—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Manufacturing Food Processing ↔ relates to ↔ Banking And Credit

14 Wikipedia bridge articles confirmed in both vertical ledgers. 295 deterministic cross-vertical edges. 7,551 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
295 Cross Edges
7,551 External Sources
321 Wikipedia Articles
15 🌲 Evergreen
227 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Manufacturing Food Processing
× Banking And Credit
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
295
External Sources Harvested
7,551
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.0000  ·  type: exact_title_cross  ·  23 shared tokens
QID Bridge Titles (14)
Boise State UniversityCollege of Western IdahoTreasure ValleyEconomic developmentMergers and acquisitionsBoise, IdahoNampa, IdahoAgriculture in IdahoInterstate 84 in IdahoCaldwell, IdahoMeridian, IdahoCanyon County, IdahoKuna, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisemetropolitanadacollegewestcanyonoregonnampatreasurevalleywesterncapitalhomenorthwestactivityamongbusinesseconomicseducation
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:51:20 UTC
Content Hash
3811f13f58c4776e
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in manufacturing_food_processing (tier:evergreen) and banking_and_credit (tier:evergreen). | SHARED TOKENS (23): "activity", "among", "boise", "business", "college", "division", "economics", "education", "engineering", "founded", "health", "high", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research".... | EXACT TITLE in manufacturing_food_processing: "Boise State University". | EXACT TITLE in banking_and_credit: "Boise State University".
activityamongboisebusinesscollegedivisioneconomicseducationengineeringfoundedhealthhighidahoindependentinstitutionprogramprogramspublicreportedresearchuniversitiesuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in manufacturing_food_processing (tier:evergreen) and banking_and_credit (tier:evergreen). | SHARED TOKENS (26): "academic", "ada", "boise", "canyon", "career", "college", "counties", "credit", "cwi", "development", "education", "fall", "governed", "idaho", "nampa", "north", "primary", "programs", "public", "reported".... | EXACT TITLE in manufacturing_food_processing: "College of Western Idaho". | EXACT TITLE in banking_and_credit: "College of Western Idaho".
academicadaboisecanyoncareercollegecountiescreditcwidevelopmenteducationfallgovernedidahonampanorthprimaryprogramspublicreportedservedtechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.960
QID OVERLAP: Q7836726 in manufacturing_food_processing (tier:evergreen) and banking_and_credit (tier:evergreen). | SHARED TOKENS (13): "agricultural", "boise", "commerce", "idaho", "land", "local", "metropolitan", "name", "oregon", "region", "treasure", "valley", "western". | EXACT TITLE in manufacturing_food_processing: "Treasure Valley". | EXACT TITLE in banking_and_credit: "Treasure Valley".
agriculturalboisecommerceidaholandlocalmetropolitannameoregonregiontreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
E
Q4530482 EXACT TITLE 0.960
QID OVERLAP: Q4530482 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:evergreen). | SHARED TOKENS (13): "concept", "development", "economic", "economics", "frequently", "increases", "infrastructure", "local", "market", "policy", "quality", "region", "west". | EXACT TITLE in banking_and_credit: "Economic development".
conceptdevelopmenteconomiceconomicsfrequentlyincreasesinfrastructurelocalmarketpolicyqualityregionwest
ality of life of a nation, region, local community, or an individual are improved according to targeted goals and objectives. The term has been used frequently in the 20th and 21st centuries, but the concept has existed in the West for far longer. "Modernization", "Globalization", and especially "Industrialization" are other terms often used while discussing economic development.
"More than half the people of the world are living in conditions approaching misery. Their food is inadequate, they are victims of the disease. Their economic life is primitive and stagnant. Their poverty is a handicap and a threat both to them and to more prosperous areas. For the first time in history, humanity possesses the knowledge and the skill to relieve the suffering of these people ... I believe that we should make available to peace-loving people the benefits of our store of technical knowledge to help them realize their aspirations for a better life… What we envisage is a program of development based on the concepts of democratic fair dealing ... Greater production is the key to prosperity and peace. And the key to greater production is a wider and more vigorous application of modem scientific and technical knowledge." There have been several major phases of development theory since 1945. Alexander Gerschenkron argued that the less developed the country is at the outset of economic development (relative to others), the more likely certain conditions are to occur. Hence, all countries do not progress similarly. From the 1940s to the 1960s the state played a large role in promoting industrialization in developing countries, following the idea of modernization theory. This period was followed by a brief period of basic needs development focusing on human capital development and redistribution in the 1970s. Neoliberalism emerged in the 1980s pushing an agenda of free trade and removal of import substitution industrialization policies. In economics, the study of economic development was born out of an extension to traditional economics that focused entirely on the national product, or the aggregate output of goods and services. Economic development was concerned with the expansion of people's entitlements and their corresponding capabilities, such as morbidity, nourishment, literacy, education, and other socio-economic indicators. Borne out of the backdrop of Keynesian economics (advocating government intervention), and neoclassical economics (stressing reduced intervention), with the rise of high-growth countries (Singapore, South Korea, Hong Kong) and planned governments (Argentina, Chile, Sudan, Uganda), economic development and more generally development economics emerged amidst these mid-20th century theoretical interpretations of how economies prosper. Also, economist Albert O. Hirschman, a major contributor to development economics, asserted that economic development grew to concentrate on the poor regions of the world, primarily in Africa, Asia and Latin America yet on the outpouring of fundamental ideas and models. It has also been argued, notably by Asian and European proponents of infrastructure-based development, that systematic, long-term government investments in transportation, housing, education, and healthcare are necessary to ensure sustainable economic growth in emerging countries. During Robert McNamara's 13 years at the World Bank, he introduced key changes, most notably, shifting the Bank's economic development policies toward targeted poverty reduction. Before his tenure at the World Bank, poverty did not receive substantial attention as part of international and national economic development; the focus of development had been on industrialization and infrastructure. Poverty also came to be redefined as a condition faced by people rather than countries.
h and 21st centuries, but the concept has existed in the West for far longer. "Modernization", "Globalization", and especially "Industrialization" are other terms often used while discussing economic development.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (41): "acquisition", "act", "activity", "assets", "business", "capital", "central", "competition", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "economically", "effects", "entity", "federal", "governed"....
acquisitionactactivityassetsbusinesscapitalcentralcompetitionconsolidatedconsolidationcontrolcorporatecreatedepartmentdirecteconomicallyeffectsentityfederalgovernedgovernmentlawlegalmanagementmarketoperatingoperationsorganizationownershipprohibits+11
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "metropolitan", "north", "oregon", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployershomeidaholocallymajormetropolitannorthoregontechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "name", "nampa", "northwest", "principal", "university", "west", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannamenampanorthwestprincipaluniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
A
Q4694038 QID OVERLAP 0.780
QID OVERLAP: Q4694038 in manufacturing_food_processing (tier:evergreen) and banking_and_credit (tier:branch). | SHARED TOKENS (14): "agricultural", "agriculture", "different", "idaho", "land", "livestock", "processing", "produces", "production", "products", "represents", "role", "sales", "sector".
agriculturalagriculturedifferentidaholandlivestockprocessingproducesproductionproductsrepresentsrolesalessector
ortant part of the state's way of life and represents a substantial portion of the state's economy. 20% of Idaho's sales each year are generated by agriculture and food/beverage processing. In 2015, agricultural products were valued at $7,463,718,000, with slightly over half of that from the sale of livestock and dairy products. Cattle is the second largest agriculture sector of the state and Idaho is the third largest producer of milk and cheese in the United States. Although dairy plays a significant role in the economy, Idaho is most known for its potatoes. Idaho is the number one producer of potatoes in the nation and contributes to 32% of the country's production. Idaho has nearly 25,000 farms and ranches spread over 11.8 million acres of land that produces more than 185 different agricultural products.
er of potatoes in the nation and contributes to 32% of the country's production. Idaho has nearly 25,000 farms and ranches spread over 11.8 million acres of land that produces more than 185 different agricultural products.
2015 Idaho Organic Production There are roughly 168 farms in Idaho that produce organic commodities. In 2015, 95,739 acres of cropland and 71,443 acres of pasture/rangeland produced $85,014,000 in sales. As the popularity of organic foods rises, we will continue to see an increase in the sales of these commodities. Total Cash Receipts In 2015, Idaho's agricultural products were valued at $7,463,718,000. Slightly over half of this amount was from the sale of livestock and dairy products. *Record Setting Year 2016 Idaho Livestock (January) In 2015, Idaho's number one agriculture sector, with a value of production of $3,204,663,000, was all milk products and its second largest agriculture sector, with a value of production of $1,731,000,000, was cattle. Slightly over half of the state's income comes from the sale of livestock and dairy products. Idaho is the third largest producer of milk and cheese, fourth largest producer of milk cows, sixth largest producer of sheep and lambs, and 13th largest producer of cattle and calves in the United States.
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.720
QID OVERLAP: Q843258 in manufacturing_food_processing (tier:evergreen) and banking_and_credit (tier:evergreen). | SHARED TOKENS (11): "boise", "falls", "highway", "home", "idaho", "interstate", "major", "metropolitan", "near", "northwest", "oregon".
boisefallshighwayhomeidahointerstatemajormetropolitannearnorthwestoregon
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "oregon", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanoregonwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "making", "meridian".
adaamongboisecapitalidahomakingmeridian
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in manufacturing_food_processing (tier:evergreen) and banking_and_credit (tier:evergreen). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa".
boisecaldwellcanyonidahomakingmetropolitannampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.620
QID OVERLAP: Q1515177 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "kuna", "metropolitan".
adaadditionalboiseidahokunametropolitan
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in manufacturing_food_processing (tier:branch) and banking_and_credit (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "northwest".
adaboiseeagleidahonorthwest
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
281 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP281 edges
🌲 EVERGREEN1 edges
0.650
actagainstappliesassistanceauthoritybusinesscapacityconsumercreditdevelopmentdifferentfederalfinancefinancialfrequentlygovernmentheldhousinginstitutionlaw
SHARED TOKENS (36): "act", "against", "applies", "assistance", "authority", "business", "capacity", "consumer", "credit", "development", "different", "federal", "finance", "financial", "frequently", "government", "held", "housing", "institution", "law".... | URL->B (1): https://www.consumerfinance.gov/rules-policy/regulations/1002/. | EXACT TITLE in banking_and_credit: "Equal Credit Opportunity Act".
🌿 BRANCH227 edges
0.590
agencyassetscentralcreditdepartmentfinancegoverningheadquarteredidahomembersunionwestern
SHARED TOKENS (12): "agency", "assets", "central", "credit", "department", "finance", "governing", "headquartered", "idaho", "members", "union", "western". | URL->B (1): https://www.iccu.com/. | EXACT TITLE in banking_and_credit: "Idaho Central Credit Union".
0.500
activitiesassetassociatedbuildingbuildingsconstructiondevelopmenteconomicextendfacilitiesindustrialindustriesindustryinfrastructureplanningproductswork
SHARED TOKENS (17): "activities", "asset", "associated", "building", "buildings", "construction", "development", "economic", "extend", "facilities", "industrial", "industries", "industry", "infrastructure", "planning", "products", "work". | EXACT TITLE in manufacturing_food_processing: "Construction". | EXACT TITLE in banking_and_credit: "Construction".
0.500
additionalassetsbeyondbusinessescommercialcorporationdecisionsemployeesfederalgovernmentheldinstitutionlesslocallocallynationalofficeofficesownedrequirements
SHARED TOKENS (21): "additional", "assets", "beyond", "businesses", "commercial", "corporation", "decisions", "employees", "federal", "government", "held", "institution", "less", "local", "locally", "national", "office", "offices", "owned", "requirements".... | EXACT TITLE in banking_and_credit: "Community bank".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcropdistinctdividedearlygreatidahoindustriesjulylandminingnationalnorthnorthwestofficial
SHARED TOKENS (32): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "crop", "distinct", "divided", "early", "great", "idaho", "industries", "july", "land", "mining", "national", "north", "northwest", "official".... | EXACT TITLE in manufacturing_food_processing: "Idaho". | EXACT TITLE in banking_and_credit: "Idaho".
0.500
accountactamongbusinessconstructioncreatecropdemanddevelopmenteconomiceffectsexperiencedfinancialgeneralgreatgrowinghighindustrialindustriesindustry
SHARED TOKENS (43): "account", "act", "among", "business", "construction", "create", "crop", "demand", "development", "economic", "effects", "experienced", "financial", "general", "great", "growing", "high", "industrial", "industries", "industry".... | EXACT TITLE in banking_and_credit: "Great Depression".
0.500
Kitchen ↗ Q43164 EXACT TITLE
closecommercialconstructiondevelopedequipmentfacilitiesfoundfunctionsgenerallyhealthhighlargerlawmachinemainmarketmeetpreparationpublicrelated
SHARED TOKENS (28): "close", "commercial", "construction", "developed", "equipment", "facilities", "found", "functions", "generally", "health", "high", "larger", "law", "machine", "main", "market", "meet", "preparation", "public", "related".... | EXACT TITLE in manufacturing_food_processing: "Kitchen".
0.500
becomebusinessescannotcentralcommercialdivisionfinancialfunctioninstitutioninvestmentlargerprivatepublicretailsectorsystem
SHARED TOKENS (16): "become", "businesses", "cannot", "central", "commercial", "division", "financial", "function", "institution", "investment", "larger", "private", "public", "retail", "sector", "system". | EXACT TITLE in banking_and_credit: "Commercial bank".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotchainconsumerconsumerscreatesdescribingdevelopedenforcementhandlinghealthindustrylessmainmanagementmarketorganizationoriginsphysicalpracticespreparation
SHARED TOKENS (27): "cannot", "chain", "consumer", "consumers", "creates", "describing", "developed", "enforcement", "handling", "health", "industry", "less", "main", "management", "market", "organization", "origins", "physical", "practices", "preparation".... | EXACT TITLE in manufacturing_food_processing: "Food safety".
0.500
activitiesactivityadministrativeassociatedconsumerscontrolcorecustomercustomersdefiningdevelopmentdifferentdiffersengineeringindustriesmakingmanagementmaterialsmeansmeet
SHARED TOKENS (37): "activities", "activity", "administrative", "associated", "consumers", "control", "core", "customer", "customers", "defining", "development", "different", "differs", "engineering", "industries", "making", "management", "materials", "means", "meet".... | EXACT TITLE in manufacturing_food_processing: "Quality assurance".
0.500
authoritiescategoriesdelegatedfinancefinancialfirmsinformationlawlegalmainmarketmarketspracticesprincipalpublicregulationrestrictionsretailriskrules
SHARED TOKENS (22): "authorities", "categories", "delegated", "finance", "financial", "firms", "information", "law", "legal", "main", "market", "markets", "practices", "principal", "public", "regulation", "restrictions", "retail", "risk", "rules".... | EXACT TITLE in banking_and_credit: "Financial regulation".
0.500
agriculturalcommercialconstructionconsumercorporationestatefederalheadquarteredhomeidahomarketofficesoregonownedrealresidentialsystemwashington
SHARED TOKENS (18): "agricultural", "commercial", "construction", "consumer", "corporation", "estate", "federal", "headquartered", "home", "idaho", "market", "offices", "oregon", "owned", "real", "residential", "system", "washington". | EXACT TITLE in banking_and_credit: "Banner Bank".
0.500
activeagricultureapplicationcommonlyconditionscropeconomicirrigationmanagementneedpathwayspracticesqualityreducingsitesourcewater
SHARED TOKENS (17): "active", "agriculture", "application", "commonly", "conditions", "crop", "economic", "irrigation", "management", "need", "pathways", "practices", "quality", "reducing", "site", "source", "water". | EXACT TITLE in manufacturing_food_processing: "Nutrient management".
0.500
activitiesbusinessbusinessescapacitycentralcreatecreateseconomiceconomicsentityentrepreneursestablishestablishedfinancialfirmsformalidentificationoperatingproductsremains
SHARED TOKENS (25): "activities", "business", "businesses", "capacity", "central", "create", "creates", "economic", "economics", "entity", "entrepreneurs", "establish", "established", "financial", "firms", "formal", "identification", "operating", "products", "remains".... | EXACT TITLE in manufacturing_food_processing: "Entrepreneurship".
0.500
Debt buyer ↗ Q2254117 EXACT TITLE
actadministersagencyamongannualbusinessbuyerscapitalconcentratedconsumerconsumerscreditdependsenforcementestablishedfederalformgovernmentgroupindustry
SHARED TOKENS (34): "act", "administers", "agency", "among", "annual", "business", "buyers", "capital", "concentrated", "consumer", "consumers", "credit", "depends", "enforcement", "established", "federal", "form", "government", "group", "industry".... | EXACT TITLE in banking_and_credit: "Debt buyer".
0.500
Private label ↗ EXACT TITLE
amongbrandchaindeterminesdirectlydistinctgreatmanufacturersmultiplenamenationalownedprivateproductrolesimilarsoldtruthvalue
SHARED TOKENS (19): "among", "brand", "chain", "determines", "directly", "distinct", "great", "manufacturers", "multiple", "name", "national", "owned", "private", "product", "role", "similar", "sold", "truth", "value". | EXACT TITLE in manufacturing_food_processing: "Private label".
0.500
assetassetsbusinessescommercialcommonlyconsumercorporatecreditfinancialinstitutionmembersoperationsperiodpublicretailsharesmallsystemsunion
SHARED TOKENS (19): "asset", "assets", "businesses", "commercial", "commonly", "consumer", "corporate", "credit", "financial", "institution", "members", "operations", "period", "public", "retail", "share", "small", "systems", "union". | EXACT TITLE in banking_and_credit: "Credit union".
0.500
Frozen food ↗ Q751728 EXACT TITLE
agencybuildingsearlygroupindustrymaintainsproduceproductqualityreportedsmallerstandardsstructuresupportingtechnology
SHARED TOKENS (15): "agency", "buildings", "early", "group", "industry", "maintains", "produce", "product", "quality", "reported", "smaller", "standards", "structure", "supporting", "technology". | EXACT TITLE in manufacturing_food_processing: "Frozen food".
0.500
Wells Fargo ↗ Q744149 EXACT TITLE
accountacquisitionadditionalagainstamericaamongapplicationsassetassetsautomatedbusinesscorporationcustomersequipmentexistingfallsfederalfinancialformgrowing
SHARED TOKENS (42): "account", "acquisition", "additional", "against", "america", "among", "applications", "asset", "assets", "automated", "business", "corporation", "customers", "equipment", "existing", "falls", "federal", "financial", "form", "growing".... | EXACT TITLE in banking_and_credit: "Wells Fargo".
0.500
accountbecomebusinesscapacitycommercialcustomercustomersfinancialfirmsindependentinstitutioninvestmentmainorganizationsoldtradetransactions
SHARED TOKENS (17): "account", "become", "business", "capacity", "commercial", "customer", "customers", "financial", "firms", "independent", "institution", "investment", "main", "organization", "sold", "trade", "transactions". | EXACT TITLE in banking_and_credit: "Broker-dealer".
0.500
accountactagainstagencycapitalcategorychargescommercialconditionsconsumerconsumerscorporationcreditfederalfinancialfunctionsgovernmentgreatownershipplaces
SHARED TOKENS (31): "account", "act", "against", "agency", "capital", "category", "charges", "commercial", "conditions", "consumer", "consumers", "corporation", "credit", "federal", "financial", "functions", "government", "great", "ownership", "places".... | EXACT TITLE in banking_and_credit: "Federal Deposit Insurance Corporation".
0.500
actactivityagencyauthorizedbureauchargesconsumerconsumerscreditdataenforcementestablishedfederalfeesfinancialfirefirmsgovernmentgreatindependent
SHARED TOKENS (39): "act", "activity", "agency", "authorized", "bureau", "charges", "consumer", "consumers", "credit", "data", "enforcement", "established", "federal", "fees", "financial", "fire", "firms", "government", "great", "independent".... | EXACT TITLE in banking_and_credit: "Consumer Financial Protection Bureau".
0.500
businesscorporationcreatecreditcustomerdocumentfinancialfunctionsgeneralinformationoperationsorganizationrealrecordrecordedrecordsreportreportssalessource
SHARED TOKENS (23): "business", "corporation", "create", "credit", "customer", "document", "financial", "functions", "general", "information", "operations", "organization", "real", "record", "recorded", "records", "report", "reports", "sales", "source".... | EXACT TITLE in banking_and_credit: "Bookkeeping".
0.500
academicagriculturalappliedappliesbroadercombinescontroldevelopmentengineeringengineershandlingindustrialknowledgematerialsoperationsphysicalprocessingproductionproductsprofessional
SHARED TOKENS (22): "academic", "agricultural", "applied", "applies", "broader", "combines", "control", "development", "engineering", "engineers", "handling", "industrial", "knowledge", "materials", "operations", "physical", "processing", "production", "products", "professional".... | EXACT TITLE in manufacturing_food_processing: "Food engineering".
0.500
actactsadministersassetscorporationfinancialformheldinstitutionlawlegalnameownedprincipalprofessionalrecords
SHARED TOKENS (16): "act", "acts", "administers", "assets", "corporation", "financial", "form", "held", "institution", "law", "legal", "name", "owned", "principal", "professional", "records". | EXACT TITLE in banking_and_credit: "Trust company".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstconditionscoveredentityestablishedfeefinancialformhealthmanagementmeansownershippolicypotentiallyprimaryprocessingprotectionrelationshiprisksmall
SHARED TOKENS (21): "against", "conditions", "covered", "entity", "established", "fee", "financial", "form", "health", "management", "means", "ownership", "policy", "potentially", "primary", "processing", "protection", "relationship", "risk", "small".... | EXACT TITLE in banking_and_credit: "Insurance".
0.500
Bank failure ↗ EXACT TITLE
agencyamongassetassetsbecomebusinesscreatescustomersdemandeconomicallyeffecteffectsfallsfinancialfirmsgenerallygovernmentmajormarketmeet
SHARED TOKENS (29): "agency", "among", "asset", "assets", "become", "business", "creates", "customers", "demand", "economically", "effect", "effects", "falls", "financial", "firms", "generally", "government", "major", "market", "meet".... | EXACT TITLE in banking_and_credit: "Bank failure".
0.500
actactsconnectedconnectionconsumerconsumerscreditdesigneddisclosuresfederalfeesgrantslawmakingpracticesprincipalprohibitsregulatesregulationrequirements
SHARED TOKENS (21): "act", "acts", "connected", "connection", "consumer", "consumers", "credit", "designed", "disclosures", "federal", "fees", "grants", "law", "making", "practices", "principal", "prohibits", "regulates", "regulation", "requirements".... | EXACT TITLE in banking_and_credit: "Truth in Lending Act".
0.500
actaddressingadministeredagencyassistancecontroldirectlyengineersenvironmentalfederalformgoverninginvolvinglawmaintainmajornameownedphysicalprimary
SHARED TOKENS (27): "act", "addressing", "administered", "agency", "assistance", "control", "directly", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "maintain", "major", "name", "owned", "physical", "primary".... | EXACT TITLE in manufacturing_food_processing: "Clean Water Act".
0.500
Albertsons ↗ EXACT TITLE
acquiredacquisitionamericaboisecapitalchaincloseconsumerscorporatecustomerdifferentearlyemployeesfederalformerfoundedgeneralheadquarteredidaholess
SHARED TOKENS (30): "acquired", "acquisition", "america", "boise", "capital", "chain", "close", "consumers", "corporate", "customer", "different", "early", "employees", "federal", "former", "founded", "general", "headquartered", "idaho", "less".... | EXACT TITLE in manufacturing_food_processing: "Albertsons".
0.500
activeagainstagricultureapplicationsbuildingchainchannelsconditionsconsumercontrolleddesigneddevelopeddevelopmentearlygenerallyhumanindustrialindustriesindustryinfrastructure
SHARED TOKENS (46): "active", "against", "agriculture", "applications", "building", "chain", "channels", "conditions", "consumer", "controlled", "designed", "developed", "development", "early", "generally", "human", "industrial", "industries", "industry", "infrastructure".... | EXACT TITLE in manufacturing_food_processing: "Refrigeration".
0.500
actadministrationagencyagricultureauthoritycommercialdepartmentfederalgovernmenthealthjurisdictionproductspublicregulatorysafetysubjectsupply
SHARED TOKENS (17): "act", "administration", "agency", "agriculture", "authority", "commercial", "department", "federal", "government", "health", "jurisdiction", "products", "public", "regulatory", "safety", "subject", "supply". | EXACT TITLE in manufacturing_food_processing: "Food Safety and Inspection Service".
0.500
additionalagainstauthorizationchannelscommonlyconnectionscreditcustomersfederalfinancialhistoryinformationmoveprocessorprocessorssupplysystemthemtransactiontransactions
SHARED TOKENS (22): "additional", "against", "authorization", "channels", "commonly", "connections", "credit", "customers", "federal", "financial", "history", "information", "move", "processor", "processors", "supply", "system", "them", "transaction", "transactions".... | EXACT TITLE in banking_and_credit: "Payment processor".
0.500
accessadditionalauthoritiesbureauconsumerconsumersestatefinancialgenerallyhomeindependentlegalmaintainmarketmoveproductspropertyprotectionregulatoryrequire
SHARED TOKENS (23): "access", "additional", "authorities", "bureau", "consumer", "consumers", "estate", "financial", "generally", "home", "independent", "legal", "maintain", "market", "move", "products", "property", "protection", "regulatory", "require".... | EXACT TITLE in banking_and_credit: "Reverse mortgage".
0.500
Cheese ↗ Q10943 EXACT TITLE
activityaddingexpertisehighlayermarketsoriginprocessingproductproductionprotectivepurchasingsimilarstoragewater
SHARED TOKENS (15): "activity", "adding", "expertise", "high", "layer", "markets", "origin", "processing", "product", "production", "protective", "purchasing", "similar", "storage", "water". | EXACT TITLE in manufacturing_food_processing: "Cheese".
0.500
analysisapplicationcontrolcreatedatadistinguisheffectsengineeringestablishevidenceformgenerallygraphhealthcareidentifyidentifyingindustrialindustrynameoperations
SHARED TOKENS (21): "analysis", "application", "control", "create", "data", "distinguish", "effects", "engineering", "establish", "evidence", "form", "generally", "graph", "healthcare", "identify", "identifying", "industrial", "industry", "name", "operations".... | EXACT TITLE in manufacturing_food_processing: "Root-cause analysis".
0.500
actadministrationamongbureaucreditdevelopedestablishedestablishingfederalfinancialgeneralgovernmentlawmeetmembersnationalprovisionsregulatoryremainshare
SHARED TOKENS (22): "act", "administration", "among", "bureau", "credit", "developed", "established", "establishing", "federal", "financial", "general", "government", "law", "meet", "members", "national", "provisions", "regulatory", "remain", "share".... | EXACT TITLE in banking_and_credit: "Federal Credit Union Act".
0.500
accessactiveactsadditionalcategorieseconomicenvironmentaloperationalpersonnelphysicalpreventionproductsprotectionqualityrisksafetysystem
SHARED TOKENS (17): "access", "active", "acts", "additional", "categories", "economic", "environmental", "operational", "personnel", "physical", "prevention", "products", "protection", "quality", "risk", "safety", "system". | EXACT TITLE in manufacturing_food_processing: "Food defense".
0.500
actsapplicationsbecomebusinessescomplianceconsumercreditdependsdevelopeddirectestatefeesfinancejurisdictionlendersmarketsproductsrealregulatedregulation
SHARED TOKENS (22): "acts", "applications", "become", "businesses", "compliance", "consumer", "credit", "depends", "developed", "direct", "estate", "fees", "finance", "jurisdiction", "lenders", "markets", "products", "real", "regulated", "regulation".... | EXACT TITLE in banking_and_credit: "Mortgage broker".
0.500
Onion ↗ Q23485 EXACT TITLE
annualappliedbecomecentralclosecropestablishedformfrequentlygrowingmultiplenameproducescaleseparateservedstoragetreated
SHARED TOKENS (18): "annual", "applied", "become", "central", "close", "crop", "established", "form", "frequently", "growing", "multiple", "name", "produce", "scale", "separate", "served", "storage", "treated". | EXACT TITLE in manufacturing_food_processing: "Onion".
0.500
amongapproximatelyboisedivisionestablishedextensionfallshighidahomainofficesopenedoperatesproductionprofessionalpublicresearchschoolsstatewideuniversity
SHARED TOKENS (20): "among", "approximately", "boise", "division", "established", "extension", "falls", "high", "idaho", "main", "offices", "opened", "operates", "production", "professional", "public", "research", "schools", "statewide", "university". | EXACT TITLE in manufacturing_food_processing: "University of Idaho".
0.500
additionalagainstbusinessbusinessesbuyerscompetitionconsumerconsumersdirecteconomiceducationenforcementestablishedevenfederalformationgeneralgovernmenthealthinformation
SHARED TOKENS (35): "additional", "against", "business", "businesses", "buyers", "competition", "consumer", "consumers", "direct", "economic", "education", "enforcement", "established", "even", "federal", "formation", "general", "government", "health", "information".... | EXACT TITLE in banking_and_credit: "Consumer protection".
0.500
addingadditionalappliesauthoritybeyondcategoryconsumerconventionalexistingfunctionsgovernmenthealthmarketingpracticespreventionprocessingratherrelatedrisksafety
SHARED TOKENS (23): "adding", "additional", "applies", "authority", "beyond", "category", "consumer", "conventional", "existing", "functions", "government", "health", "marketing", "practices", "prevention", "processing", "rather", "related", "risk", "safety".... | EXACT TITLE in manufacturing_food_processing: "Functional food".
0.500
ATM ↗ Q81235 EXACT TITLE
accessaccountautomatedclosecommonlycreditcustomercustomersdifferentdirectfinancialidentificationidentifiedindustryinformationinstitutionmachinemobilenamesneed
SHARED TOKENS (23): "access", "account", "automated", "close", "commonly", "credit", "customer", "customers", "different", "direct", "financial", "identification", "identified", "industry", "information", "institution", "machine", "mobile", "names", "need".... | EXACT TITLE in manufacturing_food_processing: "ATM". | EXACT TITLE in banking_and_credit: "ATM".
0.500
Bank ↗ Q22687 EXACT TITLE
activitiesassetsbusinesscapitalcentralcreatescreditcurrentdemanddirectlyexistingfinancialfoundedgenerallyhighhistoryholdinstitutioninternationalmaking
SHARED TOKENS (30): "activities", "assets", "business", "capital", "central", "creates", "credit", "current", "demand", "directly", "existing", "financial", "founded", "generally", "high", "history", "hold", "institution", "international", "making".... | EXACT TITLE in banking_and_credit: "Bank".
0.500
Wheat ↗ Q15645384 EXACT TITLE
americacropdemandessentialgeneralgrouphighhumanindustrylandlargermajormakingmultiplenorthproductionqualityrecordsmallsource
SHARED TOKENS (22): "america", "crop", "demand", "essential", "general", "group", "high", "human", "industry", "land", "larger", "major", "making", "multiple", "north", "production", "quality", "record", "small", "source".... | EXACT TITLE in banking_and_credit: "Wheat".
0.500
academicapprenticeshipconnectsdepartmentemployeremployersindustryinstructionjoblabormeetprogramprovideregisteredskills
SHARED TOKENS (15): "academic", "apprenticeship", "connects", "department", "employer", "employers", "industry", "instruction", "job", "labor", "meet", "program", "provide", "registered", "skills". | EXACT TITLE in banking_and_credit: "Registered apprenticeship".
0.500
categorycommercialconsolidationcreditdevelopmentfinancialformationframeworkinstitutionnationaloperateprimaryseparatestatussystemswhose
SHARED TOKENS (16): "category", "commercial", "consolidation", "credit", "development", "financial", "formation", "framework", "institution", "national", "operate", "primary", "separate", "status", "systems", "whose". | EXACT TITLE in banking_and_credit: "Savings bank".
0.500
activitiesactivityactsadministrativeassetsbusinesscompliancecontrolcontrolsdatadepartmentsdesignedestablishexecutivefederalfinancialgenerallygoverninggovernmentidentify
SHARED TOKENS (43): "activities", "activity", "acts", "administrative", "assets", "business", "compliance", "control", "controls", "data", "departments", "designed", "establish", "executive", "federal", "financial", "generally", "governing", "government", "identify".... | EXACT TITLE in banking_and_credit: "Internal audit".
0.500
actactsadministrationauthoritycontrolfederalformformedgivinglawmembersnationalprincipalproductprovisionsregulationsrequirementssafety
SHARED TOKENS (18): "act", "acts", "administration", "authority", "control", "federal", "form", "formed", "giving", "law", "members", "national", "principal", "product", "provisions", "regulations", "requirements", "safety". | EXACT TITLE in manufacturing_food_processing: "Federal Food, Drug, and Cosmetic Act".
0.500
activitiesamericaamongassetassetsbrandcommercialcorporatecreditdevelopmentdivisionearlyfinancialfoundedheadquarteredhistoryinstitutioninvestmentlegallist
SHARED TOKENS (35): "activities", "america", "among", "asset", "assets", "brand", "commercial", "corporate", "credit", "development", "division", "early", "financial", "founded", "headquartered", "history", "institution", "investment", "legal", "list".... | EXACT TITLE in banking_and_credit: "JPMorgan Chase".
0.500
activitiesagriculturalagriculturebusinessesdirecteffectsenvironmentalhighhumanindustrialindustryirrigationmanagementmeetmunicipalnorthregionremainrequiresimilar
SHARED TOKENS (27): "activities", "agricultural", "agriculture", "businesses", "direct", "effects", "environmental", "high", "human", "industrial", "industry", "irrigation", "management", "meet", "municipal", "north", "region", "remain", "require", "similar".... | EXACT TITLE in manufacturing_food_processing: "Reclaimed water".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingbuildingsdevelopeddevelopmentdifferentdiffersformgovernmentindustriallandlocalplacesplanningpolicypropertyregulationsregulatoryresidentialrules
SHARED TOKENS (23): "activities", "building", "buildings", "developed", "development", "different", "differs", "form", "government", "industrial", "land", "local", "places", "planning", "policy", "property", "regulations", "regulatory", "residential", "rules".... | EXACT TITLE in manufacturing_food_processing: "Zoning".
0.500
accessaccountbecomeconnectconventionalcorecorporatecustomersdirectearlyevenfacilitiesfinancialhomeinstitutionmakingmobileneednetworkoperate
SHARED TOKENS (27): "access", "account", "become", "connect", "conventional", "core", "corporate", "customers", "direct", "early", "even", "facilities", "financial", "home", "institution", "making", "mobile", "need", "network", "operate".... | EXACT TITLE in banking_and_credit: "Online banking".
0.500
activityamongcomplianceconsolidatedcontrolsdataeconomicevenfederalfinancialformgeneralhealthcareindustrylawmeansneedoperationalpolicyregulations
SHARED TOKENS (28): "activity", "among", "compliance", "consolidated", "controls", "data", "economic", "even", "federal", "financial", "form", "general", "healthcare", "industry", "law", "means", "need", "operational", "policy", "regulations".... | EXACT TITLE in banking_and_credit: "Regulatory compliance".
0.500
activityconditionscontroldesigneddevelopedgeneralhighhousingindustrialindustrylinesmachineoperationsprocessorprogramsproviderequiresresultssmallsystem
SHARED TOKENS (21): "activity", "conditions", "control", "designed", "developed", "general", "high", "housing", "industrial", "industry", "lines", "machine", "operations", "processor", "programs", "provide", "requires", "results", "small", "system".... | EXACT TITLE in manufacturing_food_processing: "Programmable logic controller".
0.500
apprenticeshipapprenticeshipsconceptemployerexperiencedextendformalfoundjoblaborlicenseoutsideperiodprofessionalregulatedrolessystemtradetraining
SHARED TOKENS (19): "apprenticeship", "apprenticeships", "concept", "employer", "experienced", "extend", "formal", "found", "job", "labor", "license", "outside", "period", "professional", "regulated", "roles", "system", "trade", "training". | EXACT TITLE in manufacturing_food_processing: "Apprenticeship". | EXACT TITLE in banking_and_credit: "Apprenticeship".
0.500
Accounting ↗ Q4116214 EXACT TITLE
activitiesanalysisbusinessbusinessesdesigneddevelopeddividedeconomicexternalfinancialfirmsfunctionsgenerallyhistoryhumaninformationinternationalmajormanagementoperations
SHARED TOKENS (34): "activities", "analysis", "business", "businesses", "designed", "developed", "divided", "economic", "external", "financial", "firms", "functions", "generally", "history", "human", "information", "international", "major", "management", "operations".... | EXACT TITLE in banking_and_credit: "Accounting".
0.500
articlechainchannelsconsumerconsumerscustomersdirectdirectlyfacilitiesflowindependentmanagementmaterialsnetworkpointproductproductsstructuresupplysystem
SHARED TOKENS (23): "article", "chain", "channels", "consumer", "consumers", "customers", "direct", "directly", "facilities", "flow", "independent", "management", "materials", "network", "point", "product", "products", "structure", "supply", "system".... | EXACT TITLE in banking_and_credit: "Supply chain".
0.500
accessactactivitiesadministrationagencyapproximatelybusinessbusinessescapitalcentersconnectcontractscreditdevelopmentdirectoryeconomicentrepreneursexperiencedfederalgovernment
SHARED TOKENS (37): "access", "act", "activities", "administration", "agency", "approximately", "business", "businesses", "capital", "centers", "connect", "contracts", "credit", "development", "directory", "economic", "entrepreneurs", "experienced", "federal", "government".... | EXACT TITLE in banking_and_credit: "Small Business Administration".
0.500
additionalagriculturalauthorizationcontrolcurrenthighindustrylicensingmainmanagementmeetpersonnelpracticesproductproductsprovidequalityregulatoryrelevantrequirements
SHARED TOKENS (23): "additional", "agricultural", "authorization", "control", "current", "high", "industry", "licensing", "main", "management", "meet", "personnel", "practices", "product", "products", "provide", "quality", "regulatory", "relevant", "requirements".... | EXACT TITLE in manufacturing_food_processing: "Good manufacturing practice".
0.500
agriculturebusinessbusinessescommercialconsumercorporationestateheadquarteredidahoproductspublicrealregionalretailsmallwashington
SHARED TOKENS (16): "agriculture", "business", "businesses", "commercial", "consumer", "corporation", "estate", "headquartered", "idaho", "products", "public", "real", "regional", "retail", "small", "washington". | EXACT TITLE in banking_and_credit: "Glacier Bancorp".
0.500
accountapplicationappliescompetitioncorporationcreditdifferentfinancialfoundgenerallyhomeindustrymarketmarketsnetworkopeningoriginatingplanningpolicypower
SHARED TOKENS (24): "account", "application", "applies", "competition", "corporation", "credit", "different", "financial", "found", "generally", "home", "industry", "market", "markets", "network", "opening", "originating", "planning", "policy", "power".... | EXACT TITLE in banking_and_credit: "Loan origination".
0.500
Logistics ↗ Q177777 EXACT TITLE
acquiringchaincustomersequipmentflowinformationitemslinesmanagementmaterialmaterialsmodeloperationaloriginphysicalplanningpointproductionproductsprofessional
SHARED TOKENS (27): "acquiring", "chain", "customers", "equipment", "flow", "information", "items", "lines", "management", "material", "materials", "model", "operational", "origin", "physical", "planning", "point", "production", "products", "professional".... | EXACT TITLE in manufacturing_food_processing: "Logistics".
0.500
Packaging ↗ Q207822 EXACT TITLE
articleassociatedbusinesscoveredgoverninggovernmentindustrialinstitutionalproducingproductsprotectionregulationsseparatestoragesystemtechnology
SHARED TOKENS (16): "article", "associated", "business", "covered", "governing", "government", "industrial", "institutional", "producing", "products", "protection", "regulations", "separate", "storage", "system", "technology". | EXACT TITLE in manufacturing_food_processing: "Packaging".
0.500
agriculturalagricultureclassificationcontainingdifferentenvironmentalformhomeindustrialmakingotherwisephysicalprimaryprocessingproductproductsreducingresultsroles
SHARED TOKENS (19): "agricultural", "agriculture", "classification", "containing", "different", "environmental", "form", "home", "industrial", "making", "otherwise", "physical", "primary", "processing", "product", "products", "reducing", "results", "roles". | EXACT TITLE in manufacturing_food_processing: "Food processing".
0.500
agriculturalappliedcentralconsumersdevelopmentdirectlyearlyextendsmaterialspracticesprocessingproduceproductionproductssafetytechnologytesting
SHARED TOKENS (17): "agricultural", "applied", "central", "consumers", "development", "directly", "early", "extends", "materials", "practices", "processing", "produce", "production", "products", "safety", "technology", "testing". | EXACT TITLE in manufacturing_food_processing: "Food science".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiescanyoncentralcommercialconstructedconstructioncontrolcovereddevelopedfallsgreathighhistoryhumanidahoirrigationmajornationalnearnorth
SHARED TOKENS (37): "activities", "canyon", "central", "commercial", "constructed", "construction", "control", "covered", "developed", "falls", "great", "high", "history", "human", "idaho", "irrigation", "major", "national", "near", "north".... | EXACT TITLE in manufacturing_food_processing: "Snake River".
0.500
Retail ↗ Q126793 EXACT TITLE
accessanalysisbroaderbusinesscapabilitiescenterchainchannelscitedcommonlycompetitionconsumerscorecreditcustomercustomersdecisionsdirectlyeconomicallyemployees
SHARED TOKENS (55): "access", "analysis", "broader", "business", "capabilities", "center", "chain", "channels", "cited", "commonly", "competition", "consumers", "core", "credit", "customer", "customers", "decisions", "directly", "economically", "employees".... | EXACT TITLE in manufacturing_food_processing: "Retail". | EXACT TITLE in banking_and_credit: "Retail".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
buildingbusinessbusinessescapitalcommercialcreditdemanddevelopeddirectlyestateexistingfinancialformgivinghomeinstitutioninvestmentlawlegalmarkets
SHARED TOKENS (33): "building", "business", "businesses", "capital", "commercial", "credit", "demand", "developed", "directly", "estate", "existing", "financial", "form", "giving", "home", "institution", "investment", "law", "legal", "markets".... | EXACT TITLE in banking_and_credit: "Mortgage".
0.500
accountautomatedbecomecodecommunicationscreditdifferentdirectdirectlyemployeesfinancialinternationallinksmachinemajorneednetworkoperationalphysicalrules
SHARED TOKENS (27): "account", "automated", "become", "code", "communications", "credit", "different", "direct", "directly", "employees", "financial", "international", "links", "machine", "major", "need", "network", "operational", "physical", "rules".... | EXACT TITLE in banking_and_credit: "Payment system".
0.500
Finance ↗ Q43015 EXACT TITLE
academicactivitiesadministrationanalysisassetassetsbusinessbusinessescorporatecovereddistinctdividedearlyeconomicsengineeringentityestablishedfinancefinancialformed
SHARED TOKENS (38): "academic", "activities", "administration", "analysis", "asset", "assets", "business", "businesses", "corporate", "covered", "distinct", "divided", "early", "economics", "engineering", "entity", "established", "finance", "financial", "formed".... | EXACT TITLE in manufacturing_food_processing: "Finance". | EXACT TITLE in banking_and_credit: "Finance".
0.500
accountadministrationagencyassetscentralcommercialcorporationcreditdevelopmentfederalfederallygovernmentindependentnationaloperatesoperatingoperationsprovideshareunion
SHARED TOKENS (20): "account", "administration", "agency", "assets", "central", "commercial", "corporation", "credit", "development", "federal", "federally", "government", "independent", "national", "operates", "operating", "operations", "provide", "share", "union". | EXACT TITLE in banking_and_credit: "National Credit Union Administration".
0.500
adaairportboisecentercommercialdepartmentfallsfirefunctionsgeneralidahointernationalnationaloperatesprotectionsupportwestern
SHARED TOKENS (17): "ada", "airport", "boise", "center", "commercial", "department", "falls", "fire", "functions", "general", "idaho", "international", "national", "operates", "protection", "support", "western". | EXACT TITLE in manufacturing_food_processing: "Boise Airport".
0.500
applicationappliedcommonlydevelopeddirectlyearlyfoundhighwayindustrialmajormunicipalobtainoperateoperationspowerproducesafetysimilarsystemwater
SHARED TOKENS (20): "application", "applied", "commonly", "developed", "directly", "early", "found", "highway", "industrial", "major", "municipal", "obtain", "operate", "operations", "power", "produce", "safety", "similar", "system", "water". | EXACT TITLE in manufacturing_food_processing: "Compressed air".
0.500
actadministeredadministrationarticlebureaucurrentdepartmentdepartmentsearlyestablishedexecutivefederalfinancefinancialgovernmentlicensesmajormattersnationaloffice
SHARED TOKENS (25): "act", "administered", "administration", "article", "bureau", "current", "department", "departments", "early", "established", "executive", "federal", "finance", "financial", "government", "licenses", "major", "matters", "national", "office".... | EXACT TITLE in banking_and_credit: "United States Department of the Treasury".
0.500
actadministrationannualassetsauthoritiesauthorizationbusinessbusinessescorporationemployeesgovernmentgreathomeindustrylesslicenseoperateoperationspolicyprofessionals
SHARED TOKENS (31): "act", "administration", "annual", "assets", "authorities", "authorization", "business", "businesses", "corporation", "employees", "government", "great", "home", "industry", "less", "license", "operate", "operations", "policy", "professionals".... | EXACT TITLE in banking_and_credit: "Small business".
0.500
agencyapproximatelyauthoritybusinessescompetitionconstructioncontractsdirecteconomicgivinggovernmentgreatgroupinternationallocalorganizationpracticesprivateprocurementproduce
SHARED TOKENS (31): "agency", "approximately", "authority", "businesses", "competition", "construction", "contracts", "direct", "economic", "giving", "government", "great", "group", "international", "local", "organization", "practices", "private", "procurement", "produce".... | EXACT TITLE in manufacturing_food_processing: "Government procurement".
0.500
New Deal ↗ Q186356 EXACT TITLE
actadditionaladministrationagriculturalauthorityauthorizedcompetitionconditionsconstructioncontrolledcorporationcreatedemanddevelopmenteconomicemployeesemploymentfacilitiesfederalfinancial
SHARED TOKENS (41): "act", "additional", "administration", "agricultural", "authority", "authorized", "competition", "conditions", "construction", "controlled", "corporation", "create", "demand", "development", "economic", "employees", "employment", "facilities", "federal", "financial".... | EXACT TITLE in banking_and_credit: "New Deal".
0.500
actadministrationagencyassociatedauthoritycontrolcurrentdepartmentdirectlyemployeesfederalformerheadquartershealthhumanofficesprimaryproductspublicregulated
SHARED TOKENS (26): "act", "administration", "agency", "associated", "authority", "control", "current", "department", "directly", "employees", "federal", "former", "headquarters", "health", "human", "offices", "primary", "products", "public", "regulated".... | EXACT TITLE in manufacturing_food_processing: "Food and Drug Administration".
0.500
Potato ↗ Q10998 EXACT TITLE
americabecomecropdifferentessentialexpansionfoundoriginproduceproductionrapidregionremainsshowsinglesupply
SHARED TOKENS (16): "america", "become", "crop", "different", "essential", "expansion", "found", "origin", "produce", "production", "rapid", "region", "remains", "show", "single", "supply". | EXACT TITLE in manufacturing_food_processing: "Potato".
0.500
acquiredacquisitionactivitiesamericaassetsautomatedbusinesscentercenterscommercialcompetitionconsumercorporatecorporationdisclosuresearlyeconomicestablishingfederalfederally
SHARED TOKENS (45): "acquired", "acquisition", "activities", "america", "assets", "automated", "business", "center", "centers", "commercial", "competition", "consumer", "corporate", "corporation", "disclosures", "early", "economic", "establishing", "federal", "federally".... | EXACT TITLE in banking_and_credit: "Bank of America".
0.500
analysisapplicationsautomatedcontroldistinctengineeringexistingexpertiseformfunctionsguidanceindustrialindustryinformationmachineplanningproductsproviderealrequirements
SHARED TOKENS (23): "analysis", "applications", "automated", "control", "distinct", "engineering", "existing", "expertise", "form", "functions", "guidance", "industrial", "industry", "information", "machine", "planning", "products", "provide", "real", "requirements".... | EXACT TITLE in manufacturing_food_processing: "Machine vision".
0.500
agriculturalagriculturealonedemandeconomiceffecteffectsenvironmentalfrequentlygrowinghumanlandlivestockmainmakingneedotherwisepracticesproducingproduction
SHARED TOKENS (22): "agricultural", "agriculture", "alone", "demand", "economic", "effect", "effects", "environmental", "frequently", "growing", "human", "land", "livestock", "main", "making", "need", "otherwise", "practices", "producing", "production".... | EXACT TITLE in manufacturing_food_processing: "Animal feed".
0.500
activityauthorizationbusinesscertificationsclosecorporationdepartmentsdeterminesemployeesgovernmentjurisdictionlicenselicenseslocalmultipleoperateoperatingphysicalrequiressingle
SHARED TOKENS (20): "activity", "authorization", "business", "certifications", "close", "corporation", "departments", "determines", "employees", "government", "jurisdiction", "license", "licenses", "local", "multiple", "operate", "operating", "physical", "requires", "single". | EXACT TITLE in manufacturing_food_processing: "Business license".
0.480
actactivitiesactivityfilefinancialgovernmentlawprotectionrecordsreportreportingreportsrequirestransactions
SHARED TOKENS (14): "act", "activities", "activity", "file", "financial", "government", "law", "protection", "records", "report", "reporting", "reports", "requires", "transactions". | EXACT TITLE in banking_and_credit: "Bank Secrecy Act".
0.480
Savings account ↗ EXACT TITLE
accountcommonlyfacilitiesgovernmentholdinvestmentmarketproviderecordedrequirerequirementsretailthemtransactions
SHARED TOKENS (14): "account", "commonly", "facilities", "government", "hold", "investment", "market", "provide", "recorded", "require", "requirements", "retail", "them", "transactions". | EXACT TITLE in banking_and_credit: "Savings account".
0.480
boisecenterschaincomemployeesfoundedheldidaholistoregonownedprivatelyretailwashington
SHARED TOKENS (14): "boise", "centers", "chain", "com", "employees", "founded", "held", "idaho", "list", "oregon", "owned", "privately", "retail", "washington". | EXACT TITLE in manufacturing_food_processing: "WinCo Foods".
0.460
actactsdepartmentdevelopmentestablishedfederalnationalofficepolicyprimaryshapedsupportsystem
SHARED TOKENS (13): "act", "acts", "department", "development", "established", "federal", "national", "office", "policy", "primary", "shaped", "support", "system". | EXACT TITLE in banking_and_credit: "National Bank Act".
0.460
analysisbureauclassificationcorporatecreditcustomersfinanciallabormanagementorganizationreportedriskrole
SHARED TOKENS (13): "analysis", "bureau", "classification", "corporate", "credit", "customers", "financial", "labor", "management", "organization", "reported", "risk", "role". | EXACT TITLE in banking_and_credit: "Credit analyst".
0.460
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessesdesigneddirectlyfunctionindustrialmanufacturersmaterialsproductionwarehouse
SHARED TOKENS (13): "agriculture", "associated", "building", "buildings", "businesses", "designed", "directly", "function", "industrial", "manufacturers", "materials", "production", "warehouse". | EXACT TITLE in manufacturing_food_processing: "Warehouse". | EXACT TITLE in banking_and_credit: "Warehouse".
0.460
actagencybureaudepartmentestablishedfederalfederallyindependentjulylicensednationalofficeregulatory
SHARED TOKENS (13): "act", "agency", "bureau", "department", "established", "federal", "federally", "independent", "july", "licensed", "national", "office", "regulatory". | EXACT TITLE in banking_and_credit: "Office of the Comptroller of the Currency".
0.460
Cattle ↗ Q830 EXACT TITLE
americacentralcommonlydistributeddividedfoundlivestockmembersproductsseparatesmallthemwestern
SHARED TOKENS (13): "america", "central", "commonly", "distributed", "divided", "found", "livestock", "members", "products", "separate", "small", "them", "western". | EXACT TITLE in manufacturing_food_processing: "Cattle".
0.460
Credit ↗ Q182076 EXACT TITLE
consumercreditfinancialformformalgrouplegallymakingmaterialspropertyprovidetransactionsvalue
SHARED TOKENS (13): "consumer", "credit", "financial", "form", "formal", "group", "legally", "making", "materials", "property", "provide", "transactions", "value". | EXACT TITLE in manufacturing_food_processing: "Credit". | EXACT TITLE in banking_and_credit: "Credit".
0.450
Simplot ↗ Q3484788 EXACT TITLE
agricultureboisecommonlyheadquarteredidaho
SHARED TOKENS (5): "agriculture", "boise", "commonly", "headquartered", "idaho". | URL->A (1): https://www.simplot.com/company. | EXACT TITLE in manufacturing_food_processing: "Simplot".
0.440
applicableapplicationchaindevelopmenthealthcarehistoryidentificationinformationmeansrecordedsupplyverify
SHARED TOKENS (12): "applicable", "application", "chain", "development", "healthcare", "history", "identification", "information", "means", "recorded", "supply", "verify". | EXACT TITLE in manufacturing_food_processing: "Traceability".
0.440
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlyfallshumanlandmajorpotentiallyrelatedwater
SHARED TOKENS (12): "become", "create", "demand", "developed", "directly", "falls", "human", "land", "major", "potentially", "related", "water". | EXACT TITLE in manufacturing_food_processing: "Stormwater".
0.440
administrationamericaapproximatelyassetscreditfederallyheadquarteredheldmembersnationalregulatedunion
SHARED TOKENS (12): "administration", "america", "approximately", "assets", "credit", "federally", "headquartered", "held", "members", "national", "regulated", "union". | EXACT TITLE in banking_and_credit: "Mountain America Credit Union".
0.440
activitiesbuildingbusinessequipmentindustrialinfrastructureoperationalpracticesresidentialsupportingtechnicalutilities
SHARED TOKENS (12): "activities", "building", "business", "equipment", "industrial", "infrastructure", "operational", "practices", "residential", "supporting", "technical", "utilities". | EXACT TITLE in manufacturing_food_processing: "Maintenance".
0.440
accountagencybureauconsumercreditdataentityhistoryinformationlendersprivatereporting
SHARED TOKENS (12): "account", "agency", "bureau", "consumer", "credit", "data", "entity", "history", "information", "lenders", "private", "reporting". | EXACT TITLE in banking_and_credit: "Credit bureau".
0.440
analysiscommonlydemandfunctiongrowinglessmaterialperiodrathersimilarvaluewater
SHARED TOKENS (12): "analysis", "commonly", "demand", "function", "growing", "less", "material", "period", "rather", "similar", "value", "water". | EXACT TITLE in manufacturing_food_processing: "Biochemical oxygen demand".
0.440
Remittance ↗ Q1351807 EXACT TITLE
accesscapitaleducationfeesfinancialhealthhomeinternationalrolesharesupporttransaction
SHARED TOKENS (12): "access", "capital", "education", "fees", "financial", "health", "home", "international", "role", "share", "support", "transaction". | EXACT TITLE in banking_and_credit: "Remittance".
0.440
activitybusinessbusinessescodeentityfallsfederalgrouplargerlawlegallicense
SHARED TOKENS (12): "activity", "business", "businesses", "code", "entity", "falls", "federal", "group", "larger", "law", "legal", "license". | EXACT TITLE in banking_and_credit: "Money transmitter".
0.440
agencyboisedepartmentenvironmentalfederalgovernmentidahomainofficesqualityregionalregulations
SHARED TOKENS (12): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "main", "offices", "quality", "regional", "regulations". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Environmental Quality".
0.440
articleassociateddesigneddifferseducationfeesfinancialinstitutionmajorrisksuppliessystem
SHARED TOKENS (12): "article", "associated", "designed", "differs", "education", "fees", "financial", "institution", "major", "risk", "supplies", "system". | EXACT TITLE in banking_and_credit: "Student loan".
0.420
Escrow ↗ Q338451 EXACT TITLE
accountcompletedconditionsestablishedheldnameobligationsprimaryprincipalpropertytransaction
SHARED TOKENS (11): "account", "completed", "conditions", "established", "held", "name", "obligations", "primary", "principal", "property", "transaction". | EXACT TITLE in banking_and_credit: "Escrow".
0.420
acquisitionbusinessconsolidatedconsolidationentityexistingfinancialgrouplargersmallertaxation
SHARED TOKENS (11): "acquisition", "business", "consolidated", "consolidation", "entity", "existing", "financial", "group", "larger", "smaller", "taxation". | EXACT TITLE in manufacturing_food_processing: "Consolidation (business)". | EXACT TITLE in banking_and_credit: "Consolidation (business)".
0.420
controlcoveredengineeringequipmentindustrialmachinemeansoperatingoperationsoperatorssafety
SHARED TOKENS (11): "control", "covered", "engineering", "equipment", "industrial", "machine", "means", "operating", "operations", "operators", "safety". | EXACT TITLE in manufacturing_food_processing: "Machine guarding".
0.420
Lactalis ↗ Q1799825 EXACT TITLE
approximatelybusinesscorporationformergroupmarketsnameownedownsproductssales
SHARED TOKENS (11): "approximately", "business", "corporation", "former", "group", "markets", "name", "owned", "owns", "products", "sales". | EXACT TITLE in manufacturing_food_processing: "Lactalis".
0.420
businessescenterscentralcoredevelopmenteconomicenvironmentalexpansionformationgrowingmodel
SHARED TOKENS (11): "businesses", "centers", "central", "core", "development", "economic", "environmental", "expansion", "formation", "growing", "model". | EXACT TITLE in banking_and_credit: "Suburbanization".
0.420
accountcurrentcustomercustomersfeesfinancialinstitutionrecordedrelationshiprepresentstransactions
SHARED TOKENS (11): "account", "current", "customer", "customers", "fees", "financial", "institution", "recorded", "relationship", "represents", "transactions". | EXACT TITLE in banking_and_credit: "Deposit account".
0.420
capacitycreatecreditevenfalllargerlendersmanagementprovidequalityrisk
SHARED TOKENS (11): "capacity", "create", "credit", "even", "fall", "larger", "lenders", "management", "provide", "quality", "risk". | EXACT TITLE in banking_and_credit: "Mortgage underwriting".
0.420
Forklift ↗ Q41577 EXACT TITLE
becomedevelopeddevelopmentearlyequipmentindustrialmanufacturersmaterialsmovesalessold
SHARED TOKENS (11): "become", "developed", "development", "early", "equipment", "industrial", "manufacturers", "materials", "move", "sales", "sold". | EXACT TITLE in manufacturing_food_processing: "Forklift".
0.420
Allergen ↗ Q186752 EXACT TITLE
againstenvironmentalhealthinternationalmaintainsorganizationotherwiseproducesproductiontechnicalunion
SHARED TOKENS (11): "against", "environmental", "health", "international", "maintains", "organization", "otherwise", "produces", "production", "technical", "union". | EXACT TITLE in manufacturing_food_processing: "Allergen".
0.400
administrationeffecthealthinfluencejurisdictionlegalmarketingproductsregulatedregulatory
SHARED TOKENS (10): "administration", "effect", "health", "influence", "jurisdiction", "legal", "marketing", "products", "regulated", "regulatory". | EXACT TITLE in manufacturing_food_processing: "Nutraceutical".
0.400
accountactbusinessesconsumercustomereffectlegalmobilesystemthough
SHARED TOKENS (10): "account", "act", "businesses", "consumer", "customer", "effect", "legal", "mobile", "system", "though". | EXACT TITLE in banking_and_credit: "Remote deposit".
0.400
Branch manager ↗ EXACT TITLE
businessdivisionemployeesexecutivefunctionfunctionslocallyofficeoperatingorganization
SHARED TOKENS (10): "business", "division", "employees", "executive", "function", "functions", "locally", "office", "operating", "organization". | EXACT TITLE in banking_and_credit: "Branch manager".
0.400
Sausage ↗ Q131419 EXACT TITLE
becomeformedmakingmaterialsnationalpreparationprocessingproductregionalsold
SHARED TOKENS (10): "become", "formed", "making", "materials", "national", "preparation", "processing", "product", "regional", "sold". | EXACT TITLE in manufacturing_food_processing: "Sausage".
0.400
Credit card ↗ Q161380 EXACT TITLE
consumerscontinuingcreditdiffersentityfinancialrequiressubjecttransactionsusers
SHARED TOKENS (10): "consumers", "continuing", "credit", "differs", "entity", "financial", "requires", "subject", "transactions", "users". | EXACT TITLE in banking_and_credit: "Credit card".
0.400
Beal Bank ↗ Q4876118 EXACT TITLE
acquiringcorporationdirectfederallyfinancialfoundedheadquarteredlistoperatesowned
SHARED TOKENS (10): "acquiring", "corporation", "direct", "federally", "financial", "founded", "headquartered", "list", "operates", "owned". | EXACT TITLE in banking_and_credit: "Beal Bank".
0.400
differentgenerallyirrigationlawlegalphysicalsourcesystemsuserswater
SHARED TOKENS (10): "different", "generally", "irrigation", "law", "legal", "physical", "source", "systems", "users", "water". | EXACT TITLE in banking_and_credit: "Water right".
0.380
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalapplicationscommercialcommonlyindustrialmunicipalsewerwater
SHARED TOKENS (9): "activities", "agricultural", "applications", "commercial", "commonly", "industrial", "municipal", "sewer", "water". | EXACT TITLE in manufacturing_food_processing: "Wastewater".
0.380
controlfoundindustrialinvolvingmakingoriginsphysicalrelatedsystems
SHARED TOKENS (9): "control", "found", "industrial", "involving", "making", "origins", "physical", "related", "systems". | EXACT TITLE in manufacturing_food_processing: "Instrumentation".
0.380
Purée ↗ Q636056 EXACT TITLE
broadercommonlygenerallynamesoriginratherservedsimilarwater
SHARED TOKENS (9): "broader", "commonly", "generally", "names", "origin", "rather", "served", "similar", "water". | EXACT TITLE in manufacturing_food_processing: "Purée".
0.380
assetsbusinesscommonlyemployerentityfinancialinvolvingoriginperiod
SHARED TOKENS (9): "assets", "business", "commonly", "employer", "entity", "financial", "involving", "origin", "period". | EXACT TITLE in banking_and_credit: "Embezzlement".
0.380
agencybusinessbusinessesfeeoperateorganizationpracticesregulatesvalue
SHARED TOKENS (9): "agency", "business", "businesses", "fee", "operate", "organization", "practices", "regulates", "value". | EXACT TITLE in banking_and_credit: "Debt collection".
0.360
Anthocyanin ↗ Q262547 EXACT TITLE
addingamongeffectevidencehumanpathwayunionverified
SHARED TOKENS (8): "adding", "among", "effect", "evidence", "human", "pathway", "union", "verified". | EXACT TITLE in manufacturing_food_processing: "Anthocyanin".
0.360
commonlyevengenerallyoriginrestaurantsservedthemthemselves
SHARED TOKENS (8): "commonly", "even", "generally", "origin", "restaurants", "served", "them", "themselves". | EXACT TITLE in manufacturing_food_processing: "French fries".
0.360
controlengineeringnameproduceproductsystemstechnicaltechnology
SHARED TOKENS (8): "control", "engineering", "name", "produce", "product", "systems", "technical", "technology". | EXACT TITLE in manufacturing_food_processing: "Mechatronics".
0.360
Milk ↗ Q8495 EXACT TITLE
againstagriculturalgivingprimaryproductproductssourcesystem
SHARED TOKENS (8): "against", "agricultural", "giving", "primary", "product", "products", "source", "system". | EXACT TITLE in manufacturing_food_processing: "Milk".
0.360
amongfinancialinstitutioninvestmentpublicrisksupportingvalue
SHARED TOKENS (8): "among", "financial", "institution", "investment", "public", "risk", "supporting", "value". | EXACT TITLE in banking_and_credit: "Underwriting".
0.360
agencydepartmentdevelopmenteconomicidaholabortechnologyworkforce
SHARED TOKENS (8): "agency", "department", "development", "economic", "idaho", "labor", "technology", "workforce". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Labor".
0.360
businessdevelopmentestateindustrialindustryofficeofficesrather
SHARED TOKENS (8): "business", "development", "estate", "industrial", "industry", "office", "offices", "rather". | EXACT TITLE in manufacturing_food_processing: "Industrial park".
0.340
businessdifferententityfinancialinstitutionmemberstransactions
SHARED TOKENS (7): "business", "different", "entity", "financial", "institution", "members", "transactions". | EXACT TITLE in banking_and_credit: "Financial institution".
0.340
boiseeagleheadquarteredidahoprocessingprocessorsproducts
SHARED TOKENS (7): "boise", "eagle", "headquartered", "idaho", "processing", "processors", "products". | EXACT TITLE in manufacturing_food_processing: "Lamb Weston".
0.340
WaFd Bank ↗ Q7971859 EXACT TITLE
federalidaholistoperatesoregonregionalwashington
SHARED TOKENS (7): "federal", "idaho", "list", "operates", "oregon", "regional", "washington". | EXACT TITLE in banking_and_credit: "WaFd Bank".
0.340
applicationsbusinessescommercialcreditfinanciallicensedrelated
SHARED TOKENS (7): "applications", "businesses", "commercial", "credit", "financial", "licensed", "related". | EXACT TITLE in banking_and_credit: "Loan officer".
0.340
Chorizo ↗ Q23374 EXACT TITLE
differentidentitiesnamesnationaloriginatingproductsregional
SHARED TOKENS (7): "different", "identities", "names", "national", "originating", "products", "regional". | EXACT TITLE in manufacturing_food_processing: "Chorizo".
0.320
Mozzarella ↗ Q14088 EXACT TITLE
distinctgenerallyhighresearchservedsold
SHARED TOKENS (6): "distinct", "generally", "high", "research", "served", "sold". | EXACT TITLE in manufacturing_food_processing: "Mozzarella".
0.320
Lien ↗ Q4469383 EXACT TITLE
applicationformgenerallygrantsobligationproperty
SHARED TOKENS (6): "application", "form", "generally", "grants", "obligation", "property". | EXACT TITLE in manufacturing_food_processing: "Lien". | EXACT TITLE in banking_and_credit: "Lien".
0.320
assetsfinancialheadquarteredinterstateregionalwestern
SHARED TOKENS (6): "assets", "financial", "headquartered", "interstate", "regional", "western". | EXACT TITLE in banking_and_credit: "First Interstate BancSystem".
0.320
estatefinancialinvestmentmanagementplanningprotection
SHARED TOKENS (6): "estate", "financial", "investment", "management", "planning", "protection". | EXACT TITLE in banking_and_credit: "Wealth management".
0.320
businesseducationindustrymultipleoperationsskills
SHARED TOKENS (6): "business", "education", "industry", "multiple", "operations", "skills". | EXACT TITLE in banking_and_credit: "Business education".
0.320
containingenvironmentalproducesproductproductswater
SHARED TOKENS (6): "containing", "environmental", "produces", "product", "products", "water". | EXACT TITLE in manufacturing_food_processing: "Dairy product".
0.320
Raspberry ↗ Q13179 EXACT TITLE
americaappliesnamenorthproductionthemselves
SHARED TOKENS (6): "america", "applies", "name", "north", "production", "themselves". | EXACT TITLE in manufacturing_food_processing: "Raspberry".
0.300
agriculturalagriculturecontroldevelopeddirectearlyenvironmentalexpansiongeneralgenerallyhealthhistoryindustriesindustrylivestockpipelineproductproductionreducingrole
SHARED TOKENS (24): "agricultural", "agriculture", "control", "developed", "direct", "early", "environmental", "expansion", "general", "generally", "health", "history", "industries", "industry", "livestock", "pipeline", "product", "production", "reducing", "role"....
0.300
amongcommercialeducationessentialevidencefoundhumanincompletemakingproductsprovideremainsselectionshowsmall
SHARED TOKENS (15): "among", "commercial", "education", "essential", "evidence", "found", "human", "incomplete", "making", "products", "provide", "remains", "selection", "show", "small".
0.300
acquireagencyapproximatelybuildingcentercommercialfinancialgenerallyheldindustrialmeetofficepropertyreportsreviewsubjectwarehouse
SHARED TOKENS (17): "acquire", "agency", "approximately", "building", "center", "commercial", "financial", "generally", "held", "industrial", "meet", "office", "property", "reports", "review", "subject", "warehouse".
0.300
adaboisecanyoncommonlycountieshomeidaholargermainmeridianmetropolitannampanorthwestoregonpacificsectiontreasurevalleywider
SHARED TOKENS (19): "ada", "boise", "canyon", "commonly", "counties", "home", "idaho", "larger", "main", "meridian", "metropolitan", "nampa", "northwest", "oregon", "pacific", "section", "treasure", "valley", "wider".
0.300
accountassetsauthoritybeyondcapitalcentralcommercialcontrolcorecreditcustomersdemanddiffersdirectlyheldholdinfluencelessmarketmeet
SHARED TOKENS (33): "account", "assets", "authority", "beyond", "capital", "central", "commercial", "control", "core", "credit", "customers", "demand", "differs", "directly", "held", "hold", "influence", "less", "market", "meet"....
0.300
accessaccountamericabusinessescommonlycreditcurrentdemanddirecteconomiceconomicsfeesfinancialheldinstitutionlocalmaintainsnorthoperateshare
SHARED TOKENS (23): "access", "account", "america", "businesses", "commonly", "credit", "current", "demand", "direct", "economic", "economics", "fees", "financial", "held", "institution", "local", "maintains", "north", "operate", "share"....
0.300
becomechaincompetitionconsolidationconsumerscorporationdifferentdirectlyinternationalitemsmakingmanagementmarketneedownedownershipownsproduceproducesproduct
SHARED TOKENS (26): "become", "chain", "competition", "consolidation", "consumers", "corporation", "different", "directly", "international", "items", "making", "management", "market", "need", "owned", "ownership", "owns", "produce", "produces", "product"....
0.300
Slaughterhouse ↗ Q385557 KW CROSS HIGH
agriculturedifferentfrequentlyhealthhumanindustrylivestockmeetpreparationproduceprovidepublicrequirementsscalesupplywork
SHARED TOKENS (16): "agriculture", "different", "frequently", "health", "human", "industry", "livestock", "meet", "preparation", "produce", "provide", "public", "requirements", "scale", "supply", "work".
0.300
Factoring (finance) ↗ KW CROSS HIGH
accountagainstassetassetsbusinesscommercialcommonlydiffersfinancefinancialformindustriesinternationalinvolvinglawmainmarketsmeetnetworkofficial
SHARED TOKENS (23): "account", "against", "asset", "assets", "business", "commercial", "commonly", "differs", "finance", "financial", "form", "industries", "international", "involving", "law", "main", "markets", "meet", "network", "official"....
0.300
Boiler ↗ EXACT TITLE
applicationscentralgenerallypowerwater
SHARED TOKENS (5): "applications", "central", "generally", "power", "water". | EXACT TITLE in manufacturing_food_processing: "Boiler".
0.300
actassetassetscapitalcentralcommercialconsumercreatecreditdemanddepartmentdevelopmentearlyeconomicestateexistingfallfederalfinancialfire
SHARED TOKENS (54): "act", "asset", "assets", "capital", "central", "commercial", "consumer", "create", "credit", "demand", "department", "development", "early", "economic", "estate", "existing", "fall", "federal", "financial", "fire"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
accessadditionalconditionsdecisionsdevelopmenteconomicestablishedfacilitiesfinancialgeneralhealthhealthcarehistoryhumaninformationmeansmeetoccupationalorganizationphysical
SHARED TOKENS (32): "access", "additional", "conditions", "decisions", "development", "economic", "established", "facilities", "financial", "general", "health", "healthcare", "history", "human", "information", "means", "meet", "occupational", "organization", "physical"....
0.300
agencydepartmenthealthidahopublic
SHARED TOKENS (5): "agency", "department", "health", "idaho", "public". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Health and Welfare".
0.300
accountcreditcustomercustomersdiffersfinancialhandlingincreasesinstitutioninvolvinglistsmobileneedpointreducingrelatedtransactions
SHARED TOKENS (17): "account", "credit", "customer", "customers", "differs", "financial", "handling", "increases", "institution", "involving", "lists", "mobile", "need", "point", "reducing", "related", "transactions".
0.300
applicationschainconsumercustomersdifferentequipmentfoundhandlingindustriesinvolvingmaterialmaterialsmovespowersystemsystemsthem
SHARED TOKENS (17): "applications", "chain", "consumer", "customers", "different", "equipment", "found", "handling", "industries", "involving", "material", "materials", "moves", "power", "system", "systems", "them".
0.300
actactivityamongarticlecommercecontrolcontrolledeconomiceffectevenfederalfoundgovernmentgrowingheldinterstatejurisdictionlinesmatterspower
SHARED TOKENS (24): "act", "activity", "among", "article", "commerce", "control", "controlled", "economic", "effect", "even", "federal", "found", "government", "growing", "held", "interstate", "jurisdiction", "lines", "matters", "power"....
0.300
authoritybusinessesevenfederalfinancialindustrylawprimaryprivateregulatedregulationregulationsregulatorregulatoryrequirementsrulestransactions
SHARED TOKENS (17): "authority", "businesses", "even", "federal", "financial", "industry", "law", "primary", "private", "regulated", "regulation", "regulations", "regulator", "regulatory", "requirements", "rules", "transactions".
0.300
actactivityanalysisassetassociatedauthoritybusinessescapitalcommercialconsumercorporatecreditdepartmentsfeesfinancefinancialfunctionsindustryinformationinstitutional
SHARED TOKENS (43): "act", "activity", "analysis", "asset", "associated", "authority", "businesses", "capital", "commercial", "consumer", "corporate", "credit", "departments", "fees", "finance", "financial", "functions", "industry", "information", "institutional"....
0.300
actagainstagencyamongauthoritycommercialcorporationemployeefederalfinancialfirmsformgroupinstitutioninvestmentlawlessmarketpdfregulatory
SHARED TOKENS (20): "act", "against", "agency", "among", "authority", "commercial", "corporation", "employee", "federal", "financial", "firms", "form", "group", "institution", "investment", "law", "less", "market", "pdf", "regulatory".
0.300
Water pollution ↗ KW CROSS HIGH
activitiesagriculturalconditionscontroleffectformhumanindustrialinfrastructureirrigationmainmanagementmanufacturerspointpowerproductsrequiresresultstechnologywater
SHARED TOKENS (20): "activities", "agricultural", "conditions", "control", "effect", "form", "human", "industrial", "infrastructure", "irrigation", "main", "management", "manufacturers", "point", "power", "products", "requires", "results", "technology", "water".
0.300
Food allergy ↗ KW CROSS HIGH
againstamongcommonlyconditionsdevelopeddevelopmentearlygivinghighhistorymanagementprotectiveriskseparatesystemthemtreating
SHARED TOKENS (17): "against", "among", "commonly", "conditions", "developed", "development", "early", "giving", "high", "history", "management", "protective", "risk", "separate", "system", "them", "treating".
0.300
controlsdesignedenforcementfilefinancialfirmsframeworkinstitutionallawpolicypracticesregulatedregulationsregulatoryrelatedrelevantreportreportstransaction
SHARED TOKENS (19): "controls", "designed", "enforcement", "file", "financial", "firms", "framework", "institutional", "law", "policy", "practices", "regulated", "regulations", "regulatory", "related", "relevant", "report", "reports", "transaction".
0.300
accountbusinesscommercialcommonlyconsumercreditcustomercustomersdemandfinancialflowgovernmentinstitutionlenderslicensedlinesperiodrequirementssourcethough
SHARED TOKENS (20): "account", "business", "commercial", "commonly", "consumer", "credit", "customer", "customers", "demand", "financial", "flow", "government", "institution", "lenders", "licensed", "lines", "period", "requirements", "source", "though".
0.300
againstcannotcollegecreatescrediteducationfinancehistoryhomeinstitutionlawlinesmainmajorpropertyrequiresimilarvalue
SHARED TOKENS (18): "against", "cannot", "college", "creates", "credit", "education", "finance", "history", "home", "institution", "law", "lines", "main", "major", "property", "require", "similar", "value".
0.300
accountapplicationapproximatelybusinessesconnectedconstructiondemanddevelopeddifferentengineersevenhumanindustrialinvolvinglandmainmanagementmunicipalneednetwork
SHARED TOKENS (32): "account", "application", "approximately", "businesses", "connected", "construction", "demand", "developed", "different", "engineers", "even", "human", "industrial", "involving", "land", "main", "management", "municipal", "need", "network"....
0.300
Wire transfer ↗ Q334501 KW CROSS HIGH
accountcentralcreditdifferententityfederallessofficeoperatorsparticipatingprovidesmallersystemsystemstransactiontransactionsvalue
SHARED TOKENS (17): "account", "central", "credit", "different", "entity", "federal", "less", "office", "operators", "participating", "provide", "smaller", "system", "systems", "transaction", "transactions", "value".
0.300
americaauthoritycommerceconsumerconsumersdevelopedearlyenvironmentalevenhealthinformationlistlocalmarketsnamesnorthproductproductionprovidepublic
SHARED TOKENS (30): "america", "authority", "commerce", "consumer", "consumers", "developed", "early", "environmental", "even", "health", "information", "list", "local", "markets", "names", "north", "product", "production", "provide", "public"....
0.300
actadministrationagencyassistanceconditionscreditdepartmenteducationeffectsemploymentestablishedfederalhealthinspectlaborlawoccupationalregulationsregulatorysafety
SHARED TOKENS (24): "act", "administration", "agency", "assistance", "conditions", "credit", "department", "education", "effects", "employment", "established", "federal", "health", "inspect", "labor", "law", "occupational", "regulations", "regulatory", "safety"....
0.300
actamongapproximatelyassetbroaderbusinessesconsumerscreditdifferentearlyeconomicevenfinancialflowgovernmenthighhousingmajormarketobligations
SHARED TOKENS (27): "act", "among", "approximately", "asset", "broader", "businesses", "consumers", "credit", "different", "early", "economic", "even", "financial", "flow", "government", "high", "housing", "major", "market", "obligations"....
0.300
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | EXACT TITLE in manufacturing_food_processing: "Northwest Nazarene University".
0.300
Credit risk ↗ Q162714 KW CROSS HIGH
againstassetsassociatedbusinessconsumercreditemployeefinancialgeneralgovernmentgrantslendersmarketmeetobligationobligationspolicyprincipalprotectionrequire
SHARED TOKENS (22): "against", "assets", "associated", "business", "consumer", "credit", "employee", "financial", "general", "government", "grants", "lenders", "market", "meet", "obligation", "obligations", "policy", "principal", "protection", "require"....
0.300
actagainstapplicationscommercialcompliancecreditdesigneddevelopmentfederalfinancialhousinginformationlawlocalmeetpracticesregulatedregulatorysectiontitle
SHARED TOKENS (20): "act", "against", "applications", "commercial", "compliance", "credit", "designed", "development", "federal", "financial", "housing", "information", "law", "local", "meet", "practices", "regulated", "regulatory", "section", "title".
0.300
Digital wallet ↗ KW CROSS HIGH
accountadministrationfinancialgovgovernmenthealthholditemslicenselicensesmobilenearphysicalpointprivateprogrampurchasingsystemtransactionstransportation
SHARED TOKENS (22): "account", "administration", "financial", "gov", "government", "health", "hold", "items", "license", "licenses", "mobile", "near", "physical", "point", "private", "program", "purchasing", "system", "transactions", "transportation"....
0.300
Bank run ↗ Q806663 KW CROSS HIGH
accessacquireactassetsbecomebusinessescapitalcentralchaincommercialconsumerscorporationcustomersdirectlyeconomiceffectsevenfederalfinancialformer
SHARED TOKENS (35): "access", "acquire", "act", "assets", "become", "businesses", "capital", "central", "chain", "commercial", "consumers", "corporation", "customers", "directly", "economic", "effects", "even", "federal", "financial", "former"....
0.300
actagencycapitalcoveredfacilitiesfinancialfirmsformidentifiedinstitutioninternationalinvestmentlegallylicensemarketmultiplenationaloperationsprimaryprovide
SHARED TOKENS (24): "act", "agency", "capital", "covered", "facilities", "financial", "firms", "form", "identified", "institution", "international", "investment", "legally", "license", "market", "multiple", "national", "operations", "primary", "provide"....
0.300
agricultureapplicationcontroldevelopmentengineeringengineersindustriallawmakingmaterialmaterialsphysicalprocessingproductionproductswork
SHARED TOKENS (16): "agriculture", "application", "control", "development", "engineering", "engineers", "industrial", "law", "making", "material", "materials", "physical", "processing", "production", "products", "work".
0.300
Public finance ↗ Q274490 KW CROSS HIGH
academicallocationamongauthoritiescentraldirecteconomiceconomicseffecteffectsfinanceframeworkgovernmentmarketpolicypublicresearchrolesubjecttaxation
SHARED TOKENS (20): "academic", "allocation", "among", "authorities", "central", "direct", "economic", "economics", "effect", "effects", "finance", "framework", "government", "market", "policy", "public", "research", "role", "subject", "taxation".
0.300
authoritiesauthoritybuildingbuildingsbusinesscapitalcenterscommercecommercialcommonlycontainingestatefunctionshousinginvestmentlandlocalmaintainmultipleoffice
SHARED TOKENS (26): "authorities", "authority", "building", "buildings", "business", "capital", "centers", "commerce", "commercial", "commonly", "containing", "estate", "functions", "housing", "investment", "land", "local", "maintain", "multiple", "office"....
0.300
activityassetsbroaderbusinessbusinessescompliancecorporatecustomercustomersdesignedenforcementevenfinancialhumanidentitiesidentityindustryinformationinstitutionlaw
SHARED TOKENS (35): "activity", "assets", "broader", "business", "businesses", "compliance", "corporate", "customer", "customers", "designed", "enforcement", "even", "financial", "human", "identities", "identity", "industry", "information", "institution", "law"....
0.300
accountactadministrationconsumerconsumerscorporationcreditdocumentfederalfinancialgenerallyheldinstitutionlargernationalrequiresharesoldtruthunion
SHARED TOKENS (20): "account", "act", "administration", "consumer", "consumers", "corporation", "credit", "document", "federal", "financial", "generally", "held", "institution", "larger", "national", "require", "share", "sold", "truth", "union".
0.300
Salami ↗ Q188655 EXACT TITLE
amongcentralperiodpotentiallysupply
SHARED TOKENS (5): "among", "central", "period", "potentially", "supply". | EXACT TITLE in manufacturing_food_processing: "Salami".
0.300
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingbuildingscommonlyconstructiondepartmentdivisionfireincreasesinspectmemberspracticespreventionresultssafetyschools
SHARED TOKENS (15): "building", "buildings", "commonly", "construction", "department", "division", "fire", "increases", "inspect", "members", "practices", "prevention", "results", "safety", "schools".
0.300
actactivityadditionaladministeredagainstamongannualauthoritybureaucomplianceconsumercreditdatadepartmentdirecteconomicenforcementestablishfederalfinancial
SHARED TOKENS (42): "act", "activity", "additional", "administered", "against", "among", "annual", "authority", "bureau", "compliance", "consumer", "credit", "data", "department", "direct", "economic", "enforcement", "establish", "federal", "financial"....
0.300
businessbusinessescommercedifferentexecutivefirmsformindustriesindustrylocalmembersnetworkorganizationownerspolicyratherrepresentstradewhose
SHARED TOKENS (19): "business", "businesses", "commerce", "different", "executive", "firms", "form", "industries", "industry", "local", "members", "network", "organization", "owners", "policy", "rather", "represents", "trade", "whose".
0.300
actactivitiesbusinessescapitalcommercialconsumercorporatecreditcustomersdepartmentdistinctiondistinguishdivisionfinancialgeneralgreatinstitutioninvestmentmarketmembers
SHARED TOKENS (23): "act", "activities", "businesses", "capital", "commercial", "consumer", "corporate", "credit", "customers", "department", "distinction", "distinguish", "division", "financial", "general", "great", "institution", "investment", "market", "members"....
0.300
actadministrationagricultureanalysischaincontrolcontrolscriticaldepartmenteffectsestablishedestablishingfirmsgovernmenthealthindustrialindustriesindustryinspectinternational
SHARED TOKENS (39): "act", "administration", "agriculture", "analysis", "chain", "control", "controls", "critical", "department", "effects", "established", "establishing", "firms", "government", "health", "industrial", "industries", "industry", "inspect", "international"....
0.300
analysiscorecreditexternalfinancialgenerallyindustryinvestmentjobmanagementprofessionalresearchriskroletitle
SHARED TOKENS (15): "analysis", "core", "credit", "external", "financial", "generally", "industry", "investment", "job", "management", "professional", "research", "risk", "role", "title".
0.300
Central bank ↗ Q66344 KW CROSS HIGH
againstauthoritybusinesscentralcommercialconsumerdecisionsdevelopedeconomiceconomicsessentialevenfinancefinancialfrequentlygovernmentindependentinstitutionjurisdictionnational
SHARED TOKENS (29): "against", "authority", "business", "central", "commercial", "consumer", "decisions", "developed", "economic", "economics", "essential", "even", "finance", "financial", "frequently", "government", "independent", "institution", "jurisdiction", "national"....
0.300
agriculturalidaholandmajornorthwest
SHARED TOKENS (5): "agricultural", "idaho", "land", "major", "northwest". | EXACT TITLE in manufacturing_food_processing: "Snake River Plain".
0.300
againstassetconsumercreditdirectlyeducationfinancialgenerallyhomeindustryinvestmentlendersmaintainmajormeetperiodproductspropertyrequirerequirements
SHARED TOKENS (21): "against", "asset", "consumer", "credit", "directly", "education", "financial", "generally", "home", "industry", "investment", "lenders", "maintain", "major", "meet", "period", "products", "property", "require", "requirements"....
0.300
actaddressingadministrationagencyauthorityfederalgrantsguidanceindustrylawlegalmajormanufacturersmembersreportedreportsrequiressafetysalessimilar
SHARED TOKENS (21): "act", "addressing", "administration", "agency", "authority", "federal", "grants", "guidance", "industry", "law", "legal", "major", "manufacturers", "members", "reported", "reports", "requires", "safety", "sales", "similar"....
0.300
Debit card ↗ Q13499 KW CROSS HIGH
accountbecomecreditcustomersdevelopmentdifferentdirectlyfacilitiesfinancialgenerallynamephysicalsimilarsystemsthemtransactionsvalue
SHARED TOKENS (17): "account", "become", "credit", "customers", "development", "different", "directly", "facilities", "financial", "generally", "name", "physical", "similar", "systems", "them", "transactions", "value".
0.300
actactivitiesadditionalapproximatelyassetsbecomecapitalcommercialcommonlycorporationearlyenforcemententerestablishestablishedestateevenfederalfinancialformed
SHARED TOKENS (39): "act", "activities", "additional", "approximately", "assets", "become", "capital", "commercial", "commonly", "corporation", "early", "enforcement", "enter", "establish", "established", "estate", "even", "federal", "financial", "formed"....
0.300
actchaptercodedesigneddisclosuresestatefeeslawlendersmainpotentiallypracticesproviderealrequiresthemtitle
SHARED TOKENS (17): "act", "chapter", "code", "designed", "disclosures", "estate", "fees", "law", "lenders", "main", "potentially", "practices", "provide", "real", "requires", "them", "title".
0.300
actbureauconsumerconsumerscreditdatafederalfinancialinformationprivateprotectionregulatesreportingreportstrade
SHARED TOKENS (15): "act", "bureau", "consumer", "consumers", "credit", "data", "federal", "financial", "information", "private", "protection", "regulates", "reporting", "reports", "trade".
0.300
agriculturalagriculturebusinesscodecombinesconditionsconventionalcreatecropeffectsenvironmentalformgrowinghighhumanlandlivestockmultipleneighboringpractices
SHARED TOKENS (28): "agricultural", "agriculture", "business", "code", "combines", "conditions", "conventional", "create", "crop", "effects", "environmental", "form", "growing", "high", "human", "land", "livestock", "multiple", "neighboring", "practices"....
0.300
againstbusinessbuyerscommercialcommonlycoveredestateevidencefeefinancialfireformformedfoundgeneralgenerallyindependentinstitutionallandlaw
SHARED TOKENS (39): "against", "business", "buyers", "commercial", "commonly", "covered", "estate", "evidence", "fee", "financial", "fire", "form", "formed", "found", "general", "generally", "independent", "institutional", "land", "law"....
0.300
agencyassetassetsbuildingscommercialcommonlydifferentestategenerallygivinggovernmentgroupinvestmentmajormarketobligationsofficeownedprincipalrather
SHARED TOKENS (31): "agency", "asset", "assets", "buildings", "commercial", "commonly", "different", "estate", "generally", "giving", "government", "group", "investment", "major", "market", "obligations", "office", "owned", "principal", "rather"....
0.300
agencydepartmenteducationemployeeemployeesenforcementengineersenvironmentalestablishingexecutivefederalfederallyfinancialgovernmentheadquartersindependentindustriesinformationjulylegal
SHARED TOKENS (34): "agency", "department", "education", "employee", "employees", "enforcement", "engineers", "environmental", "establishing", "executive", "federal", "federally", "financial", "government", "headquarters", "independent", "industries", "information", "july", "legal"....
0.300
financialprotectionsafetysystemsystems
SHARED TOKENS (5): "financial", "protection", "safety", "system", "systems". | EXACT TITLE in banking_and_credit: "Deposit insurance".
0.300
acquisitionassociatedconnectionscontroldatadistributedfunctionsindustrialindustrieslargerpowerprocessingsmallsystemsystemsthough
SHARED TOKENS (16): "acquisition", "associated", "connections", "control", "data", "distributed", "functions", "industrial", "industries", "larger", "power", "processing", "small", "system", "systems", "though".
0.300
accessassociatedconsumercreditdepartmentdesignedgenerallyinvolvinglesslocallyneedpersonnelprincipalreporttitle
SHARED TOKENS (15): "access", "associated", "consumer", "credit", "department", "designed", "generally", "involving", "less", "locally", "need", "personnel", "principal", "report", "title".
0.300
aloneamongbusinessbusinesseschannelsconceptconnectcorecreatecurrentcustomersexistingextendextensionfirmsgeographicallygovernmentidentifiedmainmarket
SHARED TOKENS (34): "alone", "among", "business", "businesses", "channels", "concept", "connect", "core", "create", "current", "customers", "existing", "extend", "extension", "firms", "geographically", "government", "identified", "main", "market"....
0.300
Data breach ↗ Q1172486 KW CROSS HIGH
againstbecomecannotcommonlycontainingdatadirecteconomicenforcementengineeringevidencefinancialfirmsidentityinformationlawpreventionrecordsrequirerisk
SHARED TOKENS (25): "against", "become", "cannot", "commonly", "containing", "data", "direct", "economic", "enforcement", "engineering", "evidence", "financial", "firms", "identity", "information", "law", "prevention", "records", "require", "risk"....
0.300
acquirecentercorporationcreatefoundedheadquarterednetworknorthoperatesoperatingpacificprincipalreportingsystemtransportationunionwestwestern
SHARED TOKENS (18): "acquire", "center", "corporation", "create", "founded", "headquartered", "network", "north", "operates", "operating", "pacific", "principal", "reporting", "system", "transportation", "union", "west", "western".
0.300
Food industry ↗ Q540912 KW CROSS HIGH
academicactivitiesagencyagriculturalagriculturebecomebusinessesconstructionconsumerscreditdevelopmentdirectlyeconomiceducationengineeringequipmentfinancialfirmsgenericindustrial
SHARED TOKENS (59): "academic", "activities", "agency", "agricultural", "agriculture", "become", "businesses", "construction", "consumers", "credit", "development", "directly", "economic", "education", "engineering", "equipment", "financial", "firms", "generic", "industrial"....
0.300
Mortgage bank ↗ KW CROSS HIGH
activitiesadditionalbusinessbusinessescapitalcommercialconsumerconsumerscreditcustomersdirectlydiscoveryeligibleenterentityfederalfederallyfeefeesframework
SHARED TOKENS (43): "activities", "additional", "business", "businesses", "capital", "commercial", "consumer", "consumers", "credit", "customers", "directly", "discovery", "eligible", "enter", "entity", "federal", "federally", "fee", "fees", "framework"....
0.300
administeredadministersagencyagriculturalagricultureapproximatelyassistancecommercialcurrentdepartmentdirectlyexecutivefederalgovernmentlivestockmeetnationalproductionprogramprograms
SHARED TOKENS (24): "administered", "administers", "agency", "agricultural", "agriculture", "approximately", "assistance", "commercial", "current", "department", "directly", "executive", "federal", "government", "livestock", "meet", "national", "production", "program", "programs"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
appliedauthoritybuildingbuildingschargescodecomplianceconstructioncontroldepartmentsdistricteffectsengineersenvironmentalestategeneralgenerallyhealthinternationaljurisdiction
SHARED TOKENS (41): "applied", "authority", "building", "buildings", "charges", "code", "compliance", "construction", "control", "departments", "district", "effects", "engineers", "environmental", "estate", "general", "generally", "health", "international", "jurisdiction"....
0.300
analysisbusinesscapabilitieschaincombineseducationengineeringengineersequipmentfinanceflowhealthcarehumanindustrialindustriesinformationknowledgelabormanagementmaterials
SHARED TOKENS (33): "analysis", "business", "capabilities", "chain", "combines", "education", "engineering", "engineers", "equipment", "finance", "flow", "healthcare", "human", "industrial", "industries", "information", "knowledge", "labor", "management", "materials"....
0.300
Fraud ↗ Q28813 EXACT TITLE
authoritiesdocumentlawlegalproperty
SHARED TOKENS (5): "authorities", "document", "law", "legal", "property". | EXACT TITLE in banking_and_credit: "Fraud".
0.300
U.S. Bancorp ↗ Q739084 KW CROSS HIGH
acquiredactadministrationamongannualassetbusinessbusinessescreditearlyentityfederalfinancialheadquarteredhistoryinstitutioninvestmentmarketmultiplenational
SHARED TOKENS (31): "acquired", "act", "administration", "among", "annual", "asset", "business", "businesses", "credit", "early", "entity", "federal", "financial", "headquartered", "history", "institution", "investment", "market", "multiple", "national"....
0.300
appliesfacilitieshighindustrialindustriesindustrymaterialsmunicipalpowerproduceproductionregulationssewerspecializedsystemtreatedtreatingwater
SHARED TOKENS (18): "applies", "facilities", "high", "industrial", "industries", "industry", "materials", "municipal", "power", "produce", "production", "regulations", "sewer", "specialized", "system", "treated", "treating", "water".
0.300
additionalassetscapitaldemandestateexistingfinancegeneralhighlegallendersmarketmeetobligationpointrealrisksmallersystemsthem
SHARED TOKENS (21): "additional", "assets", "capital", "demand", "estate", "existing", "finance", "general", "high", "legal", "lenders", "market", "meet", "obligation", "point", "real", "risk", "smaller", "systems", "them"....
0.300
controlcontrolsexperienceidentificationjobknowledgelistsmaintainmajormanagementpersonnelphysicalplacesproductproductionqualityrecordsrelationshipsrequirementsresults
SHARED TOKENS (23): "control", "controls", "experience", "identification", "job", "knowledge", "lists", "maintain", "major", "management", "personnel", "physical", "places", "product", "production", "quality", "records", "relationships", "requirements", "results"....
0.300
Wholesaling ↗ Q220695 KW CROSS HIGH
businessbusinessescommercialconsumerconsumersdirectlygeneralindustrialinstitutionalmanufacturersmarketmarketsorganizationproductsprofessionalpurchasingratherrelatedretailerssource
SHARED TOKENS (22): "business", "businesses", "commercial", "consumer", "consumers", "directly", "general", "industrial", "institutional", "manufacturers", "market", "markets", "organization", "products", "professional", "purchasing", "rather", "related", "retailers", "source"....
0.300
Private equity ↗ KW CROSS HIGH
activebusinesscapitalcategorycontroldevelopmentexpansionfinancefinancialfirmsgeneralinvestmentmanagementoperationalotherwiseownershipprivateproductproductsprovide
SHARED TOKENS (24): "active", "business", "capital", "category", "control", "development", "expansion", "finance", "financial", "firms", "general", "investment", "management", "operational", "otherwise", "ownership", "private", "product", "products", "provide"....
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessaccountarticlecreditdataeffectsevenfinancialgenerallygovernmentheldidentifyingidentityinformationinvolvinglegallylicensemajornameobtain
SHARED TOKENS (31): "access", "account", "article", "credit", "data", "effects", "even", "financial", "generally", "government", "held", "identifying", "identity", "information", "involving", "legally", "license", "major", "name", "obtain"....
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesagriculturalassociatedchaindistributedequipmentmaintainmanagementproduceproductionproductsqualityrequiressafetysequencestoragesupply
SHARED TOKENS (17): "activities", "agricultural", "associated", "chain", "distributed", "equipment", "maintain", "management", "produce", "production", "products", "quality", "requires", "safety", "sequence", "storage", "supply".
0.300
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahowestern
SHARED TOKENS (5): "agricultural", "approximately", "boise", "idaho", "western". | EXACT TITLE in manufacturing_food_processing: "Boise River".
0.300
applicableappliesauthoritybusinesscapitalconsumercontrolcontrolscreditfinancialformframeworkholdmainpolicyprotectionpublicregulationregulatoryrelated
SHARED TOKENS (29): "applicable", "applies", "authority", "business", "capital", "consumer", "control", "controls", "credit", "financial", "form", "framework", "hold", "main", "policy", "protection", "public", "regulation", "regulatory", "related"....
0.300
accessacquireapplicationsbusinesscontrolcriticaldatadatabasesdiscoveryformgovernmentguidanceindustryinformationinfrastructureknowledgelegalmajormanagementoperations
SHARED TOKENS (41): "access", "acquire", "applications", "business", "control", "critical", "data", "databases", "discovery", "form", "government", "guidance", "industry", "information", "infrastructure", "knowledge", "legal", "major", "management", "operations"....
0.300
businessbusinessescommercialcreatedecisionsentrepreneurialfirmsidentifiedinfluencemanagementmultipleorganizationownershiprelatedrelationships
SHARED TOKENS (15): "business", "businesses", "commercial", "create", "decisions", "entrepreneurial", "firms", "identified", "influence", "management", "multiple", "organization", "ownership", "related", "relationships".
🫐 BERRY53 edges
0.280
assetassetsbusinesscommonlydifferentequipmentestateformlegallendersmeansrealsystemswhose
SHARED TOKENS (14): "asset", "assets", "business", "commonly", "different", "equipment", "estate", "form", "legal", "lenders", "means", "real", "systems", "whose".
0.280
highopenedretailerssold
SHARED TOKENS (4): "high", "opened", "retailers", "sold". | EXACT TITLE in manufacturing_food_processing: "Summer sausage".
0.280
estatefinancialguidanceinformationinvestmentlicensingmanagementplanningprofessionalprovideregisteredregulatoryrelationshipstraining
SHARED TOKENS (14): "estate", "financial", "guidance", "information", "investment", "licensing", "management", "planning", "professional", "provide", "registered", "regulatory", "relationships", "training".
0.280
Private banking ↗ KW CROSS HIGH
assetassetscustomerdescriptionfinancialgeneralhighinvestmentmanagementprivateproviderelationshipretailsingle
SHARED TOKENS (14): "asset", "assets", "customer", "description", "financial", "general", "high", "investment", "management", "private", "provide", "relationship", "retail", "single".
0.280
controlcontrolscorporatecorporationdistinguishfinancialhomeinternationalinvestmentmultipleoperatingorganizationownsproduction
SHARED TOKENS (14): "control", "controls", "corporate", "corporation", "distinguish", "financial", "home", "international", "investment", "multiple", "operating", "organization", "owns", "production".
0.280
automatedchargescontainingcreditdesigneddirectfeesfinancialnetworkparticipatingprocessingsupportsystemtransactions
SHARED TOKENS (14): "automated", "charges", "containing", "credit", "designed", "direct", "fees", "financial", "network", "participating", "processing", "support", "system", "transactions".
0.280
boiseidahoownedwestern
SHARED TOKENS (4): "boise", "idaho", "owned", "western". | EXACT TITLE in banking_and_credit: "Idaho Statesman".
0.280
Whey ↗ Q185009 EXACT TITLE
chaincommercialmakingproducts
SHARED TOKENS (4): "chain", "commercial", "making", "products". | EXACT TITLE in manufacturing_food_processing: "Whey".
0.280
createproduceproducingroles
SHARED TOKENS (4): "create", "produce", "producing", "roles". | EXACT TITLE in manufacturing_food_processing: "Food microbiology".
0.280
americacorporationemployeesoperations
SHARED TOKENS (4): "america", "corporation", "employees", "operations". | EXACT TITLE in manufacturing_food_processing: "Packaging Corporation of America".
0.280
Ada County, Idaho ↗ KW CROSS HIGH
adaboisecapitaldistricthighwayhomeidahojurisdictionlocalmetropolitannorthwestpacificprivatewashington
SHARED TOKENS (14): "ada", "boise", "capital", "district", "highway", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "private", "washington".
0.260
businessdifferentflow
SHARED TOKENS (3): "business", "different", "flow". | EXACT TITLE in banking_and_credit: "Business loan".
0.260
Butcher ↗ Q329737 EXACT TITLE
marketspreparationretail
SHARED TOKENS (3): "markets", "preparation", "retail". | EXACT TITLE in manufacturing_food_processing: "Butcher".
0.260
Credit score ↗ Q1787103 KW CROSS HIGH
analysisconsumerscreditcustomersdatadepartmentsfinancegovernmentinformationlendersmobilereportrisk
SHARED TOKENS (13): "analysis", "consumers", "credit", "customers", "data", "departments", "finance", "government", "information", "lenders", "mobile", "report", "risk".
0.260
establishestateformhomelandmarketpropertyrealreportreportsroletaxationvalue
SHARED TOKENS (13): "establish", "estate", "form", "home", "land", "market", "property", "real", "report", "reports", "role", "taxation", "value".
0.240
authoritycorporationdistrictdistrictsentitygovernmentirrigationlocalobtainpowerpublicwater
SHARED TOKENS (12): "authority", "corporation", "district", "districts", "entity", "government", "irrigation", "local", "obtain", "power", "public", "water".
0.240
Barley ↗ Q11577 KW CROSS HIGH
amongcommonlygivinglessmajormakingmaterialnamespreparationproductionrolesource
SHARED TOKENS (12): "among", "commonly", "giving", "less", "major", "making", "material", "names", "preparation", "production", "role", "source".
0.240
applicationapplicationsestablishedfinancefinancialfirmsindustrymobileplatformsproductssystemstechnology
SHARED TOKENS (12): "application", "applications", "established", "finance", "financial", "firms", "industry", "mobile", "platforms", "products", "systems", "technology".
0.240
accountcreditcustomerfinancialgenerallyinstitutioninstructionmakingmultiplesinglesystemstransaction
SHARED TOKENS (12): "account", "credit", "customer", "financial", "generally", "institution", "instruction", "making", "multiple", "single", "systems", "transaction".
0.240
Sugar industry ↗ Q227870 KW CROSS HIGH
economicindustryinternationalmarketmarketingprocessingproduceproducesproductionproductsrolesupporting
SHARED TOKENS (12): "economic", "industry", "international", "market", "marketing", "processing", "produce", "produces", "production", "products", "role", "supporting".
0.240
buildingbuildingscontroldesignedengineersenvironmentaloperatingprovidequalitysystemstechnologywater
SHARED TOKENS (12): "building", "buildings", "control", "designed", "engineers", "environmental", "operating", "provide", "quality", "systems", "technology", "water".
0.240
Bridge loan ↗ Q2079582 KW CROSS HIGH
additionalapplicationsbusinessconventionaldocumentationfeesfinancegenerallylargerperiodrequirerisk
SHARED TOKENS (12): "additional", "applications", "business", "conventional", "documentation", "fees", "finance", "generally", "larger", "period", "require", "risk".
0.220
meansperiodprocessingrealreviewsrisksubjectsystemsystemstransactiontransactions
SHARED TOKENS (11): "means", "period", "processing", "real", "reviews", "risk", "subject", "system", "systems", "transaction", "transactions".
0.220
centralconstructiongenerallyhumanindustrialindustrylivestockprocessingproducingproductionproducts
SHARED TOKENS (11): "central", "construction", "generally", "human", "industrial", "industry", "livestock", "processing", "producing", "production", "products".
0.220
brandindependentitemsnameoperationsphysicalproducesproductproductsrathersales
SHARED TOKENS (11): "brand", "independent", "items", "name", "operations", "physical", "produces", "product", "products", "rather", "sales".
0.220
Bank fraud ↗ Q4856011 KW CROSS HIGH
appliesassetsfinancialformheldinstitutionmeansobtainownedpotentiallyproperty
SHARED TOKENS (11): "applies", "assets", "financial", "form", "held", "institution", "means", "obtain", "owned", "potentially", "property".
0.220
actauthorizedcapitalcommonlydesignedeconomicgovernmenthousingmarketpracticesregulations
SHARED TOKENS (11): "act", "authorized", "capital", "commonly", "designed", "economic", "government", "housing", "market", "practices", "regulations".
0.220
soldwater
SHARED TOKENS (2): "sold", "water". | EXACT TITLE in manufacturing_food_processing: "Frozen dessert".
0.210
storage
SHARED TOKENS (1): "storage". | EXACT TITLE in manufacturing_food_processing: "Cold storage".
0.210
national
SHARED TOKENS (1): "national". | EXACT TITLE in banking_and_credit: "National bank".
0.210
Bel Group ↗ Q491034 EXACT TITLE
group
SHARED TOKENS (1): "group". | EXACT TITLE in manufacturing_food_processing: "Bel Group".
0.200
Sanction ↗ Q407075 EXACT TITLE
EXACT TITLE in banking_and_credit: "Sanction".
0.200
directequipmentidentifyingindustrieslawpowerrequiressafetytestingwork
SHARED TOKENS (10): "direct", "equipment", "identifying", "industries", "law", "power", "requires", "safety", "testing", "work".
0.200
aloneestatefinancefinancialgeneralplanningproductsprofessionalrulework
SHARED TOKENS (10): "alone", "estate", "finance", "financial", "general", "planning", "products", "professional", "rule", "work".
0.200
Collateral ↗ Q2982746 EXACT TITLE
EXACT TITLE in banking_and_credit: "Collateral".
0.180
acquiredactanalysisconventionalessentialqualityratherseparatewater
SHARED TOKENS (9): "acquired", "act", "analysis", "conventional", "essential", "quality", "rather", "separate", "water".
0.180
activitybusinesscurrentexistingfinancefutureinvestmentmeanssmall
SHARED TOKENS (9): "activity", "business", "current", "existing", "finance", "future", "investment", "means", "small".
0.180
commonlyconditionscontrolledeffectsindustrialmaterialproducerapidrole
SHARED TOKENS (9): "commonly", "conditions", "controlled", "effects", "industrial", "material", "produce", "rapid", "role".
0.180
accessactassetscontrolelderfinancialotherwiserelationshipresults
SHARED TOKENS (9): "access", "act", "assets", "control", "elder", "financial", "otherwise", "relationship", "results".
0.180
consumerhighitemsproductsretailerssalessmallsoldwarehouse
SHARED TOKENS (9): "consumer", "high", "items", "products", "retailers", "sales", "small", "sold", "warehouse".
0.160
associatedboisecenterextendsfederallyidahometropolitanvalley
SHARED TOKENS (8): "associated", "boise", "center", "extends", "federally", "idaho", "metropolitan", "valley".
0.160
accountcurrentfeesgenerallymarketmarketsrequiretransaction
SHARED TOKENS (8): "account", "current", "fees", "generally", "market", "markets", "require", "transaction".
0.140
Trust deed ↗ Q7848150 KW CROSS HIGH
conceptestategenerallawlegalrealsystems
SHARED TOKENS (7): "concept", "estate", "general", "law", "legal", "real", "systems".
0.140
engineerslinesmakingmaterialmeetproductsource
SHARED TOKENS (7): "engineers", "lines", "making", "material", "meet", "product", "source".
0.140
actactivitiesconsumersestablishfederalprovisionsregulation
SHARED TOKENS (7): "act", "activities", "consumers", "establish", "federal", "provisions", "regulation".
0.140
applicableapproximatelydirectlyeconomiceffectsevenperiod
SHARED TOKENS (7): "applicable", "approximately", "directly", "economic", "effects", "even", "period".
0.140
buildingbuildingscenterfireinterstateoregonwashington
SHARED TOKENS (7): "building", "buildings", "center", "fire", "interstate", "oregon", "washington".
0.140
connectionentityoriginateprincipalprivatesoldtransactions
SHARED TOKENS (7): "connection", "entity", "originate", "principal", "private", "sold", "transactions".
0.140
By-product ↗ Q1128255 KW CROSS HIGH
commercialdistinctionhumanprimaryproductproductionproducts
SHARED TOKENS (7): "commercial", "distinction", "human", "primary", "product", "production", "products".
0.120
accountbusinessestablishedfinancialinstitutiontransactions
SHARED TOKENS (6): "account", "business", "established", "financial", "institution", "transactions".
0.120
Bank teller ↗ Q806805 KW CROSS HIGH
customeremployeehandlingnorthplaceswhose
SHARED TOKENS (6): "customer", "employee", "handling", "north", "places", "whose".
0.100
boisecanyonidahometropolitannampa
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "nampa".
0.100
Natural food ↗ Q6980681 KW CROSS HIGH
generallymarketingprocessingregulatedregulation
SHARED TOKENS (5): "generally", "marketing", "processing", "regulated", "regulation".
◈ Frequently Asked Questions
Manufacturing Food Processing × Banking And Credit — Treasure Valley
HAIKU · HIGH GATE
How do food processing companies in Nampa and Caldwell access credit to expand operations along the Interstate 84 corridor?
Food manufacturers in Canyon County access expansion financing through Treasure Valley banks that specialize in agricultural and processing sector lending. These financial institutions evaluate collateral and cash flow from operations tied to Idaho's established farm supply chains that feed processing facilities throughout the western metropolitan area.
What role do mergers and acquisitions play in connecting food processing firms with banking services in Boise and the Treasure Valley?
Mergers and acquisitions of food processing companies in Ada County and Canyon County often require acquisition financing arranged by Treasure Valley banking partners familiar with processing industry operations. Banks evaluating these deals draw on economic development data showing the region's processing capacity concentrated in Nampa, Caldwell, and Kuna industrial zones.
How do Boise State University and College of Western Idaho support financial literacy for food processing entrepreneurs?
Boise State University and College of Western Idaho offer business and agricultural financing programs that prepare food processing entrepreneurs in the Treasure Valley to present bankable operations plans to local lenders. These institutions connect graduates to Canyon County and Ada County banking resources aligned with processing sector growth.
Which banking institutions in the Treasure Valley offer specialized lending for food processing equipment purchases in Meridian and Eagle?
Regional banks operating in Meridian, Eagle, and greater Boise extend equipment financing lines to food processing facilities expanding in these high-growth areas of Ada County. These lenders understand the capital intensity of processing operations and structure credit products around the seasonal revenue patterns common in Idaho food manufacturing.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Manufacturing Food Processing × Banking And Credit 14 QID bridges 295 edges 7,551 ext links 2026-07-17 21:51:20 UTC 6cdb66ca34411564
Manufacturing Food Processing corridor ↗ Banking And Credit corridor ↗ Banking And Credit × Manufacturing Food Processing ↗ boisestandard.org/standard ↗
Parent Corridors
Manufacturing Food Processing × All Other Verticals