendered in different forms since the beginning of recorded history. The New Testament contains the parable of the Good Samaritan, in which a man who has been beaten is cared for by a passing Samaritan. Luke 10:34 (NIV) – "He went to him and bandaged his wounds, pouring on oil and wine.
First aid consists of basic skills that are commonly taught to members of the public, such as cardiopulmonary resuscitation, bandaging wounds and saving someone from choking. Basic Life Support (BLS) is often the lowest level of training that can be held by those who treat patients on an ambulance. Commonly, it includes administering oxygen therapy, some drugs and a few invasive treatments. BLS personnel may either operate a BLS ambulance on their own, or assist a higher qualified crewmate on an ALS ambulance. In English-speaking countries, BLS ambulance crew members are known as emergency medical technicians, emergency care assistants or Primary care paramedics in Canada. Intermediate Life Support (ILS), also known as Limited Advanced Life Support (LALS), is positioned between BLS and ALS but is less common than both. It is commonly a BLS provider with a moderately expanded skill set (such as an AEMT, but where it is present it usually replaces BLS. Advanced Life Support (ALS) has a considerably expanded range of skills such as intravenous therapy, endotracheal intubation, cricothyrotomy and interpretation of electrocardiograms. The scope of this higher tier response varies considerably by country. Paramedics commonly provide ALS, but some countries require it to be a higher level of care and instead employ physicians in this role. Additionally Advanced Life Support includes administering therapeutic doses of electrical shock to those who are in cardiac arrest or using drugs to stimulate the heart, Airway therapy, and so on and so forth. Most ambulances are equipped with advanced Life Support equipment and have paramedics on board. While some fire departments have ambulances, first aid and squads utilize ambulances for emergency medical services. Critical Care Transport (CCT or CCP), also known as medical retrieval or rendez vous MICU protocol in some countries (Australia, NZ, Great Britain, and Francophone Canada) refers to the critical care transport of patients between hospitals (as opposed to pre-hospital). Such services are a key element in regionalized systems of hospital care where intensive care services are centralized to a few specialist hospitals. An example of this is the Emergency Medical Retrieval Service in Scotland.
Emergency medical technicians are usually able to perform a wide range of emergency care skills, such as automated defibrillation, care of spinal injuries and oxygen therapy. In few jurisdictions, some EMTs are able to perform duties as IV and IO cannulation, administration of a limited number of drugs (including but not limited to Epinephrine, Narcan, Oxygen, Aspirin, Nitroglycerin – dependent on country, state, and medical direction), more advanced airway procedures, CPAP, and limited cardiac monitoring. Most advanced procedures and skills are not within the national scope of practice for an EMT. As such most states require additional training and certifications to perform above the national curriculum standards. In the United States, an EMT certification requires intense courses and training in field skills. Certifications are state-specific and last varying durations, though National Registry certification simplifies the reciprocity process in many states.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in military (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (28): "academic", "ada", "boise", "canyon", "college", "community", "cwi", "development", "education", "governed", "idaho", "large", "population", "primary", "programs", "public", "reported", "residents", "southwest", "student".... | EXACT TITLE in military: "College of Western Idaho". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
academicadaboisecanyoncollegecommunitycwidevelopmenteducationgovernedidaholargepopulationprimaryprogramspublicreportedresidentssouthweststudentstudentstechnicalthroughouttransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in military (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (18): "according", "boise", "canyon", "college", "comes", "home", "idaho", "interstate", "meaning", "metropolitan", "miles", "northwest", "population", "principal", "student", "university", "west", "western".
accordingboisecanyoncollegecomeshomeidahointerstatemeaningmetropolitanmilesnorthwestpopulationprincipalstudentuniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Environmental impact assessment
Q320389 QID OVERLAP 0.800
QID OVERLAP: Q320389 in military (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (31): "applies", "context", "decision", "decisions", "development", "documentation", "environmental", "governed", "identifying", "impacts", "justify", "major", "making", "management", "participation", "plan", "plans", "policy", "potential", "prior"....
appliescontextdecisiondecisionsdevelopmentdocumentationenvironmentalgovernedidentifyingimpactsjustifymajormakingmanagementparticipationplanplanspolicypotentialpriorprogramprojectprojectsproposedpublicratherrelevantrequirereviewrules+1
action. In this context, the term "environmental impact assessment" is usually used when applied to actual projects by individuals or companies and the term "strategic environmental assessment" (SEA) applies to policies, plans and programmes most often proposed by organs of state. It is a tool of environmental management forming a part of project approval and decision-making. Environmental assessments may be governed by rules of administrative procedure regarding public participation and documentation of decision making, and may be subject to judicial review. The purpose of the assessment is to ensure that decision-makers consider the environmental impacts when deciding whether or not to proceed with a project. The International Association for Impact Assessment (IAIA) defines an environmental impact assessment as "the process of identifying, predicting, evaluating and mitigating the biophysical, social, and other relevant effects of development proposals prior to major decisions being taken and commitments made".
Egypt Environmental Impact Assessment (EIA) EIA is implemented in Egypt under the umbrella of the Ministry of state for environmental affairs. The Egyptian Environmental Affairs Agency (EEAA) is responsible for the EIA services. In June 1997, the responsibility of Egypt's first full-time Minister of State for Environmental Affairs was assigned as stated in the Presidential Decree no.275/1997. From thereon, the new ministry has focused, in close collaboration with the national and international development partners, on defining environmental policies, setting priorities and implementing initiatives within a context of sustainable development. According to the Law 4/1994 for the Protection of the Environment, the Egyptian Environmental Affairs Agency (EEAA) was restructured with the new mandate to substitute the institution initially established in 1982. At the central level, EEAA represents the executive arm of the Ministry. The purpose of EIA is to ensure the protection and conservation of the environment and natural resources including human health aspects against uncontrolled development. The long-term objective is to ensure a sustainable economic development that meets present needs without compromising future generations ability to meet their own needs.
Transboundary application Environmental threats do not respect national borders. International pollution can have detrimental effects on the atmosphere, oceans, rivers, aquifers, farmland, the weather and biodiversity. Global climate change is transnational. Specific pollution threats include acid rain, radioactive contamination, debris in outer space, stratospheric ozone depletion and toxic oil spills. The Chernobyl disaster, precipitated by a nuclear accident on April 26, 1986, is a stark reminder of the devastating effects of transboundary nuclear pollution. Environmental protection is inherently a cross-border issue and has led to the creation of transnational regulation via multilateral and bilateral treaties. The United Nations Conference on the Human Environment (UNCHE or Stockholm Conference) held in Stockholm in 1972 and the United Nations Conference on the Environment and Development (UNCED or Rio Summit, Rio Conference, or Earth Summit) held in Rio de Janeiro in 1992 were key in the creation of about 1,000 international instruments that include at least some provisions related to the environment and its protection. The United Nations Economic Commission for Europe's Convention on Environmental Impact Assessment in a Transboundary Context (Espoo Convention) was negotiated to provide an international legal framework for transboundary EIA. However, as there is no universal legislature or administration with a comprehensive mandate, most international treaties exist parallel to one another and are further developed without the benefit of consideration being given to potential conflicts with other agreements. There is also the issue of international enforcement. This has led to duplications and failures, in part due to an inability to enforce agreements.
Dangerous goods
Q757138 QID OVERLAP 0.800
QID OVERLAP: Q757138 in military (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (18): "air", "conditions", "containing", "creates", "environment", "even", "health", "identification", "materials", "personnel", "physical", "property", "public", "regulations", "safety", "system", "them", "trained".
airconditionscontainingcreatesenvironmentevenhealthidentificationmaterialspersonnelphysicalpropertypublicregulationssafetysystemthemtrained
r, and explosive is indicated with orange, because mixing red (flammable) with yellow (oxidizing agent) creates orange. A nonflammable and nontoxic gas is indicated with green, because all compressed air vessels were this color in France after World War II, and France was where the diamond system of hazmat identification originated. Global regulations The most widely applied regulatory scheme is that for the transportation of dangerous goods. The United Nations Economic and Social Council issues the UN Recommendations on the Transport of Dangerous Goods, which form the basis for most regional, national, and international regulatory schemes. For instance, the International Civil Aviation Organization has developed dangerous goods regulations for air transport of hazardous materials that are based upon the UN model but modified to accommodate unique aspects of air transport. Individual airline and governmental requirements are incorporated with this by the International Air Transport Association to produce the widely used IATA Dangerous Goods Regulations (DGR). Similarly, the International Maritime Organization (IMO) has developed the International Maritime Dangerous Goods Code ("IMDG Code", part of the International Convention for the Safety of Life at Sea) for transportation of dangerous goods by sea. IMO member countries have also developed the HNS Convention to provide compensation in case of dangerous goods spills in the sea. The Intergovernmental Organisation for International Carriage by Rail has developed the regulations concerning the International Carriage of Dangerous Goods by Rail ("RID", part of the Convention concerning International Carriage by Rail). Many individual nations have also structured their dangerous goods transportation regulations to harmonize with the UN model in organization as well as in specific requirements. The Globally Harmonized System of Classification and Labelling of Chemicals (GHS) is an internationally agreed upon system set to replace the various classification and labeling standards used in different countries.
The most widely applied regulatory scheme is that for the transportation of dangerous goods. The United Nations Economic and Social Council issues the UN Recommendations on the Transport of Dangerous Goods, which form the basis for most regional, national, and international regulatory schemes. For instance, the International Civil Aviation Organization has developed dangerous goods regulations for air transport of hazardous materials that are based upon the UN model but modified to accommodate unique aspects of air transport. Individual airline and governmental requirements are incorporated with this by the International Air Transport Association to produce the widely used IATA Dangerous Goods Regulations (DGR). Similarly, the International Maritime Organization (IMO) has developed the International Maritime Dangerous Goods Code ("IMDG Code", part of the International Convention for the Safety of Life at Sea) for transportation of dangerous goods by sea. IMO member countries have also developed the HNS Convention to provide compensation in case of dangerous goods spills in the sea. The Intergovernmental Organisation for International Carriage by Rail has developed the regulations concerning the International Carriage of Dangerous Goods by Rail ("RID", part of the Convention concerning International Carriage by Rail). Many individual nations have also structured their dangerous goods transportation regulations to harmonize with the UN model in organization as well as in specific requirements. The Globally Harmonized System of Classification and Labelling of Chemicals (GHS) is an internationally agreed upon system set to replace the various classification and labeling standards used in different countries.
Transport documents One of the transport regulations is that, as an assistance during emergency situations, written instructions how to deal in such need to be carried and easily accessible in the driver's cabin. Dangerous goods shipments also require a dangerous goods transport document prepared by the shipper. The information that is generally required includes the shipper's name and address; the consignee's name and address; descriptions of each of the dangerous goods, along with their quantity, classification, and packaging; and emergency contact information.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in military (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (19): "ada", "annual", "block", "boise", "capital", "employers", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "miles", "oregon", "population", "river", "technology", "treasure", "valley".
adaannualblockboisecapitalemployershomeidaholocallymajormanufacturingmetropolitanmilesoregonpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Caldwell, Idaho
Q849592 QID OVERLAP 0.740
QID OVERLAP: Q849592 in military (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (12): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "oregon", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilesoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in military (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private", "range".
adaboisecapitalhomeidahojurisdictionlocalmetropolitannorthwestpopulationprivaterange
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in military (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "population".
boisecaldwellcanyonidahomakingmetropolitanpopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in military (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "making", "population".
adaamongboisecapitalidahomakingpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
229 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP229 edges
🌲 EVERGREEN6 edges
0.650
acquisitionbroadcommerceconstructioncreatedfederalgovernmentindustryinterstatejurisdictionmattersoversightpassengerpipelinesrailroadregulationregulatoryrelevantservestransportation
SHARED TOKENS (20): "acquisition", "broad", "commerce", "construction", "created", "federal", "government", "industry", "interstate", "jurisdiction", "matters", "oversight", "passenger", "pipelines", "railroad", "regulation", "regulatory", "relevant", "serves", "transportation". | URL->B (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
actapproximatelyarmychaptercodecoordinationcreatedfederalforcesidaholocalmilitarynationalorganizationpresentreceiveregulationssectionsupportsystem
SHARED TOKENS (21): "act", "approximately", "army", "chapter", "code", "coordination", "created", "federal", "forces", "idaho", "local", "military", "national", "organization", "present", "receive", "regulations", "section", "support", "system".... | URL->A (3): https://www.imd.idaho.gov/idaho-army-national-guard/, https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "Idaho Army National Guard".
0.650
acquisitionadministrationairportamericanaviationcommercialcostsfederalfuelfundinggeneralgrantsimprovelandlightingpercentplanningprogramprojectspublic
SHARED TOKENS (25): "acquisition", "administration", "airport", "american", "aviation", "commercial", "costs", "federal", "fuel", "funding", "general", "grants", "improve", "land", "lighting", "percent", "planning", "program", "projects", "public".... | URL->B (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesairamonganotherauthoritiesauthoritybaseboisecanyoncapacitycapitalcenterconventionalcostsdemanddestinationemployeremployers
SHARED TOKENS (74): "ada", "additional", "agencies", "air", "among", "another", "authorities", "authority", "base", "boise", "canyon", "capacity", "capital", "center", "conventional", "costs", "demand", "destination", "employer", "employers".... | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.630
armyboiseengineerfieldformationgowenidahomilitarynationaloregonriversupportthroughoutunit
SHARED TOKENS (14): "army", "boise", "engineer", "field", "formation", "gowen", "idaho", "military", "national", "oregon", "river", "support", "throughout", "unit". | URL->A (1): https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "116th Cavalry Brigade Combat Team".
0.630
airaircraftbaseboisefederalfieldgowenidahomilitarymissionsnationaloperatessupportunit
SHARED TOKENS (14): "air", "aircraft", "base", "boise", "federal", "field", "gowen", "idaho", "military", "missions", "national", "operates", "support", "unit". | URL->A (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in military: "124th Fighter Wing".
🌿 BRANCH174 edges
0.590
airarmyboisegeneralidahojurisdictionmilitarynationalofficereservethoughunit
SHARED TOKENS (12): "air", "army", "boise", "general", "idaho", "jurisdiction", "military", "national", "office", "reserve", "though", "unit". | URL->A (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in military: "Idaho Air National Guard".
0.590
createdcreatingdepartmentenforcementidaholawmunicipalorganizationpolicepresentpublicstatewide
SHARED TOKENS (12): "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "present", "public", "statewide". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.550
americanboisefieldgowenhistoryidahomilitarynearparktraining
SHARED TOKENS (10): "american", "boise", "field", "gowen", "history", "idaho", "military", "near", "park", "training". | URL->A (1): https://www.idahomilitarymuseum.org/. | EXACT TITLE in military: "Idaho Military History Museum".
0.500
airaircraftassignmentbaseboisecomposedfaafacilityhomeidahoinstallationinterstatemilesmissionmountainnearoperationspersonnelpopulationprimary
SHARED TOKENS (26): "air", "aircraft", "assignment", "base", "boise", "composed", "faa", "facility", "home", "idaho", "installation", "interstate", "miles", "mission", "mountain", "near", "operations", "personnel", "population", "primary".... | EXACT TITLE in military: "Mountain Home Air Force Base".
0.500
actagenciesamericanamongapproximatelycreateddepartmentenergyestateexistingfederalfuturegeneralgovernmenthealthidaholandlandscapemanagementmiles
SHARED TOKENS (35): "act", "agencies", "american", "among", "approximately", "created", "department", "energy", "estate", "existing", "federal", "future", "general", "government", "health", "idaho", "land", "landscape", "management", "miles".... | EXACT TITLE in military: "Bureau of Land Management".
0.500
affectedassistanceconstructioncontinuingdirectlyemergencyespeciallyestablishingfoodgovernmenthealthimproveinfrastructurelimitedmanagementneedspermanentplacespresentprovide
SHARED TOKENS (31): "affected", "assistance", "construction", "continuing", "directly", "emergency", "especially", "establishing", "food", "government", "health", "improve", "infrastructure", "limited", "management", "needs", "permanent", "places", "present", "provide".... | EXACT TITLE in military: "Disaster response".
0.500
advocacyamericanapproximatelycommunitycouncildevelopmenteducationestablishednonprofitorganizationorganizationspolicyprogramspublicresearch
SHARED TOKENS (15): "advocacy", "american", "approximately", "community", "council", "development", "education", "established", "nonprofit", "organization", "organizations", "policy", "programs", "public", "research". | EXACT TITLE in military: "American Council on Education".
0.500
associatedbuildingsbuiltconstructiondesigndevelopmentequivalentexpandextendfacilitiesfinancingimproveindustrialindustryinfrastructuremaintenancepercentplanningwork
SHARED TOKENS (19): "associated", "buildings", "built", "construction", "design", "development", "equivalent", "expand", "extend", "facilities", "financing", "improve", "industrial", "industry", "infrastructure", "maintenance", "percent", "planning", "work". | EXACT TITLE in military: "Construction". | EXACT TITLE in transportation_infrastructure: "Construction".
0.500
corridorscreatedenvironmentalespeciallyindustriallandlandscapemobilityparkrightsruralserveservesurbanusersutility
SHARED TOKENS (16): "corridors", "created", "environmental", "especially", "industrial", "land", "landscape", "mobility", "park", "rights", "rural", "serve", "serves", "urban", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
Wildfire ↗ Q169950 EXACT TITLE
controlledcreatecreatesdirectequipmentespeciallyeventforestfuelsfundinggrowthhealthimpactslandland-usemanagementmaterialopenoregonphysical
SHARED TOKENS (26): "controlled", "create", "creates", "direct", "equipment", "especially", "event", "forest", "fuels", "funding", "growth", "health", "impacts", "land", "land-use", "management", "material", "open", "oregon", "physical".... | EXACT TITLE in military: "Wildfire".
0.500
airairportaviationcanyoncivilconstructionemergencyfaaflightgeneralhomeidahoindustrialintegratedmilitarymissionmountainmunicipalnationalplan
SHARED TOKENS (25): "air", "airport", "aviation", "canyon", "civil", "construction", "emergency", "faa", "flight", "general", "home", "idaho", "industrial", "integrated", "military", "mission", "mountain", "municipal", "national", "plan".... | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
World War II ↗ Q362 EXACT TITLE
advancedagainstamericancentralcivilcontinuedcouncilcreateddecemberdocumententerestablishedeventsexpansionforcesfuturehistoryinfluencemajormillion
SHARED TOKENS (27): "advanced", "against", "american", "central", "civil", "continued", "council", "created", "december", "document", "enter", "established", "events", "expansion", "forces", "future", "history", "influence", "major", "million".... | EXACT TITLE in military: "World War II".
0.500
affectedcommunitycoordinateddifferentemergencyeventsfederalimpactslocalmanagementneedsorganizationsprofessionalprovidingreducerequiresrescueresponsesearch
SHARED TOKENS (19): "affected", "community", "coordinated", "different", "emergency", "events", "federal", "impacts", "local", "management", "needs", "organizations", "professional", "providing", "reduce", "requires", "rescue", "response", "search". | EXACT TITLE in military: "Emergency management".
0.500
aircentercommercialconsumerscoordinatededicateddeliverydemanddirectlydistributionequipmentfacilityfirmsfunctionhandlinglaborlargelogisticsmarketnetwork
SHARED TOKENS (33): "air", "center", "commercial", "consumers", "coordinate", "dedicated", "delivery", "demand", "directly", "distribution", "equipment", "facility", "firms", "function", "handling", "labor", "large", "logistics", "market", "network".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
accessactauthoritiescontinuingcreatedexistingfederalfederallyformationfundingfuturegovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplans
SHARED TOKENS (28): "access", "act", "authorities", "continuing", "created", "existing", "federal", "federally", "formation", "funding", "future", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalimplementationintegratednetworkproviderequirementssignalstechnologytelecommunicationstransferuses
SHARED TOKENS (15): "access", "context", "data", "different", "digital", "implementation", "integrated", "network", "provide", "requirements", "signals", "technology", "telecommunications", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
broadercoveringdevelopmentenvironmentalgrowthindividualindustrialinfrastructurelandland-uselargerlawsmanagementmilitarynationalneedsnetworkplanningplansregion
SHARED TOKENS (31): "broader", "covering", "development", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "laws", "management", "military", "national", "needs", "network", "planning", "plans", "region".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
activeairarmyarticlebackcomponentscomposedcontrolfederalforcesgovernmentlegallocalmilitarymissionsnationalorganizationpersonnelproposedrecruitment
SHARED TOKENS (29): "active", "air", "army", "article", "back", "components", "composed", "control", "federal", "forces", "government", "legal", "local", "military", "missions", "national", "organization", "personnel", "proposed", "recruitment".... | EXACT TITLE in military: "National Guard (United States)".
0.500
activityadministrationagenciesanotherbuiltchangescivilcontrolcoordinatecreateddecisionsdivisioneducationenforcementenvironmentenvironmentalexpandedgoverninggovernmentinfluence
SHARED TOKENS (35): "activity", "administration", "agencies", "another", "built", "changes", "civil", "control", "coordinate", "created", "decisions", "division", "education", "enforcement", "environment", "environmental", "expanded", "governing", "government", "influence".... | EXACT TITLE in military: "Administrative law".
0.500
accessagenciescommunitycomponentscomposedconditionscreateddevelopmentdifferentdistincteconomyelectricalemergencyenforcementenvironmentenvironmentalespeciallyessentialfacilitiesfirms
SHARED TOKENS (48): "access", "agencies", "community", "components", "composed", "conditions", "created", "development", "different", "distinct", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "especially", "essential", "facilities", "firms".... | EXACT TITLE in military: "Infrastructure". | EXACT TITLE in transportation_infrastructure: "Infrastructure".
0.500
alongsideconcentratedconcernsdemographicdevelopeddevelopmentdirectenvironmentenvironmentalfocusedgroupgrowthimproveindividuallimitedmedicalmillionpolicypopulationpotential
SHARED TOKENS (27): "alongside", "concentrated", "concerns", "demographic", "developed", "development", "direct", "environment", "environmental", "focused", "group", "growth", "improve", "individual", "limited", "medical", "million", "policy", "population", "potential".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
accessamericanamongbusinessescapacitychangescommunitycompetedevelopmentdevelopseducationemployersformgovernmenthistoricallyhistoryhomeincomeindustrymatching
SHARED TOKENS (46): "access", "american", "among", "businesses", "capacity", "changes", "community", "compete", "development", "develops", "education", "employers", "form", "government", "historically", "history", "home", "income", "industry", "matching".... | EXACT TITLE in military: "Workforce development". | EXACT TITLE in transportation_infrastructure: "Workforce development".
0.500
apprenticeshipcertificationcompetencecontinuedemployerextendfieldlabormasterperiodpermanentpotentialpracticepractitionersprofessionalregulatedsystemtraining
SHARED TOKENS (18): "apprenticeship", "certification", "competence", "continued", "employer", "extend", "field", "labor", "master", "period", "permanent", "potential", "practice", "practitioners", "professional", "regulated", "system", "training". | EXACT TITLE in military: "Apprenticeship". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
accordingcommunitydescribesdevelopmenteconomicsespeciallyfocusedgrowthhistoricallyimproveindividualinfrastructurelocalmarketpolicyqualityregionwest
SHARED TOKENS (18): "according", "community", "describes", "development", "economics", "especially", "focused", "growth", "historically", "improve", "individual", "infrastructure", "local", "market", "policy", "quality", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
articlecomplexconsumerconsumerscreatingdirectdirectlydistributionfacilitieslinkedlogisticsmanagementmaterialsnetworkstructuresupplierssupplysystemsystemsthem
SHARED TOKENS (21): "article", "complex", "consumer", "consumers", "creating", "direct", "directly", "distribution", "facilities", "linked", "logistics", "management", "materials", "network", "structure", "suppliers", "supply", "system", "systems", "them".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
acquiredacquisitionsadditionalairaircraftairlinesallianceextendsformformationhistorylatermajornetworkoperatesoperatingprincipalregionalroutethroughout
SHARED TOKENS (20): "acquired", "acquisitions", "additional", "air", "aircraft", "airlines", "alliance", "extends", "form", "formation", "history", "later", "major", "network", "operates", "operating", "principal", "regional", "route", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
armyassignmentcontaincontainsdivisiongeneralimproveindividualintendedoperationsplacesreadinessstructuredsupporttrainingunit
SHARED TOKENS (16): "army", "assignment", "contain", "contains", "division", "general", "improve", "individual", "intended", "operations", "places", "readiness", "structured", "support", "training", "unit". | EXACT TITLE in military: "Brigade Combat Team".
0.500
administrationairaircraftairportapproximatelyauthoritycombinedconnectingcreateddatadepartmentdevelopsenforcementfacilitiesfederalflightgovernmentidentificationimprovelaw
SHARED TOKENS (39): "administration", "air", "aircraft", "airport", "approximately", "authority", "combined", "connecting", "created", "data", "department", "develops", "enforcement", "facilities", "federal", "flight", "government", "identification", "improve", "law".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherarmycivilcostsdedicatedequipmentfacilityfieldfoodinformationlogisticsmanagementmaterialmaterialsmilitarymodelmovingneedsoperational
SHARED TOKENS (32): "according", "another", "army", "civil", "costs", "dedicated", "equipment", "facility", "field", "food", "information", "logistics", "management", "material", "materials", "military", "model", "moving", "needs", "operational".... | EXACT TITLE in military: "Logistics". | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesassistancedepartmentexistingfederalfinancialfunctionsgovernmentgrantsimprovelocalofficeoperateoperatorspassengerprimarilyprogramsprovidersproviding
SHARED TOKENS (29): "administration", "agencies", "assistance", "department", "existing", "federal", "financial", "functions", "government", "grants", "improve", "local", "office", "operate", "operators", "passenger", "primarily", "programs", "providers", "providing".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbroadbroaderbuildingscapitalcategorycommunityconstructiondirectlyelectricalemploymentenvironmentalfacilitiesgovernmenthabitathealthhospitalsinfrastructurelong-termmunicipal
SHARED TOKENS (35): "assets", "broad", "broader", "buildings", "capital", "category", "community", "construction", "directly", "electrical", "employment", "environmental", "facilities", "government", "habitat", "health", "hospitals", "infrastructure", "long-term", "municipal".... | EXACT TITLE in military: "Public works". | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
accessairairlinesallowingarrangementsauthoritiescompetitivecontractingcoordinationcorridorscostsdevelopmentestatefinancialfundinggeneralgovernmenthistoricalindustryinfrastructure
SHARED TOKENS (52): "access", "air", "airlines", "allowing", "arrangements", "authorities", "competitive", "contracting", "coordination", "corridors", "costs", "development", "estate", "financial", "funding", "general", "government", "historical", "industry", "infrastructure".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
airaircraftarmyaviationcorpsdedicatedforceshistoricallylandlogisticsmilitarynationalneedsoperationspriorprovidingseparateservesoughtsupport
SHARED TOKENS (22): "air", "aircraft", "army", "aviation", "corps", "dedicated", "forces", "historically", "land", "logistics", "military", "national", "needs", "operations", "prior", "providing", "separate", "serve", "sought", "support".... | EXACT TITLE in military: "Army aviation".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciesamericancanyoncentralcommercialconstructioncontrolcreateddevelopedhabitathistoryidahoinlandlargelimitedmajormilesmilitarynationalnear
SHARED TOKENS (41): "agencies", "american", "canyon", "central", "commercial", "construction", "control", "created", "developed", "habitat", "history", "idaho", "inland", "large", "limited", "major", "miles", "military", "national", "near".... | EXACT TITLE in military: "Snake River".
0.500
constructioncontextcontroldesignedengineerequipmentfunctionsindustrialinformationinvolvinglaborlargeoperationsotherwiseprimarysourcestructuresystemstrainuses
SHARED TOKENS (21): "construction", "context", "control", "designed", "engineer", "equipment", "functions", "industrial", "information", "involving", "labor", "large", "operations", "otherwise", "primary", "source", "structure", "systems", "train", "uses".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
articlecontrolsdesigndifferentgradeheightjurisdictionsmajorotherwisepracticeprimarilyreflectsroadseparateusesvehicles
SHARED TOKENS (16): "article", "controls", "design", "different", "grade", "height", "jurisdictions", "major", "otherwise", "practice", "primarily", "reflects", "road", "separate", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.500
departmentfacilitiesfederalidentifiedindividualinterstatelocalmajormetropolitanmilitarynationalnetworkorganizationspipelineplanningsafetyservingstrategicsystemtransportation
SHARED TOKENS (20): "department", "facilities", "federal", "identified", "individual", "interstate", "local", "major", "metropolitan", "military", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "strategic", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
actamericanbusinesscontinuedcreateddecembereducationestablishedeventforcesformergovernmentindustrymillionofficialprimarythem
SHARED TOKENS (17): "act", "american", "business", "continued", "created", "december", "education", "established", "event", "forces", "former", "government", "industry", "million", "official", "primary", "them". | EXACT TITLE in military: "Philippine–American War".
0.500
anotherarrangementsbusinesscontractorcostsexistinggeneralneedobligationsprimeprocurementprojectpublicreceivereducerulessectorsmallsupport
SHARED TOKENS (19): "another", "arrangements", "business", "contractor", "costs", "existing", "general", "need", "obligations", "prime", "procurement", "project", "public", "receive", "reduce", "rules", "sector", "small", "support". | EXACT TITLE in military: "Subcontractor".
0.500
accordingamericanauthoritycivilconcentratedconsolidateddifferentdistrictsentitiesequivalentexistingformformergovernmentlawlegallylocallocallyplacespopulation
SHARED TOKENS (24): "according", "american", "authority", "civil", "concentrated", "consolidated", "different", "districts", "entities", "equivalent", "existing", "form", "former", "government", "law", "legally", "local", "locally", "places", "population".... | EXACT TITLE in military: "County (United States)". | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscivilcommunicationscomponentsconstructiondevelopmentdigitalengineeringenvironmentequipmentestablishgovernmenthistorylandlawlegalmapsownershipplanningprofessional
SHARED TOKENS (28): "analysis", "civil", "communications", "components", "construction", "development", "digital", "engineering", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "professional".... | EXACT TITLE in military: "Surveying". | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
academiccollegecommunitydifferenteducationforminstitutionsopenpolicyprogramsschoolseniorstudentstransferuniversityworkforce
SHARED TOKENS (16): "academic", "college", "community", "different", "education", "form", "institutions", "open", "policy", "programs", "school", "senior", "students", "transfer", "university", "workforce". | EXACT TITLE in military: "Community college".
0.500
actadministrationagenciesassistancecivilcorridorcreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespassengerpolicyprogramsprovidepublic
SHARED TOKENS (28): "act", "administration", "agencies", "assistance", "civil", "corridor", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "passenger", "policy", "programs", "provide", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actarmyassistancechangescodifiedcontrolcoordinationcorpsdirectlyengineersenvironmentalfederalformfundinggoverninginvolvinglawlawsmajorphysical
SHARED TOKENS (34): "act", "army", "assistance", "changes", "codified", "control", "coordination", "corps", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "involving", "law", "laws", "major", "physical".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbridgebuiltcommunitycomplexconnectingconnectionconstructioncreatedesigndesignedengineeringengineersenvironmentimpactsindustrialintendedlocalmajormiles
SHARED TOKENS (39): "allowing", "bridge", "built", "community", "complex", "connecting", "connection", "construction", "create", "design", "designed", "engineering", "engineers", "environment", "impacts", "industrial", "intended", "local", "major", "miles".... | EXACT TITLE in military: "Bridge". | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Irrigation ↗ Q11453 EXACT TITLE
appliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddistributionenvironmentalfieldformgrowthinstallationlandlandscapemanagementmining
SHARED TOKENS (36): "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "distribution", "environmental", "field", "form", "growth", "installation", "land", "landscape", "management", "mining".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
affectsapproximatelyauthoritybusinessescapableconstructioncontractsdirecteconomygovernmentgroupgrowthlawslocalnonprofitorganizationorganizationsprivateprocurementproduces
SHARED TOKENS (32): "affects", "approximately", "authority", "businesses", "capable", "construction", "contracts", "direct", "economy", "government", "group", "growth", "laws", "local", "nonprofit", "organization", "organizations", "private", "procurement", "produces".... | EXACT TITLE in military: "Government procurement".
0.500
accessallowingcommunicationsdatadevelopmentdigitalelectricalforestformindividualinformationmeansmediaphysicalsignalssingletechnologytelecommunicationsusers
SHARED TOKENS (19): "access", "allowing", "communications", "data", "development", "digital", "electrical", "forest", "form", "individual", "information", "means", "media", "physical", "signals", "single", "technology", "telecommunications", "users". | EXACT TITLE in military: "Telecommunications". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Airspace ↗ Q272730 EXACT TITLE
airairspaceallocationauthoritiesaviationboundarycivilcontrolcontrolledcoordinatedenforcementestablishedfaaflightinformationlegalmanagementmilitarynationaloperations
SHARED TOKENS (30): "air", "airspace", "allocation", "authorities", "aviation", "boundary", "civil", "control", "controlled", "coordinated", "enforcement", "established", "faa", "flight", "information", "legal", "management", "military", "national", "operations".... | EXACT TITLE in military: "Airspace". | EXACT TITLE in transportation_infrastructure: "Airspace".
0.500
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancialfinancingfirmsgeneralinvestmentlimitedlong-termmanagementoperationalotherwiseownershippartnerships
SHARED TOKENS (27): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "financial", "financing", "firms", "general", "investment", "limited", "long-term", "management", "operational", "otherwise", "ownership", "partnerships".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
Fort Boise ↗ Q3077782 EXACT TITLE
becomeboiseboundarycanyoncapitaldevelopeddifferentestablishedgovernmentidahomilesmilitarynearoregonriverwestern
SHARED TOKENS (16): "become", "boise", "boundary", "canyon", "capital", "developed", "different", "established", "government", "idaho", "miles", "military", "near", "oregon", "river", "western". | EXACT TITLE in military: "Fort Boise".
0.500
agenciesbuildingsbuiltcivilcomponentsconstructiondepartmentsdesignengineeringenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysical
SHARED TOKENS (28): "agencies", "buildings", "built", "civil", "components", "construction", "departments", "design", "engineering", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelyblockbusinesscorridordirectlyfederallimitedmetropolitanmilesmillionnationalnearlynetworkoperateoperatesoperatororganizationpassenger
SHARED TOKENS (30): "additional", "american", "approximately", "block", "business", "corridor", "directly", "federal", "limited", "metropolitan", "miles", "million", "national", "nearly", "network", "operate", "operates", "operator", "organization", "passenger".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
activitycomponentsdepartmentdevelopsemployeremployersestablishedgovernmentlawsnationaloperatesopportunitiesprogramreserveresourcessupportwork
SHARED TOKENS (17): "activity", "components", "department", "develops", "employer", "employers", "established", "government", "laws", "national", "operates", "opportunities", "program", "reserve", "resources", "support", "work". | EXACT TITLE in military: "Employer Support of the Guard and Reserve".
0.500
Cavalry ↗ Q47315 EXACT TITLE
acquisitionadvantagesagainstarmybeyonddesignedeconomyforcesheighthistoricalindividuallandlatermeaningmilitarymobilityoperatingperiodplatformspurely
SHARED TOKENS (24): "acquisition", "advantages", "against", "army", "beyond", "designed", "economy", "forces", "height", "historical", "individual", "land", "later", "meaning", "military", "mobility", "operating", "period", "platforms", "purely".... | EXACT TITLE in military: "Cavalry".
0.500
accordingactadaadditionaladjacentbaseboisecanyoncreatingdensitydifferentdocumentsestablishedhistoricalhomeidaholandlinkedmanagementmiles
SHARED TOKENS (35): "according", "act", "ada", "additional", "adjacent", "base", "boise", "canyon", "creating", "density", "different", "documents", "established", "historical", "home", "idaho", "land", "linked", "management", "miles".... | EXACT TITLE in military: "Morley Nelson Snake River Birds of Prey National Conservation Area".
0.500
agenciesbusinessesdesignfacilitiesfuturegovernmentimpactsinfluenceneedsplanningprivatepublicrangesitingsystemtransportation
SHARED TOKENS (16): "agencies", "businesses", "design", "facilities", "future", "government", "impacts", "influence", "needs", "planning", "private", "public", "range", "siting", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessagenciesbeyondcommunitydesigneddestinationdevelopeddevelopingextendsformgovernmentincomelocalmetropolitanmobilityoperateoperatedoperatesoperatorsorganizations
SHARED TOKENS (35): "access", "agencies", "beyond", "community", "designed", "destination", "developed", "developing", "extends", "form", "government", "income", "local", "metropolitan", "mobility", "operate", "operated", "operates", "operators", "organizations".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionlandlocalprimarilyprimaryprivatepublicroadroutestreeturban
SHARED TOKENS (14): "access", "another", "design", "distinction", "land", "local", "primarily", "primary", "private", "public", "road", "route", "street", "urban". | EXACT TITLE in military: "Road". | EXACT TITLE in transportation_infrastructure: "Road".
0.480
Culvert ↗ Q4168092 EXACT TITLE
allowingdesignedheightmaterialneednoiseplacingpracticerequirementsroadshapeshapesstructurevehicle
SHARED TOKENS (14): "allowing", "designed", "height", "material", "need", "noise", "placing", "practice", "requirements", "road", "shape", "shapes", "structure", "vehicle". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.480
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcreatingdrivinghistoricallymobilitynetworkprofessionalrecordruralsafetyurbanvehicleswider
SHARED TOKENS (14): "american", "associated", "creating", "driving", "historically", "mobility", "network", "professional", "record", "rural", "safety", "urban", "vehicles", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.480
businesscompatibleconstraintscontextcontrolgeneralinitiativemanagementmilitarymissionmissionsneedsprovidingworkplace
SHARED TOKENS (14): "business", "compatible", "constraints", "context", "control", "general", "initiative", "management", "military", "mission", "missions", "needs", "providing", "workplace". | EXACT TITLE in military: "Mission command".
0.480
codeconditionscontrolfederalgovernmentnationalorganizationpersonnelprocurementrolestatutessupplytitletraining
SHARED TOKENS (14): "code", "conditions", "control", "federal", "government", "national", "organization", "personnel", "procurement", "role", "statutes", "supply", "title", "training". | EXACT TITLE in military: "Title 32 of the United States Code".
0.480
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingsbusinessescomponentsdesigneddirectlyfacilityfunctionindustriallargemanufacturingmaterialsmovingplaced
SHARED TOKENS (14): "associated", "buildings", "businesses", "components", "designed", "directly", "facility", "function", "industrial", "large", "manufacturing", "materials", "moving", "placed". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.460
activeairarmybecomecomponentsfederaljurisdictionmakesmilitarynationalregionreserverole
SHARED TOKENS (13): "active", "air", "army", "become", "components", "federal", "jurisdiction", "makes", "military", "national", "region", "reserve", "role". | EXACT TITLE in military: "Air National Guard".
0.460
airaircraftaviationcapacitycargodesigndevelopmentforcesmeansmilitarynationalprovidesupply
SHARED TOKENS (13): "air", "aircraft", "aviation", "capacity", "cargo", "design", "development", "forces", "means", "military", "national", "provide", "supply". | EXACT TITLE in military: "Military aviation".
0.460
academiccompatibledesignengineeringfacilitiesfieldmanagementoccupationalplanningprovidesafetechnologytransportation
SHARED TOKENS (13): "academic", "compatible", "design", "engineering", "facilities", "field", "management", "occupational", "planning", "provide", "safe", "technology", "transportation". | EXACT TITLE in military: "Transportation engineering".
0.440
boiseexpansionformeridahooperatingoregonpassengerrestorationrouteservethoughtrain
SHARED TOKENS (12): "boise", "expansion", "former", "idaho", "operating", "oregon", "passenger", "restoration", "route", "serve", "though", "train". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.440
Sidewalk ↗ Q177749 EXACT TITLE
adjacentamericanbuildingsdesignedlandmobilityprimarilyprivateroadsouthstreetvehicle
SHARED TOKENS (12): "adjacent", "american", "buildings", "designed", "land", "mobility", "primarily", "private", "road", "south", "street", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.440
administrationdepartmentdivisionfederalmajorofficeprogramprogramspublicroadroletransportation
SHARED TOKENS (12): "administration", "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.440
actadministrationairarmycreateddepartmentestablishedfederalfunctiongeneralnationalresponsible
SHARED TOKENS (12): "act", "administration", "air", "army", "created", "department", "established", "federal", "function", "general", "national", "responsible". | EXACT TITLE in military: "National Guard Bureau".
0.420
Taxiway ↗ Q910386 EXACT TITLE
aircraftairportaviationconnectingfacilitiesgeneralmovingoperatorsrunwayssafethough
SHARED TOKENS (11): "aircraft", "airport", "aviation", "connecting", "facilities", "general", "moving", "operators", "runways", "safe", "though". | EXACT TITLE in military: "Taxiway". | EXACT TITLE in transportation_infrastructure: "Taxiway".
0.420
Utility ↗ Q466707 EXACT TITLE
amongcontextdecisiondevelopeddistincteconomicsfunctionfunctionsrelationshipsourceutility
SHARED TOKENS (11): "among", "context", "decision", "developed", "distinct", "economics", "function", "functions", "relationship", "source", "utility". | EXACT TITLE in military: "Utility". | EXACT TITLE in transportation_infrastructure: "Utility".
0.420
articleassistancefieldgeneralgroupinformationmountainnationalrescuesearchurban
SHARED TOKENS (11): "article", "assistance", "field", "general", "group", "information", "mountain", "national", "rescue", "search", "urban". | EXACT TITLE in military: "Search and rescue". | EXACT TITLE in transportation_infrastructure: "Search and rescue".
0.420
airarmydifferentfederalmilitarynationalorganizationsreserverespectiveresponsiblesimultaneously
SHARED TOKENS (11): "air", "army", "different", "federal", "military", "national", "organizations", "reserve", "respective", "responsible", "simultaneously". | EXACT TITLE in military: "Army National Guard".
0.400
contractorcontractorscustomerdirectlygeneralgovernmentlawprimeworkworks
SHARED TOKENS (10): "contractor", "contractors", "customer", "directly", "general", "government", "law", "prime", "work", "works". | EXACT TITLE in military: "Prime contractor".
0.400
commercedepartmentdevelopmentgrantsgrowthidahoimprovepublicresourcesstate-level
SHARED TOKENS (10): "commerce", "department", "development", "grants", "growth", "idaho", "improve", "public", "resources", "state-level". | EXACT TITLE in military: "Idaho Department of Commerce".
0.400
Floodplain ↗ Q193110 EXACT TITLE
adjacentbanksbasecontroldevelopedlandnearriverurbanvalley
SHARED TOKENS (10): "adjacent", "banks", "base", "control", "developed", "land", "near", "river", "urban", "valley". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.380
departmentdevelopmentidahoinsurancelaborresponsibleselectedtechnologyworkforce
SHARED TOKENS (9): "department", "development", "idaho", "insurance", "labor", "responsible", "selected", "technology", "workforce". | EXACT TITLE in military: "Idaho Department of Labor". | EXACT TITLE in transportation_infrastructure: "Idaho Department of Labor".
0.380
activityamongidahopercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (9): "activity", "among", "idaho", "percent", "programs", "public", "research", "students", "university". | EXACT TITLE in military: "Idaho State University". | EXACT TITLE in transportation_infrastructure: "Idaho State University".
0.380
Snowplow ↗ Q14976 EXACT TITLE
especiallyintendedlargereceiveservingsnowtransportationvehiclevehicles
SHARED TOKENS (9): "especially", "intended", "large", "receive", "serving", "snow", "transportation", "vehicle", "vehicles". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.380
designeddevelopmenteducationmilitarypersonnelprofessionalprogramsschoolstraining
SHARED TOKENS (9): "designed", "development", "education", "military", "personnel", "professional", "programs", "schools", "training". | EXACT TITLE in military: "Professional military education".
0.370
airarmyboisedepartmentgovernmentidahomilitarynationalpotentialsecurityserve
SHARED TOKENS (11): "air", "army", "boise", "department", "government", "idaho", "military", "national", "potential", "security", "serve". | URL->A (3): https://www.imd.idaho.gov/, https://www.imd.idaho.gov/idaho-air-national-guard/.
0.360
airairportaviationbasecivilcontainfacilitiesmilitary
SHARED TOKENS (8): "air", "airport", "aviation", "base", "civil", "contain", "facilities", "military". | EXACT TITLE in military: "Joint-use airport".
0.360
Runway ↗ Q184590 EXACT TITLE
aircraftaviationbuiltdesignedrunwayrunwaystaxiwaysthough
SHARED TOKENS (8): "aircraft", "aviation", "built", "designed", "runway", "runways", "taxiways", "though". | EXACT TITLE in military: "Runway". | EXACT TITLE in transportation_infrastructure: "Runway".
0.360
americanfieldgraderoadroutessystemthoughuses
SHARED TOKENS (8): "american", "field", "grade", "road", "routes", "system", "though", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.340
buildingsbuiltdevelopmentenvironmenthistoricalmaintainspreservation
SHARED TOKENS (7): "buildings", "built", "development", "environment", "historical", "maintains", "preservation". | EXACT TITLE in military: "Historic preservation".
0.340
civilengineeringfieldinvolvingnetworktelecommunicationstransportation
SHARED TOKENS (7): "civil", "engineering", "field", "involving", "network", "telecommunications", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.320
aircreatedieselengineerfueluses
SHARED TOKENS (6): "air", "create", "diesel", "engineer", "fuel", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.300
actairarmyarticlechaptercodecomponentscorpscurrentdepartmentdifferentfederalforcesformergenerallawlawslegalmilitarymissions
SHARED TOKENS (30): "act", "air", "army", "article", "chapter", "code", "components", "corps", "current", "department", "different", "federal", "forces", "former", "general", "law", "laws", "legal", "military", "missions"....
0.300
accesscargocostsdestinationdirecteconomicsespeciallygeneralgroupintendedlogisticsmaterialmovingoperatingpracticeregionspecializedtraintransportation
SHARED TOKENS (19): "access", "cargo", "costs", "destination", "direct", "economics", "especially", "general", "group", "intended", "logistics", "material", "moving", "operating", "practice", "region", "specialized", "train", "transportation".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomecommercialcostsdensitydevelopmentencroachmentenvironmentenvironmentalexistingexpansionformgrowthhousingindustrialinfrastructurelandlargeplanningpopulation
SHARED TOKENS (32): "associated", "become", "commercial", "costs", "density", "development", "encroachment", "environment", "environmental", "existing", "expansion", "form", "growth", "housing", "industrial", "infrastructure", "land", "large", "planning", "population"....
0.300
againstairaircraftcivilcombinedcontinuedcontrolcoordinatedcoordinationdedicateddevelopedespeciallyforcesformidentifyingjetlatermajormilitarymission
SHARED TOKENS (30): "against", "air", "aircraft", "civil", "combined", "continued", "control", "coordinated", "coordination", "dedicated", "developed", "especially", "forces", "form", "identifying", "jet", "later", "major", "military", "mission"....
0.300
Shooting range ↗ Q521839 KW CROSS HIGH
agenciesairdesignedenforcementevenfacilityfieldlawlawsmastermilitaryoperatedpersonnelpracticeprovidequalificationsrangerelevantresponsiblerules
SHARED TOKENS (26): "agencies", "air", "designed", "enforcement", "even", "facility", "field", "law", "laws", "master", "military", "operated", "personnel", "practice", "provide", "qualifications", "range", "relevant", "responsible", "rules"....
0.300
accessestablishedhistoricalidahomaintainsmaterialofficeofficialplacespreservationprogrampublicrecordsresponsiblesociety
SHARED TOKENS (15): "access", "established", "historical", "idaho", "maintains", "material", "office", "official", "places", "preservation", "program", "public", "records", "responsible", "society".
0.300
administrationagainstaircraftallianceamericananotherassistanceauthoritybroadcapitalcontrolcreatingestablishedforcesformergovernmentgrouphistorylargemajor
SHARED TOKENS (36): "administration", "against", "aircraft", "alliance", "american", "another", "assistance", "authority", "broad", "capital", "control", "creating", "established", "forces", "former", "government", "group", "history", "large", "major"....
0.300
arrangementsauthoritycivildistinctemergencyforcesgoverninglawlawslegalmilitarypopulationpreservationproceduresseparatesystemstimes
SHARED TOKENS (17): "arrangements", "authority", "civil", "distinct", "emergency", "forces", "governing", "law", "laws", "legal", "military", "population", "preservation", "procedures", "separate", "systems", "times".
0.300
Civil service ↗ KW CROSS HIGH
authoritiescivilcomposedconditionscoordinatecreateddepartmentdevelopeddistinctionestablishedfieldformgeneralgovernedgovernmentinstitutionaljurisdictionlocalnationalofficial
SHARED TOKENS (31): "authorities", "civil", "composed", "conditions", "coordinate", "created", "department", "developed", "distinction", "established", "field", "form", "general", "governed", "government", "institutional", "jurisdiction", "local", "national", "official"....
0.300
acquisitionagencieschaptercodecodifiedcomposedcostscouncildescribesdocumentfederalgovernmentprincipalproceduresprocurementregulationregulationsrulessupplierssystem
SHARED TOKENS (23): "acquisition", "agencies", "chapter", "code", "codified", "composed", "costs", "council", "describes", "document", "federal", "government", "principal", "procedures", "procurement", "regulation", "regulations", "rules", "suppliers", "system"....
0.300
airambulanceanothercareemergencyemsequipmentfacilityhospitallocalmeansmedicalmilitarypersonnelrequiringroutetransfertransferstreatmentvehicles
SHARED TOKENS (20): "air", "ambulance", "another", "care", "emergency", "ems", "equipment", "facility", "hospital", "local", "means", "medical", "military", "personnel", "requiring", "route", "transfer", "transfers", "treatment", "vehicles".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentralcomesdesigndieselengineersenvironmentmakesneednoisereducerequireresearchresultingroadrulessafetysignalssignificant
SHARED TOKENS (26): "associated", "become", "central", "comes", "design", "diesel", "engineers", "environment", "makes", "need", "noise", "reduce", "require", "research", "resulting", "road", "rules", "safety", "signals", "significant"....
0.300
associatedcontextdedicateddocumentseducationhistoryindexinstitutionsmilitarynationalpreservationregionregionalservetechnologyunit
SHARED TOKENS (16): "associated", "context", "dedicated", "documents", "education", "history", "index", "institutions", "military", "national", "preservation", "region", "regional", "serve", "technology", "unit".
0.300
accessdesigneddistinctequipmentforcesfunctiongeneralinstallationlandlimitedmilitarypublicservetechnologytraintraining
SHARED TOKENS (16): "access", "designed", "distinct", "equipment", "forces", "function", "general", "installation", "land", "limited", "military", "public", "serve", "technology", "train", "training".
0.300
accordingcreatingdemandformfunctionsmedicalneedsnetworkpassengerprivateprogramsprovidepublicratherrelevantrouteroutesruralsharedtechnology
SHARED TOKENS (22): "according", "creating", "demand", "form", "functions", "medical", "needs", "network", "passenger", "private", "programs", "provide", "public", "rather", "relevant", "route", "routes", "rural", "shared", "technology"....
0.300
actagainstcivildepartmentfederalforcesgovernmentindividuallawmilitarynationalnationallypolicerequiressecuritystatutorythereforetitle
SHARED TOKENS (18): "act", "against", "civil", "department", "federal", "forces", "government", "individual", "law", "military", "national", "nationally", "police", "requires", "security", "statutory", "therefore", "title".
0.300
actactiveactivityairarmyauthoritybecomecannotcapacitycontroldifferentdistinctemergencyentitiesfederalforcesgovernmentindividuallawlaws
SHARED TOKENS (34): "act", "active", "activity", "air", "army", "authority", "become", "cannot", "capacity", "control", "different", "distinct", "emergency", "entities", "federal", "forces", "government", "individual", "law", "laws"....
0.300
aircraftcompliancecontinuingmaintenancerepair
SHARED TOKENS (5): "aircraft", "compliance", "continuing", "maintenance", "repair". | EXACT TITLE in military: "Aircraft maintenance". | EXACT TITLE in transportation_infrastructure: "Aircraft maintenance".
0.300
Military engineering ↗ KW CROSS HIGH
academicaccordingactivityaircraftcivilcommunicationsconstructioncontrolelectricalengineerengineeringengineersenvironmentenvironmentalequipmentfunctionsintelligencelogisticsmilitaryoperate
SHARED TOKENS (37): "academic", "according", "activity", "aircraft", "civil", "communications", "construction", "control", "electrical", "engineer", "engineering", "engineers", "environment", "environmental", "equipment", "functions", "intelligence", "logistics", "military", "operate"....
0.300
americanbuiltbusinessescentralchangesdemographicdevelopmentenvironmentalexpansionformationgrowthmodelpatternspopulationresidentsruralsouthurban
SHARED TOKENS (18): "american", "built", "businesses", "central", "changes", "demographic", "development", "environmental", "expansion", "formation", "growth", "model", "patterns", "population", "residents", "rural", "south", "urban".
0.300
alongsideamericanamongassociatedclinicalcomplexdevelopeddevelopseventeventslargemilitarypartnerphysicalpresentreportedresponsereviewshowsupport
SHARED TOKENS (20): "alongside", "american", "among", "associated", "clinical", "complex", "developed", "develops", "event", "events", "large", "military", "partner", "physical", "present", "reported", "response", "review", "show", "support".
0.300
alongsidebecomechangescommunityforcesformfragmentedfuelhabitatlandlandscapelocalopenotherwisequalityregimesourcewest
SHARED TOKENS (18): "alongside", "become", "changes", "community", "forces", "form", "fragmented", "fuel", "habitat", "land", "landscape", "local", "open", "otherwise", "quality", "regime", "source", "west".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
controlenforcementeventhealthidentifiedimproveoccupationalprovidingpublicremainrequiringroadruralsafesafetystandardsstrategysystemthemusers
SHARED TOKENS (22): "control", "enforcement", "event", "health", "identified", "improve", "occupational", "providing", "public", "remain", "requiring", "road", "rural", "safe", "safety", "standards", "strategy", "system", "them", "users"....
0.300
blockbusinesscentercentraldedicateddesigneddevelopmentformgrowthintegratedlandnetworkplanningprivatepublicrelationshipresidentialscaleservingspace
SHARED TOKENS (22): "block", "business", "center", "central", "dedicated", "designed", "development", "form", "growth", "integrated", "land", "network", "planning", "private", "public", "relationship", "residential", "scale", "serving", "space"....
0.300
administersbusinesscoveringdepartmentdevelopmentfederalforestlandmajormanagementmillionnationalofficeoperationsparkprivateresearchsystem
SHARED TOKENS (18): "administers", "business", "covering", "department", "development", "federal", "forest", "land", "major", "management", "million", "national", "office", "operations", "park", "private", "research", "system".
0.300
communitiescommunityconnectingdepartmentdirectemployerestablishinstructionlawmillionnationalneedsofficepolicyprogramprogramspublicreserveresourcesresponse
SHARED TOKENS (23): "communities", "community", "connecting", "department", "direct", "employer", "establish", "instruction", "law", "million", "national", "needs", "office", "policy", "program", "programs", "public", "reserve", "resources", "response"....
0.300
analysisbroadercapabilitiescapabilitydatadecisionsenvironmentforcesidentifiedinformationintelligencemilitarymissionoperationaloperationsperiodpersonnelplanningpopulationprovide
SHARED TOKENS (27): "analysis", "broader", "capabilities", "capability", "data", "decisions", "environment", "forces", "identified", "information", "intelligence", "military", "mission", "operational", "operations", "period", "personnel", "planning", "population", "provide"....
0.300
accordingarmyauthoritycontroldevelopmentfieldforcesindividualinformationlawfulmeaningmilitarymissionmissionsorganizationpersonnelphysicalpotentialproceduresresources
SHARED TOKENS (22): "according", "army", "authority", "control", "development", "field", "forces", "individual", "information", "lawful", "meaning", "military", "mission", "missions", "organization", "personnel", "physical", "potential", "procedures", "resources"....
0.300
actadjacentairappropriationsarmyauthoritycapacitycomescorpsdepartmentenforcementexpandedfederalgrouphomelawlawslegalmakesmilitary
SHARED TOKENS (27): "act", "adjacent", "air", "appropriations", "army", "authority", "capacity", "comes", "corps", "department", "enforcement", "expanded", "federal", "group", "home", "law", "laws", "legal", "makes", "military"....
0.300
acquisitionactairauthoritycodecodifiedcontroldepartmentdepartmentsenergyenvironmentfinancialforcesgenerallogisticsmanagementmilitarynationalofficeoperations
SHARED TOKENS (29): "acquisition", "act", "air", "authority", "code", "codified", "control", "department", "departments", "energy", "environment", "financial", "forces", "general", "logistics", "management", "military", "national", "office", "operations"....
0.300
advancedanalysiscodescommunicationscreatingcurrentequipmentforcesinformationinstitutionslatermilitarypresentsecuritysignalssystemsthemvisual
SHARED TOKENS (18): "advanced", "analysis", "codes", "communications", "creating", "current", "equipment", "forces", "information", "institutions", "later", "military", "present", "security", "signals", "systems", "them", "visual".
0.300
accessibleadministrationairairlinesamericananothercommercialconstructiondepartmentdieseldistributiondivisiondrivingeconomyeducationenvironmentalfederalgoverninggovernshandling
SHARED TOKENS (50): "accessible", "administration", "air", "airlines", "american", "another", "commercial", "construction", "department", "diesel", "distribution", "division", "driving", "economy", "education", "environmental", "federal", "governing", "governs", "handling"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecreateddifferentestatefacilitygovernmentlandlegallocaloperateotherwiseownershipphysicalprivaterealrightsroadrouteroutes
SHARED TOKENS (25): "authority", "capable", "created", "different", "estate", "facility", "government", "land", "legal", "local", "operate", "otherwise", "ownership", "physical", "private", "real", "rights", "road", "route", "routes"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecommunitiescompetitivecreatecreatescurrentdescribesdevelopeddevelopingdevelopmenteconomicseducationenvironmentalequivalentessentialgeographygrowthhealth
SHARED TOKENS (46): "approximately", "architecture", "become", "communities", "competitive", "create", "creates", "current", "describes", "developed", "developing", "development", "economics", "education", "environmental", "equivalent", "essential", "geography", "growth", "health"....
0.300
addinganotherarticlebecomecapacitydemanddensitydepartmentsdrivingplanningpublicresultingroadroutetimestransportationurbanvehicles
SHARED TOKENS (18): "adding", "another", "article", "become", "capacity", "demand", "density", "departments", "driving", "planning", "public", "resulting", "road", "route", "times", "transportation", "urban", "vehicles".
0.300
alongsideamericancapacitycapitalconnectingconventionalcorridorsdedicateddesigndesignedmillionnetworkpublicqualityreducesinglesystemsystemstransportation
SHARED TOKENS (19): "alongside", "american", "capacity", "capital", "connecting", "conventional", "corridors", "dedicated", "design", "designed", "million", "network", "public", "quality", "reduce", "single", "system", "systems", "transportation".
0.300
advancedcapacitychangesconditionscoordinateddifferentemergencyfieldimproveinformationinfrastructurelawsmanagementmobilityprovidereduceroadsafetysystemsystems
SHARED TOKENS (25): "advanced", "capacity", "changes", "conditions", "coordinated", "different", "emergency", "field", "improve", "information", "infrastructure", "laws", "management", "mobility", "provide", "reduce", "road", "safety", "system", "systems"....
0.300
aggregatecreatingdepartmentdesigneddifferentevenpathwayprimaryprovideroutesharedtravelurbanuserusers
SHARED TOKENS (15): "aggregate", "creating", "department", "designed", "different", "even", "pathway", "primary", "provide", "route", "shared", "travel", "urban", "user", "users".
0.300
actarmycollegecomponentscorpscreatedformgrouplandmilitarymissionnationalpartnershipsprogramprogramsreserveschoolsstudentsthroughouttrain
SHARED TOKENS (23): "act", "army", "college", "components", "corps", "created", "form", "group", "land", "military", "mission", "national", "partnerships", "program", "programs", "reserve", "schools", "students", "throughout", "train"....
0.300
americanassistancecombinedcreatedespeciallyevenfacilitiesjurisdictionslargelawsotherwiseroadrulessafetyschoolseparatesignalsstreettogetherusers
SHARED TOKENS (22): "american", "assistance", "combined", "created", "especially", "even", "facilities", "jurisdictions", "large", "laws", "otherwise", "road", "rules", "safety", "school", "separate", "signals", "street", "together", "users"....
0.300
administrationaircraftaviationcodecommercialdesigndesignedfaafederalflightgeneralgoverninglightingmaintenancemodeloperationspublicregulatedregulationsrules
SHARED TOKENS (26): "administration", "aircraft", "aviation", "code", "commercial", "design", "designed", "faa", "federal", "flight", "general", "governing", "lighting", "maintenance", "model", "operations", "public", "regulated", "regulations", "rules"....
0.300
Cyberwarfare ↗ Q849340 KW CROSS HIGH
activeagainstamongassociatedcapabilitiesdigitalevenforcesintendedmilitaryoperationsphysicalrealresponseresultingscalesignificantview
SHARED TOKENS (18): "active", "against", "among", "associated", "capabilities", "digital", "even", "forces", "intended", "military", "operations", "physical", "real", "response", "resulting", "scale", "significant", "view".
0.300
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcombinedcompetitiveconsolidatedconsolidationcontrolcreatedepartmentdirectenablesentitiesexpand
SHARED TOKENS (45): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "combined", "competitive", "consolidated", "consolidation", "control", "create", "department", "direct", "enables", "entities", "expand"....
0.300
accessadvancedamericanbuiltcapacitycentralchangesconnectconnectedconnectingcontainingdesignedevennetworkopenedplanspropertyproposedprovidequalification
SHARED TOKENS (32): "access", "advanced", "american", "built", "capacity", "central", "changes", "connect", "connected", "connecting", "containing", "designed", "even", "network", "opened", "plans", "property", "proposed", "provide", "qualification"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralidahointerstatemajormilesnationalnearnorthwestofficialoregonparallelparkriverroadrouterulesthroughoutwestwestern
SHARED TOKENS (20): "caldwell", "general", "idaho", "interstate", "major", "miles", "national", "near", "northwest", "official", "oregon", "parallel", "park", "river", "road", "route", "rules", "throughout", "west", "western".
0.300
decemberdepartmenteducationenergyenforcementengineersenvironmentalequivalentestablishingfederalfederallyfinancialgovernmentinformationlawslegallocalmattersmonitoringnational
SHARED TOKENS (29): "december", "department", "education", "energy", "enforcement", "engineers", "environmental", "equivalent", "establishing", "federal", "federally", "financial", "government", "information", "laws", "legal", "local", "matters", "monitoring", "national"....
0.300
administrationassetscapitalcomesconcernscontractingcostsdevelopmentfinancialfinancingfundinggovernmenthospitalsinfrastructureinstitutionsinvestmentlong-termoperatingpartnershippartnerships
SHARED TOKENS (35): "administration", "assets", "capital", "comes", "concerns", "contracting", "costs", "development", "financial", "financing", "funding", "government", "hospitals", "infrastructure", "institutions", "investment", "long-term", "operating", "partnership", "partnerships"....
0.300
Military base ↗ Q245016 KW CROSS HIGH
airaviationbasecentercomplexdirectlyequipmentfacilityfoodmilitaryoperateoperatedoperationspersonnelprovidetraining
SHARED TOKENS (16): "air", "aviation", "base", "center", "complex", "directly", "equipment", "facility", "food", "military", "operate", "operated", "operations", "personnel", "provide", "training".
0.300
administrationamericanassistancecostsdepartmenteducationemergencyestablishedexpandedfacilitiesfederalfuturegovernmenthealthcarehomeinsurancelong-termmedicalmilitarymission
SHARED TOKENS (26): "administration", "american", "assistance", "costs", "department", "education", "emergency", "established", "expanded", "facilities", "federal", "future", "government", "healthcare", "home", "insurance", "long-term", "medical", "military", "mission"....
0.300
becomescomponentsdatadigitalessentialexpandedfieldfunctionsinformationinfrastructurenetworkphysicalprovidereflectssecuritystandardssystemstechnologytherefore
SHARED TOKENS (19): "becomes", "components", "data", "digital", "essential", "expanded", "field", "functions", "information", "infrastructure", "network", "physical", "provide", "reflects", "security", "standards", "systems", "technology", "therefore".
0.300
aircraftassetsbecomecontrolcontrolledcostsdevelopedenvironmentalessentialexpandedforestinfrastructuremilitarymissionsmonitoringriversystemvehicle
SHARED TOKENS (18): "aircraft", "assets", "become", "control", "controlled", "costs", "developed", "environmental", "essential", "expanded", "forest", "infrastructure", "military", "missions", "monitoring", "river", "system", "vehicle".
0.300
actactiveairaircraftapproximatelyarmyauthoritycivilcomponentscontrolcorpsdepartmentdepartmentsestablishedfieldforcesintegratedintelligencelandmilitary
SHARED TOKENS (35): "act", "active", "air", "aircraft", "approximately", "army", "authority", "civil", "components", "control", "corps", "department", "departments", "established", "field", "forces", "integrated", "intelligence", "land", "military"....
0.300
additionalconditionsdesigneddevelopmentdifferentfuelfuelslargeprocedurespropertyprotectedsignificantsizeurbanvehicleswork
SHARED TOKENS (16): "additional", "conditions", "designed", "development", "different", "fuel", "fuels", "large", "procedures", "property", "protected", "significant", "size", "urban", "vehicles", "work".
0.300
accordingallianceamericanbasecannotcodecombinedcomplexconditionscontrolledcoordinationdecisiondecisionsdistinctionemploymentequipmentforceshomeidentifiedinvolving
SHARED TOKENS (40): "according", "alliance", "american", "base", "cannot", "code", "combined", "complex", "conditions", "controlled", "coordination", "decision", "decisions", "distinction", "employment", "equipment", "forces", "home", "identified", "involving"....
0.300
combinedconnectsconsumerscurrentdeliverydirectdirectlydistinctdistributionelectricalenergyevenformhandlinghistoricallyindustrylocalmajormarketnetwork
SHARED TOKENS (25): "combined", "connects", "consumers", "current", "delivery", "direct", "directly", "distinct", "distribution", "electrical", "energy", "even", "form", "handling", "historically", "industry", "local", "major", "market", "network"....
0.300
actadaagainstbroadbusinesschangescivilcostscouncildiscriminationemployerslaterlawnationalprotectionsprovidepublicrequirementsrequiresrights
SHARED TOKENS (21): "act", "ada", "against", "broad", "business", "changes", "civil", "costs", "council", "discrimination", "employers", "later", "law", "national", "protections", "provide", "public", "requirements", "requires", "rights"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontroldecemberinformationlawslocalnationalneedpolicereduceroadsignalssouthsystemsystemstechnologyusers
SHARED TOKENS (18): "advanced", "capacity", "control", "december", "information", "laws", "local", "national", "need", "police", "reduce", "road", "signals", "south", "system", "systems", "technology", "users".
0.300
centercreatelatermilesnetworkoperatesoperatingplansprincipalprojectrailroadreportingroadrouteroutessystemtransportationwestwestern
SHARED TOKENS (19): "center", "create", "later", "miles", "network", "operates", "operating", "plans", "principal", "project", "railroad", "reporting", "road", "route", "routes", "system", "transportation", "west", "western".
0.300
accessactadditionaladministrationapproximatelybuiltconstructioncontinuedcontrolledcreatingdesigndesigneddevelopedequivalentestablishedexpandextendsfederalfuelfunding
SHARED TOKENS (46): "access", "act", "additional", "administration", "approximately", "built", "construction", "continued", "controlled", "creating", "design", "designed", "developed", "equivalent", "established", "expand", "extends", "federal", "fuel", "funding"....
0.300
boiseidahomakingmilitaryopened
SHARED TOKENS (5): "boise", "idaho", "making", "military", "opened". | EXACT TITLE in military: "Idaho State Veterans Cemetery".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationairanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycivilcodescommunicationscommunitiescommunitycreatingdesigndevelopingdevelopment
SHARED TOKENS (68): "administration", "air", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "civil", "codes", "communications", "communities", "community", "creating", "design", "developing", "development"....
0.300
amongarmyarticlebecomecapitalchamberscommercecontractsdirectestablishestablishesestablishingfederalgeneralgoverninggovernmentgrantsinterstatelawlaws
SHARED TOKENS (41): "among", "army", "article", "become", "capital", "chambers", "commerce", "contracts", "direct", "establish", "establishes", "establishing", "federal", "general", "governing", "government", "grants", "interstate", "law", "laws"....
0.300
accordingactivityanalysisbecomesdesigndocumentationengineerengineeringengineersenvironmentestablishedgeneralgovernmentjurisdictionslegallicensurelocalmaintenanceplanspractice
SHARED TOKENS (39): "according", "activity", "analysis", "becomes", "design", "documentation", "engineer", "engineering", "engineers", "environment", "established", "general", "government", "jurisdictions", "legal", "licensure", "local", "maintenance", "plans", "practice"....
0.300
advancedagenciesairarmycollegecontractsdepartmentdepartmentsdevelopmentdirectlyfederalforcesfunctionsgovernmenthealthintelligencelogisticsmanagementmilitarymillion
SHARED TOKENS (37): "advanced", "agencies", "air", "army", "college", "contracts", "department", "departments", "development", "directly", "federal", "forces", "functions", "government", "health", "intelligence", "logistics", "management", "military", "million"....
0.300
actagenciesauthoritycouncilcreateddecemberdecisionsdesignedenvironmentenvironmentalestablishedfederalgovernmentimpactslawlawsnationalpolicypotentialproposed
SHARED TOKENS (26): "act", "agencies", "authority", "council", "created", "december", "decisions", "designed", "environment", "environmental", "established", "federal", "government", "impacts", "law", "laws", "national", "policy", "potential", "proposed"....
0.300
actactiveappropriationscorpsdesignedemergencyestablishedforcesmilitarynationaloccupationaloperationsorganizationpersonnelprimarilyprovidingreserveresponsibleroletrained
SHARED TOKENS (22): "act", "active", "appropriations", "corps", "designed", "emergency", "established", "forces", "military", "national", "occupational", "operations", "organization", "personnel", "primarily", "providing", "reserve", "responsible", "role", "trained"....
0.300
Iraq War ↗ Q545449 KW CROSS HIGH
additionaladministrationagainstamongauthoritybroadercenteredcivilcombinedcouncilcreatedestablishedforcesgovernmentlawmilitarymillionpositionprimaryprime
SHARED TOKENS (27): "additional", "administration", "against", "among", "authority", "broader", "centered", "civil", "combined", "council", "created", "established", "forces", "government", "law", "military", "million", "position", "primary", "prime"....
0.300
actactiveagenciesairapproximatelyarmyauthoritybusinesscapacitycivilcombinedcomponentsconstructioncontrolcorpsdepartmentdesigndirectdirectlyeconomy
SHARED TOKENS (70): "act", "active", "agencies", "air", "approximately", "army", "authority", "business", "capacity", "civil", "combined", "components", "construction", "control", "corps", "department", "design", "direct", "directly", "economy"....
0.300
airamericanarmyaviationcivildepartmentdepartmentsfieldfocusedforceslandmajormaterialsmilitarynationaloperatedoperatesprimarilyreservesystems
SHARED TOKENS (25): "air", "american", "army", "aviation", "civil", "department", "departments", "field", "focused", "forces", "land", "major", "materials", "military", "national", "operated", "operates", "primarily", "reserve", "systems"....
0.300
acquisitioncannotconstructiondesigndevelopmentdistributionevenfacilitiesforceshealthlogisticsmaintenancemedicalmilitaryoperationspersonnelplanningstoragesupplysupport
SHARED TOKENS (20): "acquisition", "cannot", "construction", "design", "development", "distribution", "even", "facilities", "forces", "health", "logistics", "maintenance", "medical", "military", "operations", "personnel", "planning", "storage", "supply", "support".
0.300
complexdescribesdrivingespeciallyindustrialindustrymeaningmilitarypolicypublicrelationshipsignificantsuppliessupplythemtogether
SHARED TOKENS (16): "complex", "describes", "driving", "especially", "industrial", "industry", "meaning", "military", "policy", "public", "relationship", "significant", "supplies", "supply", "them", "together".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherbuildingsconnectdevelopmenteasementsevenexpandedfunctionsgovernmentjurisdictionslandlaterlegalownershipprivatepropertypublicrequiresurrounding
SHARED TOKENS (24): "acquisition", "another", "buildings", "connect", "development", "easements", "even", "expanded", "functions", "government", "jurisdictions", "land", "later", "legal", "ownership", "private", "property", "public", "require", "surrounding"....
0.300
administrationagainstagenciesaircraftairlinesairspaceamericananotherarticleaviationbuildingscentercentralcombinedcomplexconstructioncontinuedcoordinatedcostsdedicated
SHARED TOKENS (63): "administration", "against", "agencies", "aircraft", "airlines", "airspace", "american", "another", "article", "aviation", "buildings", "center", "central", "combined", "complex", "construction", "continued", "coordinated", "costs", "dedicated"....
0.300
Outsourcing ↗ Q61515 KW CROSS HIGH
anotherassetsbusinesscentercontractingcontrolevenfacilityfunctionsindustriallaterlegallimitedmanagementmanufacturingoperationalorganizationotherwisepracticeprivate
SHARED TOKENS (25): "another", "assets", "business", "center", "contracting", "control", "even", "facility", "functions", "industrial", "later", "legal", "limited", "management", "manufacturing", "operational", "organization", "otherwise", "practice", "private"....
0.300
administrationagenciesamongchangescommunitiescompliancecontentcontrolcurrentdecemberdepartmentdesigndesigneddevelopeddocumentfederallawlocalnationalopen
SHARED TOKENS (27): "administration", "agencies", "among", "changes", "communities", "compliance", "content", "control", "current", "december", "department", "design", "designed", "developed", "document", "federal", "law", "local", "national", "open"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
buildingscannotcombinedconnectdesigndesigneddestinationeveninfrastructureinsidelargemunicipalpropertypublicreceiverequireresidentialsmallstreetsystems
SHARED TOKENS (20): "buildings", "cannot", "combined", "connect", "design", "designed", "destination", "even", "infrastructure", "inside", "large", "municipal", "property", "public", "receive", "require", "residential", "small", "street", "systems".
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdifferentequivalentformindividualmeaningoperateoperatesoperatingoperationspassengerprimarilyrailroadsectionsystemsystemstechnology
SHARED TOKENS (24): "broader", "capability", "capacity", "conditions", "different", "equivalent", "form", "individual", "meaning", "operate", "operates", "operating", "operations", "passenger", "primarily", "railroad", "section", "system", "systems", "technology"....
0.300
academicacquiredadditionaladvancedagainstcompetencedescribesdevelopmentemployersemploymentessentialfieldindividualinstitutionsknowledgemanagementmilitaryorganizationsplanningpractitioners
SHARED TOKENS (35): "academic", "acquired", "additional", "advanced", "against", "competence", "describes", "development", "employers", "employment", "essential", "field", "individual", "institutions", "knowledge", "management", "military", "organizations", "planning", "practitioners"....
0.300
Combined arms ↗ Q1418029 KW CROSS HIGH
accordingairaircraftanothercombineddifferentdivisionenvironmentforceslandmilitaryorganizationrequiressimultaneouslyspacestructuresupportsupportingsupportsthough
SHARED TOKENS (22): "according", "air", "aircraft", "another", "combined", "different", "division", "environment", "forces", "land", "military", "organization", "requires", "simultaneously", "space", "structure", "support", "supporting", "supports", "though"....
0.300
accesscommunitydesigndesigneddrivingengineersenvironmentalhealthhomeoperatedpolicypractitionerspublicrequiressafesafetytransportationtravelurbanusers
SHARED TOKENS (20): "access", "community", "design", "designed", "driving", "engineers", "environmental", "health", "home", "operated", "policy", "practitioners", "public", "requires", "safe", "safety", "transportation", "travel", "urban", "users".
0.300
againstairaircraftamericancapabilitiesdemonstratedesigndesigneddevelopeddirectenablesfacilitiesforcesimproveintendedlandmaintenancemissionsprimarilyprogram
SHARED TOKENS (30): "against", "air", "aircraft", "american", "capabilities", "demonstrate", "design", "designed", "developed", "direct", "enables", "facilities", "forces", "improve", "intended", "land", "maintenance", "missions", "primarily", "program"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcommunitiesconnectingdieseldifferentdistrictsinsidemetropolitanoperateoperatespassengerprimarilyregionalsystemsurban
SHARED TOKENS (16): "business", "central", "communities", "connecting", "diesel", "different", "districts", "inside", "metropolitan", "operate", "operates", "passenger", "primarily", "regional", "systems", "urban".
0.300
airarmycollegecombinedcompetitivecorpscoveringdepartmenteducationfieldforcesgroupmilitarymountainoperateoperationsopportunitiesparticipationpercentprogram
SHARED TOKENS (37): "air", "army", "college", "combined", "competitive", "corps", "covering", "department", "education", "field", "forces", "group", "military", "mountain", "operate", "operations", "opportunities", "participation", "percent", "program"....
0.300
boisehomeidahointerstatemajormetropolitanmilesmountainnearnorthwestoregonprimarilyrangeriverrouteroutesserves
SHARED TOKENS (17): "boise", "home", "idaho", "interstate", "major", "metropolitan", "miles", "mountain", "near", "northwest", "oregon", "primarily", "range", "river", "route", "routes", "serves".
0.300
Memorial Day ↗ Q371781 KW CROSS HIGH
administrationamericanamongannualarmybecomecivildepartmentdivisionfederalforceslegallocalmilitarynationalofficialorganizationpersonnelserving
SHARED TOKENS (19): "administration", "american", "among", "annual", "army", "become", "civil", "department", "division", "federal", "forces", "legal", "local", "military", "national", "official", "organization", "personnel", "serving".
🫐 BERRY49 edges
0.280
airarmycodecodescorpsfunctionidentifyindividualmilitaryoccupationalprimaryqualificationsystemtraining
SHARED TOKENS (14): "air", "army", "code", "codes", "corps", "function", "identify", "individual", "military", "occupational", "primary", "qualification", "system", "training".
0.280
becomechangesdesigndrivingengineeringengineersespeciallyimprovephysicalresponsibleroadsafetyurbanuses
SHARED TOKENS (14): "become", "changes", "design", "driving", "engineering", "engineers", "especially", "improve", "physical", "responsible", "road", "safety", "urban", "uses".
0.280
americandepartmentdepartmentsdirectlyeconomyfederalgovernmentmissionplansafeservingstrategicsystemtransportation
SHARED TOKENS (14): "american", "department", "departments", "directly", "economy", "federal", "government", "mission", "plan", "safe", "serving", "strategic", "system", "transportation".
0.280
actairarmydepartmentdepartmentsfederalgovernmentmilitarynationalofficialprincipalsecurityseniorsuccessor
SHARED TOKENS (14): "act", "air", "army", "department", "departments", "federal", "government", "military", "national", "official", "principal", "security", "senior", "successor".
0.260
actactiveappliescodifiedcomponentsemploymentfederallawmilitarypersonnelreserverespectiverights
SHARED TOKENS (13): "act", "active", "applies", "codified", "components", "employment", "federal", "law", "military", "personnel", "reserve", "respective", "rights".
0.260
civilconstructiondesignengineeringengineersfuturemaintenancematerialsplanningprofessionalstandardsstructuraltransportation
SHARED TOKENS (13): "civil", "construction", "design", "engineering", "engineers", "future", "maintenance", "materials", "planning", "professional", "standards", "structural", "transportation".
0.240
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedidahointerstatelimitedmilesoregonpriorroutesouthsystemwestwestern
SHARED TOKENS (12): "continued", "idaho", "interstate", "limited", "miles", "oregon", "prior", "route", "south", "system", "west", "western".
0.240
approximatelyboisechambersdatadistrictsevengovernmentidahopopulationresidentssinglesouth
SHARED TOKENS (12): "approximately", "boise", "chambers", "data", "districts", "even", "government", "idaho", "population", "residents", "single", "south".
0.240
americanapproximatelycategorycurrentdepartmentformermilitarymillionpersonnelrelationshipresearchrights
SHARED TOKENS (12): "american", "approximately", "category", "current", "department", "former", "military", "million", "personnel", "relationship", "research", "rights".
0.240
administrationassistancedepartmentforceshealthcarehomeinsurancemedicalmilitaryoccupationalpersonnelreceive
SHARED TOKENS (12): "administration", "assistance", "department", "forces", "healthcare", "home", "insurance", "medical", "military", "occupational", "personnel", "receive".
0.240
accessconnectingdesignedformerjurisdictionslocalmajorprovideresidentialroadserveswider
SHARED TOKENS (12): "access", "connecting", "designed", "former", "jurisdictions", "local", "major", "provide", "residential", "road", "serves", "wider".
0.240
Air rights ↗ Q4698374 KW CROSS HIGH
airdevelopmentestatelandlawlawslegalownershippropertyrealrightsspace
SHARED TOKENS (12): "air", "development", "estate", "land", "law", "laws", "legal", "ownership", "property", "real", "rights", "space".
0.240
Oversize load ↗ Q680421 KW CROSS HIGH
airbridgeconstructionequipmentindustrialinfrastructurelargelegalordinaryroadsizetransportation
SHARED TOKENS (12): "air", "bridge", "construction", "equipment", "industrial", "infrastructure", "large", "legal", "ordinary", "road", "size", "transportation".
0.220
accessallowingindividualinformationneedsorganizationorganizationspositionprivatesecuritythem
SHARED TOKENS (11): "access", "allowing", "individual", "information", "needs", "organization", "organizations", "position", "private", "security", "them".
0.220
Park and ride ↗ Q738031 KW CROSS HIGH
connectionslargemetropolitanparkpoolpublicroadsystemtransfervehiclevehicles
SHARED TOKENS (11): "connections", "large", "metropolitan", "park", "pool", "public", "road", "system", "transfer", "vehicle", "vehicles".
0.220
generalmilitary
SHARED TOKENS (2): "general", "military". | EXACT TITLE in military: "Adjutant general".
0.220
activeagenciescontrolcoordinationdevelopedemergencymanagementnationalprovidingresponsesystem
SHARED TOKENS (11): "active", "agencies", "control", "coordination", "developed", "emergency", "management", "national", "providing", "response", "system".
0.220
additionalcannotcapabilitieseducationestablishimprovemilitarypersonnelrespectiveskillstraining
SHARED TOKENS (11): "additional", "cannot", "capabilities", "education", "establish", "improve", "military", "personnel", "respective", "skills", "training".
0.200
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahometropolitanmunicipalnearlypopulationseparatestreet
SHARED TOKENS (10): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "nearly", "population", "separate", "street".
0.200
Auto mechanic ↗ Q706835 KW CROSS HIGH
conditionsdigitalmaintenanceneedsproposedrepairroleshowingvehiclework
SHARED TOKENS (10): "conditions", "digital", "maintenance", "needs", "proposed", "repair", "role", "showing", "vehicle", "work".
0.200
authorityconsequentlycontrolforcesgovernmentmilitaryofficialprofessionaltechnicaltitle
SHARED TOKENS (10): "authority", "consequently", "control", "forces", "government", "military", "official", "professional", "technical", "title".
0.200
associatedboisecentercontainsextendsfederallyidahometropolitanpopulationvalley
SHARED TOKENS (10): "associated", "boise", "center", "contains", "extends", "federally", "idaho", "metropolitan", "population", "valley".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahometropolitanpopulationschoolschoolssharedwest
SHARED TOKENS (10): "ada", "boise", "canyon", "idaho", "metropolitan", "population", "school", "schools", "shared", "west".
0.180
airamericancargocommercialenvironmentlandlogisticsmilitaryphysical
SHARED TOKENS (9): "air", "american", "cargo", "commercial", "environment", "land", "logistics", "military", "physical".
0.180
acquisitionagenciesdatagovgovernmentmanagementprocurementsupplierssystem
SHARED TOKENS (9): "acquisition", "agencies", "data", "gov", "government", "management", "procurement", "suppliers", "system".
0.160
becomeemploymentenablesfinancialhealthoccupationsrehabilitationsupport
SHARED TOKENS (8): "become", "employment", "enables", "financial", "health", "occupations", "rehabilitation", "support".
0.160
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitannearlypercentpopulation
SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "metropolitan", "nearly", "percent", "population".
0.160
articlecurrentforcesgovernmentidaholawsmilitaryoffice
SHARED TOKENS (8): "article", "current", "forces", "government", "idaho", "laws", "military", "office".
0.160
differentmeansmilitarymodelmodelsneedprofessionaltimes
SHARED TOKENS (8): "different", "means", "military", "model", "models", "need", "professional", "times".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanpopulationruralwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "metropolitan", "population", "rural", "western".
0.160
aircraftcargocostshandlingroadsecuritytransportationvehicle
SHARED TOKENS (8): "aircraft", "cargo", "costs", "handling", "road", "security", "transportation", "vehicle".
0.160
Bike lane ↗ Q1378400 KW CROSS HIGH
businessesentryimproveresearchroadsafetyshowsvehicles
SHARED TOKENS (8): "businesses", "entry", "improve", "research", "road", "safety", "shows", "vehicles".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
idaholandmajormilesnorthwestprimarilyriver
SHARED TOKENS (7): "idaho", "land", "major", "miles", "northwest", "primarily", "river".
0.140
commerciallargematerialsoperatesizevehiclevehicles
SHARED TOKENS (7): "commercial", "large", "materials", "operate", "size", "vehicle", "vehicles".
0.120
bankscanyonconnectingidahorivervalley
SHARED TOKENS (6): "banks", "canyon", "connecting", "idaho", "river", "valley".
0.120
armycomponentsforcesnationalreservetogether
SHARED TOKENS (6): "army", "components", "forces", "national", "reserve", "together".
0.120
Air base ↗ Q695850 KW CROSS HIGH
airaircraftairportbasemilitaryoperating
SHARED TOKENS (6): "air", "aircraft", "airport", "base", "military", "operating".
0.120
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahomilesnorthwestpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "miles", "northwest", "population".
0.100
idahointerstateroutetreasurevalley
SHARED TOKENS (5): "idaho", "interstate", "route", "treasure", "valley".
0.100
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
airairlinesamericanboiseidaho
SHARED TOKENS (5): "air", "airlines", "american", "boise", "idaho".
0.100
governinglegallimitedlocalmunicipal
SHARED TOKENS (5): "governing", "legal", "limited", "local", "municipal".
0.100
administrationindividualreserveselectedtraining
SHARED TOKENS (5): "administration", "individual", "reserve", "selected", "training".
0.100
Axle load ↗ Q340755 KW CROSS HIGH
connecteddesigndesignedengineeringvehicle
SHARED TOKENS (5): "connected", "design", "designed", "engineering", "vehicle".
0.100
cannothabitatmanagementpracticerange
SHARED TOKENS (5): "cannot", "habitat", "management", "practice", "range".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Military × Transportation Infrastructure — Treasure Valley
HAIKU · HIGH GATE
How does military operations at Boise Airport affect civilian transportation planning in Ada County?
Boise Airport coordinates military flight operations with Federal Aviation Administration protocols that directly shape runway usage and airspace corridors affecting civilian departures and arrivals across the metropolitan area. Ada County zoning and land-use planning must account for military airspace restrictions when approving new transportation infrastructure projects within miles of the airport.
What role do military facilities play in emergency medical services transportation corridors across the Treasure Valley?
Military installations in the Treasure Valley region coordinate with emergency medical services to establish transport routes that avoid restricted airspace and ground access zones. Boise, Nampa, and Caldwell emergency response planning incorporates military facility locations into helicopter and ground ambulance routing for public safety.
How do federal military land requirements impact transportation infrastructure development between Boise and Caldwell?
Federal property controlled for military purposes reduces available land for highway expansion and public transit projects connecting Boise, Nampa, and Caldwell in western Ada County. Environmental impact assessment processes for new transportation corridors must evaluate conflicts with existing military installations and their operational boundaries.
What transportation planning considerations does Boise State University address regarding nearby military airspace?
Boise State University's campus development and transportation infrastructure planning account for proximity to military-controlled airspace managed by the Federal Aviation Administration. The College of Western Idaho similarly coordinates facility expansion with military flight corridor data to ensure student and staff safety.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Military × Transportation Infrastructure 17 QID bridges 246 edges 6,478 ext links 2026-07-17 22:09:44 UTC eefd25e544d2d8d7
Military corridor ↗ Transportation Infrastructure corridor ↗ Transportation Infrastructure × Military ↗ boisestandard.org/standard ↗
Parent Corridors
Military × All Other Verticals