—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Government Civic ↔ relates to ↔ Land Use Planning

40 Wikipedia bridge articles confirmed in both vertical ledgers. 214 deterministic cross-vertical edges. 5,424 external source links harvested. Every edge provenance-stamped. Every claim auditable.

40 QID Bridge Articles
214 Cross Edges
5,424 External Sources
264 Wikipedia Articles
40 🌲 Evergreen
142 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Government Civic
× Land Use Planning
QID Bridge Articles
40
confirmed Wikipedia overlap
Total Cross Edges
214
External Sources Harvested
5,424
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  26 shared tokens
QID Bridge Titles (20)
IdahoBureau of ReclamationStormwaterBus rapid transitAquiferFederal Transit AdministrationTransportation planningUniversity of IdahoGroundwaterUrban renewalBoise State UniversityBoise AirportCollege of Western IdahoTreasure ValleyWastewaterIdaho Transportation DepartmentIdaho LegislatureWater rightBoise RiverMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationpublicgovernmentwateradametropolitanlandwesternagencycitiesurbantransportationhomeagriculturalriverdepartmentfederallocal
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:04:35 UTC
Content Hash
7bd5624549c0db42
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
40 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (26): "agricultural", "agriculture", "associated", "boise", "capital", "contains", "distinct", "economy", "geographic", "idaho", "land", "largest", "linked", "national", "official", "population", "restricted", "river", "separate", "significant".... | EXACT TITLE in government_civic: "Idaho". | EXACT TITLE in land_use_planning: "Idaho".
agriculturalagricultureassociatedboisecapitalcontainsdistincteconomygeographicidaholandlargestlinkednationalofficialpopulationrestrictedriverseparatesignificantsquaresuppliestechnologyterritoryuseswestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (30): "act", "agency", "applied", "become", "built", "bureau", "delivery", "department", "development", "established", "farmland", "federal", "funding", "government", "irrigation", "largest", "law", "management", "potential", "power".... | EXACT TITLE in government_civic: "Bureau of Reclamation". | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
actagencyappliedbecomebuiltbureaudeliverydepartmentdevelopmentestablishedfarmlandfederalfundinggovernmentirrigationlargestlawmanagementpotentialpowerprogramprojectsreclamationresourcerevenuesourcesupplysurveywaterwestern
the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
ial source of the program's funding. Because Texas had no federal lands, it did not become a Reclamation state until 1906, when Congress passed a law including it in the provisions of the Reclamation Act. History From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
Stormwater
Q1421263 EXACT TITLE 1.000
QID OVERLAP: Q1421263 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (23): "addition", "become", "bodies", "cities", "create", "demand", "developed", "directly", "groundwater", "land", "large", "major", "plants", "population", "potential", "related", "resource", "stormwater", "timing", "treatment".... | EXACT TITLE in government_civic: "Stormwater". | EXACT TITLE in land_use_planning: "Stormwater".
additionbecomebodiescitiescreatedemanddevelopeddirectlygroundwaterlandlargemajorplantspopulationpotentialrelatedresourcestormwatertimingtreatmenturbanwaterwetlands
unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
With less vegetation and more impervious surfaces (parking lots, roads, buildings, compacted soil), developed areas allow less rain to infiltrate into the ground, and more runoff is generated than in undeveloped conditions. Additionally, passages such as ditches and storm sewers quickly transport runoff away from commercial and residential areas into nearby water bodies. This greatly increases the volume of water in waterways and the discharge of those waterways, leading to erosion and flooding. Because the water is flushed out of the watershed during the storm event, little infiltrates the soil, replenishes groundwater, or supplies stream baseflow in dry weather. A first flush is the initial runoff of a rainstorm. During this phase, polluted water entering storm drains in areas with high proportions of impervious surfaces is typically more concentrated compared to the remainder of the storm. Consequently, these high concentrations of urban runoff result in high levels of pollutants discharged from storm sewers to surface waters. Daily human activities result in deposition of pollutants on roads, lawns, roofs, farm fields, and other land surfaces. Such pollutants include trash, sediment, nutrients, bacteria, pesticides, metals, and petroleum byproducts. When it rains or there is irrigation, water runs off and ultimately makes its way to a river, lake, or ocean.
Stormwater runoff as a source of pollution In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. In natural catchments (watersheds) surface runoff entering waterways is a relatively rare event, occurring only a few times each year and generally after larger storms. Before land development occurs in a particular area, most rainfall soaks into the ground and contributes to groundwater recharge, or is recycled into the atmosphere by vegetation through evapotranspiration. Modern drainage systems, which collect runoff from impervious surfaces (e.g., roofs and roads), ensure that water is efficiently moved to waterways through pipe networks, meaning that even small storms result in increased waterway flows. In addition to delivering higher pollutants from the urban catchment, increased stormwater flow can lead to stream erosion, encourage weed invasion, and alter natural flow regimes. Native species often rely on such flow regimes for spawning, juvenile development, and migration.
Bus rapid transit
Q2878855 EXACT TITLE 1.000
QID OVERLAP: Q2878855 in government_civic (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (20): "capacity", "capital", "cities", "connecting", "conventional", "cost", "design", "interact", "largest", "network", "priority", "public", "quality", "rapid", "single", "system", "systems", "traffic", "transit", "transportation". | EXACT TITLE in land_use_planning: "Bus rapid transit".
capacitycapitalcitiesconnectingconventionalcostdesigninteractlargestnetworkprioritypublicqualityrapidsinglesystemsystemstraffictransittransportation
Bus rapid transit (BRT), also referred to as a busway or transitway, is a trolleybus, electric bus, or bus service system designed to have higher capacity, reliability, and other quality features than a conventional bus system. Typically, a BRT system includes roadways that are dedicated to buses, and gives priority to buses at intersections where buses may interact with other traffic, alongside design features to reduce delays caused by passengers boarding or disembarking buses, or paying fares. BRT aims to combine the capacity and speed of a light rail transit (LRT) or mass rapid transit (MRT) system with the flexibility, lower cost and simplicity of a bus system. Although some cities, such as Lima, Liège and Runcorn, pioneered segregated busway systems with some BRT features, the first city to fully integrate every BRT feature into a single system was Curitiba with the Rede Integrada de Transporte in 1974. As of March 2018, a total of 166 cities in six continents have implemented BRT systems, accounting for 4,906 km (3,048 mi) of BRT lanes and about 32.2 million passengers every day. The majority of these are in Latin America, where about 19.6 million passengers ride daily, and which has the most cities with BRT systems, with 54, led by Brazil with 21 cities. The Latin American countries with the most daily ridership are Brazil (10.7 million), Colombia (3.0 million), and Mexico (2.5 million). In the other regions, China (4.3 million) and Iran (2.1 million) stand out.
at intersections where buses may interact with other traffic, alongside design features to reduce delays caused by passengers boarding or disembarking buses, or paying fares. BRT aims to combine the capacity and speed of a light rail transit (LRT) or mass rapid transit (MRT) system with the flexibility, lower cost and simplicity of a bus system. Although some cities, such as Lima, Liège and Runcorn, pioneered segregated busway systems with some BRT features, the first city to fully integrate every BRT feature into a single system was Curitiba with the Rede Integrada de Transporte in 1974. As of March 2018, a total of 166 cities in six continents have implemented BRT systems, accounting for 4,906 km (3,048 mi) of BRT lanes and about 32.2 million passengers every day. The majority of these are in Latin America, where about 19.6 million passengers ride daily, and which has the most cities with BRT systems, with 54, led by Brazil with 21 cities. The Latin American countries with the most daily ridership are Brazil (10.7 million), Colombia (3.0 million), and Mexico (2.5 million). In the other regions, China (4.3 million) and Iran (2.1 million) stand out.
rk in the world, with about 264.6 kilometres (164.4 mi) of corridors connecting the Indonesian capital city. Terminology Bus rapid transit is a mode of mass rapid transit (MRT) and describes a high-capacity urban public-transit system with its own right of way, vehicles at short headways, platform-level boarding, and preticketing. The expression "BRT" is mainly used in the Americas and China; in India, it is called "BRTS" (BRT System); in Europe it is often called a "busway" or a "BHLS" (stands for Bus with a High Level of Service). The term transitway was originated in 1981 with the opening of the OC Transpo transitway in Ottawa, Ontario, Canada. Critics have charged that the term "bus rapid transit" has sometimes been misapplied to systems that lack most or all the essential features which differentiate it from conventional bus services.
Aquifer
Q208791 EXACT TITLE 1.000
QID OVERLAP: Q208791 in government_civic (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (15): "beyond", "formation", "groundwater", "home", "industrial", "land", "layer", "major", "material", "materials", "pressure", "related", "source", "study", "water". | EXACT TITLE in land_use_planning: "Aquifer".
beyondformationgroundwaterhomeindustriallandlayermajormaterialmaterialspressurerelatedsourcestudywater
as home or industrial use. Groundwater is a major source of fresh water for many regions, although it can present various challenges for the environment, such as overdrafting (extracting groundwater beyond the equilibrium yield of the aquifer), groundwater-related subsidence of land, and the salinization or pollution of the groundwater. Etymology The word aquifer is derived from the latin prefix aqui-, the combining form of aqua meaning "water," and suffix -fer, meaning "bearing."
Undersea Remote sensing in 2015 and direct sampling in 2025 discovered an undersea reservoir of fresh water off the coast of Nantucket, stretching possibly from New Jersey to Maine and thus representing one of the largest freshwater aquifers in the United States. The aquifer itself may represent glacial meltwater once overlain by dry land that subsequently was flooded by rising sea levels—as caused by the Holocene glacial retreat. Or it, (the aquifer) may maintain long-term groundwater flow connections along the US east coast, and thereby is recharged even today by contemporary rainfall over coastal surface lands. Human use of groundwater Challenges for using groundwater include: overdrafting (extracting groundwater beyond the equilibrium yield of the aquifer), groundwater-related subsidence of land, groundwater becoming saline, and groundwater pollution. By country or continent Africa Aquifer depletion is a problem in some areas, especially in northern Africa, where one example is the Great Manmade River project of Libya.
s include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
F
Q5440472 EXACT TITLE 1.000
QID OVERLAP: Q5440472 in government_civic (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (28): "administration", "administrative", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "grants", "local", "mandates", "office", "offices", "operators", "programs", "providers", "public".... | EXACT TITLE in land_use_planning: "Federal Transit Administration".
administrationadministrativeagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentgrantslocalmandatesofficeofficesoperatorsprogramsproviderspublicregionalrequirementsstatutorysystemstechnicaltransittransportationurban
The Federal Transit Administration (FTA) is an agency within the United States Department of Transportation (DOT) that provides financial and technical assistance to local public transportation systems. The FTA is one of ten modal administrations within the DOT. Headed by an Administrator who is appointed by the president of the United States, the FTA functions through its Washington, D.C., headquarters office and ten regional offices which assist transit agencies in all states, the District of Columbia, and the territories. Until 1991, it was known as the Urban Mass Transportation Administration (UMTA). Public transportation includes buses, subways, light rail, commuter rail, monorail, passenger ferry boats, trolleys, inclined railways, and people movers. The federal government, through the FTA, provides financial assistance to develop new transit systems and improve, maintain, and operate existing systems. The FTA oversees grants to state and local transit providers, primarily through its ten regional offices.
C., headquarters office and ten regional offices which assist transit agencies in all states, the District of Columbia, and the territories. Until 1991, it was known as the Urban Mass Transportation Administration (UMTA). Public transportation includes buses, subways, light rail, commuter rail, monorail, passenger ferry boats, trolleys, inclined railways, and people movers. The federal government, through the FTA, provides financial assistance to develop new transit systems and improve, maintain, and operate existing systems. The FTA oversees grants to state and local transit providers, primarily through its ten regional offices.
History In 1962, President John F. Kennedy sent a message to the U.S. Congress calling for the creation of a program of federal capital assistance for mass transportation. President Kennedy said, "To conserve and enhance values in existing urban areas is essential. But at least as important are steps to promote economic efficiency and livability in areas of future development. Our national welfare therefore requires the provision of good urban transportation, with the properly balanced use of private vehicles and modern mass transport to help shape as well as serve urban growth." President Lyndon B. Johnson signed the Urban Mass Transportation Act of 1964 into law, which passed the House by a vote of 212–129 and cleared the Senate 52–41, creating the Urban Mass Transportation Administration. The agency was charged with providing federal assistance for mass transit projects, including an initial $375 million in capital assistance over three years as mandated by the act.
Transportation planning
Q1034047 EXACT TITLE 1.000
QID OVERLAP: Q1034047 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (21): "agencies", "assessment", "businesses", "design", "evaluation", "facilities", "government", "highways", "influence", "lines", "movement", "planners", "planning", "policies", "private", "process", "public", "siting", "streets", "system".... | EXACT TITLE in government_civic: "Transportation planning". | EXACT TITLE in land_use_planning: "Transportation planning".
agenciesassessmentbusinessesdesignevaluationfacilitiesgovernmenthighwaysinfluencelinesmovementplannersplanningpoliciesprivateprocesspublicsitingstreetssystemtransportation
s to prepare for future needs to move people and goods to destinations. As practiced today, it is a collaborative process that incorporates the input of many stakeholders including various government agencies, the public and private businesses.
impacts on the transportation system to influence beneficial outcomes. Transportation planning is also commonly referred to as transport planning internationally, and is involved with the evaluation, assessment, design, and siting of transport facilities (generally streets, highways, bike lanes, and public transport lines). Models and sustainability Transportation planning, or transport planning, has historically followed the rational planning model of defining goals and objectives, identifying problems, generating alternatives, evaluating alternatives, and developing plans. Other models for planning include rational actor, transit oriented development, satisficing, incremental planning, organizational process, collaborative planning, and political bargaining. Planners are increasingly expected to adopt a multidisciplinary approach, especially due to the rising importance of environmentalism. For example, the use of behavioural psychology to persuade drivers to abandon their automobiles and use public transport instead. The role of the transport planner is shifting from technical analysis to promoting sustainability through integrated transport policies. For example, in Hanoi, the increasing number of motorcycles is responsible for not only environmental damage but also slowing down economic growth. In the long run, the plan is to reduce traffic through a change in urban planning.
United Kingdom In the United Kingdom, transport planning has traditionally been a branch of civil engineering. In the 1950s and the 1960s, it was generally believed that the motor car was an important element in the future of transport as economic growth spurred on car ownership figures. The role of the transport planner was to match motorway and rural road capacity against the demands of economic growth. Urban areas would need to be redesigned for the motor vehicle or impose traffic containment and demand management to mitigate congestion and environmental impacts. The policies were popularised in a 1963 government publication, Traffic in Towns. The contemporary Smeed Report on congestion pricing was initially promoted to manage demand but was deemed politically unacceptable. In more recent times, the approach has been caricatured as "predict and provide" to predict future transport demand and provide the network for it, usually by building more roads. The publication of Planning Policy Guidance 13 in 1994 (revised in 2001), followed by A New Deal for Transport in 1998 and the white paper Transport Ten Year Plan 2000 again indicated an acceptance that unrestrained growth in road traffic was neither desirable nor feasible.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (19): "addition", "among", "boise", "division", "established", "idaho", "offices", "operates", "park", "production", "professional", "public", "research", "rural", "schools", "statewide", "students", "uidaho", "university". | EXACT TITLE in government_civic: "University of Idaho". | EXACT TITLE in land_use_planning: "University of Idaho".
additionamongboisedivisionestablishedidahoofficesoperatesparkproductionprofessionalpublicresearchruralschoolsstatewidestudentsuidahouniversity
ate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
The Administration Building, with its eighty-foot (24 m) clock tower and Collegiate Gothic-style structure, was built from 1907 to 1909 and has become an icon of the university. The building holds classrooms, an auditorium, and administrative offices, including the offices of the President and Provost. Multiple expansions were made, with the north wing added in 1912, the eastern portion of the south wing in 1916 (extended west in 1936 for the library), and the functional annex in 1950, incorporated into the Albertson addition of 2002. The U of I library was housed in the Administration Building until 1957, when the Library building opened, constructed on the former site of tennis courts. The College of Law occupied the south wing until its building (Menard) opened in 1973. The original Administration Building, with a single tall spire reaching to 163 feet (50 m), was constructed through the decade of the 1890s and ultimately finished in 1899. It burned in 1906. In the meantime, classes were held at various sites in Moscow. The new Administration Building was designed by John E.
Idaho Student Union Building The Idaho Student Union Building (ISUB), completed in 2000 as the Commons, is the heart of campus and contains a food court, copy center, bagel and coffee shop (Einstein's Bagels), credit union, and convenience store.
Groundwater
Q161598 EXACT TITLE 1.000
QID OVERLAP: Q161598 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (42): "agricultural", "agriculture", "become", "capacity", "central", "change", "cities", "contains", "cycle", "effects", "environmental", "formation", "groundwater", "household", "industrial", "influence", "land", "largest", "major", "movement".... | EXACT TITLE in government_civic: "Groundwater". | EXACT TITLE in land_use_planning: "Groundwater".
agriculturalagriculturebecomecapacitycentralchangecitiescontainscycleeffectsenvironmentalformationgroundwaterhouseholdindustrialinfluencelandlargestmajormovementmultiplemunicipaloperatingpercentpipelinesprocessprovidepublicshiftedsource+12
d the water table. Groundwater is recharged from the surface; it may discharge from the surface naturally at springs and seeps, and can form oases or wetlands. Groundwater is also often withdrawn for agricultural, municipal, and industrial use by constructing and operating extraction wells. The study of the distribution and movement of groundwater is hydrogeology, also called groundwater hydrology. Typically, groundwater is thought of as water flowing through shallow aquifers, but, in the technical sense, it can also contain soil moisture, permafrost (frozen soil), immobile water in very low permeability bedrock, and deep geothermal or oil formation water. Groundwater is hypothesized to provide lubrication that can possibly influence the movement of faults. It is likely that much of Earth's subsurface contains some water, which may be mixed with other fluids in some instances. Groundwater is often cheaper, more convenient and less vulnerable to pollution than surface water. Therefore, it is commonly used for public drinking water supplies. For example, groundwater provides the largest source of usable water storage in the United States, and California annually withdraws the largest amount of groundwater of all the states. Underground reservoirs contain far more water than the capacity of all surface reservoirs and lakes in the US, including the Great Lakes. Many municipal water supplies are derived solely from groundwater. Over 2 billion people rely on it as their primary water source worldwide. Human use of groundwater causes environmental problems. For example, polluted groundwater is less visible and more difficult to clean up than pollution in rivers and lakes. Groundwater pollution most often results from improper disposal of wastes on land. Major sources include industrial and household chemicals and garbage landfills, excessive fertilizers and pesticides used in agriculture, industrial waste lagoons, tailings and process wastewater from mines, industrial fracking, oil field brine pits, leaking underground oil storage tanks and pipelines, sewage sludge and septic systems. Additionally, groundwater is susceptible to saltwater intrusion in coastal areas and can cause land subsidence when extracted unsustainably, leading to sinking cities (like Bangkok) and loss in elevation (such as the multiple meters lost in the Central Valley of California). These issues are made more complicated by sea level rise and other effects of climate change, particularly those on the water cycle.
Quantities Groundwater is the most accessed source of freshwater around the world, including as drinking water, irrigation, and manufacturing. Groundwater accounts for about half of the world's drinking water, 40% of its irrigation water, and a third of water for industrial purposes. Another estimate stated that globally groundwater accounts for about one third of all water withdrawals, and surface water for the other two thirds. Groundwater provides drinking water to at least 50% of the global population. About 2.5 billion people depend solely on groundwater resources to satisfy their basic daily water needs. A similar estimate was published in 2021 which stated that "groundwater is estimated to supply between a quarter and a third of the world's annual freshwater withdrawals to meet agricultural, industrial and domestic demands." Global freshwater withdrawal was probably around 600 km3 per year in 1900 and increased to 3,880 km3 per year in 2017. The rate of increase was especially high (around 3% per year) during the period 1950–1980, partly due to a higher population growth rate, and partly to rapidly increasing groundwater development, particularly for irrigation. The rate of increase is (as per 2022) approximately 1% per year, in tune with the current population growth rate. Global groundwater depletion has been calculated to be between 100 and 300 km3 per year. This depletion is mainly caused by "expansion of irrigated agriculture in drylands". The Asia-Pacific region is the largest groundwater abstractor in the world, containing seven out of the ten countries that extract most groundwater (Bangladesh, China, India, Indonesia, Iran, Pakistan and Turkey).
Municipal and industrial water supplies are provided through large wells. Multiple wells for one water supply source are termed "wellfields", which may withdraw water from confined or unconfined aquifers. Using groundwater from deep, confined aquifers provides more protection from surface water contamination. Some wells, termed "collector wells", are specifically designed to induce infiltration of surface (usually river) water. Aquifers that provide sustainable fresh groundwater to urban areas and for agricultural irrigation are typically close to the ground surface (within a couple of hundred metres) and have some recharge by fresh water. This recharge is typically from rivers or meteoric water (precipitation) that percolates into the aquifer through overlying unsaturated materials. In cases where the groundwater has unacceptable levels of salinity or specific ions, desalination is a common treatment,.
Urban renewal
Q920600 EXACT TITLE 1.000
QID OVERLAP: Q920600 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (17): "addressing", "businesses", "cities", "construction", "economic", "government", "growth", "housing", "infrastructure", "land", "private", "process", "projects", "public", "redevelopment", "renewal", "urban". | EXACT TITLE in government_civic: "Urban renewal". | EXACT TITLE in land_use_planning: "Urban renewal".
addressingbusinessescitiesconstructioneconomicgovernmentgrowthhousinginfrastructurelandprivateprocessprojectspublicredevelopmentrenewalurban
Urban renewal, also known as urban regeneration or urban redevelopment, is a set of government or private initiatives aimed at addressing urban decay, upgrading infrastructure, and revitalizing city neighborhoods. Typically, urban renewal involves clearing "blighted" areas, followed by new construction for housing, businesses, and public spaces.
21st century In the late 20th century and now in the 21st century, urban renewal initiatives have often pursued three key goals: economic revitalization, social or cultural regeneration, and environmental sustainability. These efforts frequently aim to transform underutilized urban areas into hubs of economic and cultural activity, leveraging policies that promote both sustainability and equitable development. For example, green infrastructure projects, such as urban parks and community gardens, not only enhance property values but also foster social cohesion and provide environmental benefits like improved water management and biodiversity conservation. In recent years, urban renewal programs have increasingly involved "culturepreneurs," individuals or organizations that blend cultural and economic strategies to reimagine urban spaces. These stakeholders often collaborate with governments and private entities to redevelop vacant land into dynamic public spaces, such as pop-up cultural venues or urban beaches. Culturepreneur initiatives are designed to bridge the gap between the needs of urban residents, local authorities, and property developers, fostering innovative, community-driven solutions. Moreover, urban renewal projects have drawn attention to the nuanced impacts of gentrification. While these efforts can bring economic and infrastructural improvements, they may also displace long-standing communities and erode cultural heritage.
Slum clearances are the strategy of demolishing low-income, poor-quality settlements and using the land for another type of housing. As well as being a tool for urban renewal, they have also been carried out for public health and social reform reasons. Slum clearances and other programmes focused mainly on the demolition of housing in disadvantaged areas have often been criticized as a means of urban renewal for not adequately addressing the social problems that caused the initial problems in the area.
Boise State University
EXACT TITLE 1.000
QID OVERLAP: Q891082 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "arts", "boise", "business", "college", "division", "economics", "education", "engineering", "expenditures", "fiscal", "founded", "health", "idaho", "independent", "master", "member", "program", "programs".... | EXACT TITLE in government_civic: "Boise State University". | EXACT TITLE in land_use_planning: "Boise State University".
activityamongartsboisebusinesscollegedivisioneconomicseducationengineeringexpendituresfiscalfoundedhealthidahoindependentmastermemberprogramprogramspublicreportedresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in government_civic (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (24): "ada", "addition", "airport", "boise", "commercial", "commission", "department", "downtown", "fire", "functions", "general", "idaho", "increase", "international", "national", "operated", "operates", "protection", "receive", "rights".... | EXACT TITLE in land_use_planning: "Boise Airport".
adaadditionairportboisecommercialcommissiondepartmentdowntownfirefunctionsgeneralidahoincreaseinternationalnationaloperatedoperatesprotectionreceiverightssupportuseswesternwildfire
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (29): "academic", "ada", "board", "boise", "canyon", "college", "community", "counties", "cwi", "development", "education", "elected", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported".... | EXACT TITLE in government_civic: "College of Western Idaho". | EXACT TITLE in land_use_planning: "College of Western Idaho".
academicadaboardboisecanyoncollegecommunitycountiescwidevelopmenteducationelectedgovernedidaholargenampapopulationprogramspublicreportedresidentssouthweststudentstechnicaltransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "idaho", "land", "local", "metropolitan", "resources", "river", "rural", "southwestern", "treasure", "valley", "western". | EXACT TITLE in government_civic: "Treasure Valley". | EXACT TITLE in land_use_planning: "Treasure Valley".
agriculturalassociationboiseidaholandlocalmetropolitanresourcesriverruralsouthwesterntreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Wastewater
Q336191 EXACT TITLE 0.960
QID OVERLAP: Q336191 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (13): "activities", "agricultural", "another", "commercial", "community", "definition", "industrial", "municipal", "processes", "produced", "sewer", "wastewater", "water". | EXACT TITLE in government_civic: "Wastewater". | EXACT TITLE in land_use_planning: "Wastewater".
activitiesagriculturalanothercommercialcommunitydefinitionindustrialmunicipalprocessesproducedsewerwastewaterwater
w water, or saline water in a variety of deliberate applications or processes. Another definition of wastewater is "Used water from any combination of domestic, industrial, commercial or agricultural activities, surface runoff / storm water, and any sewer infiltration or sewer inflow".
Domestic wastewater, which encompasses sewage produced by communities and is commonly subdivided into greywater and blackwater. Industrial wastewater: waterborne waste generated from a variety of industrial processes, such as manufacturing operations, mineral extraction, power generation, or water and wastewater treatment. Cooling water, is released with potential thermal pollution after use to condense steam or reduce machinery temperatures by conduction or evaporation. Leachate: precipitation containing pollutants dissolved while percolating through ores, raw materials, products, or solid waste. Return flow: the flow of water carrying suspended soil, pesticide residues, or dissolved minerals and nutrients from irrigated cropland. Surface runoff: the flow of water occurring on the ground surface when excess rainwater, stormwater, meltwater, or other sources, can no longer sufficiently rapidly infiltrate the soil. Urban runoff, including water used for outdoor cleaning activity and landscape irrigation in densely populated areas created by urbanization. Agricultural wastewater: animal husbandry wastewater generated from confined animal operations. Treatment Wastewater treatment refers to processes used to remove contaminants from wastewater. The treated effluent is typically discharged to a receiving water body with the aim of limiting adverse environmental impacts. Sewage is usually treated at sewage treatment plants. Industrial wastewater may be treated at facilities designed for industrial processes or, in some cases, at municipal sewage treatment plants. When the latter occurs, industries generally perform on-site pretreatment before discharge to the municipal system. Other specialized treatment plants exist for agricultural wastewater and leachate. Treatment processes commonly include phase separation, biological and chemical transformation steps, and polishing to improve effluent quality. Sludge is the principal by-product generated during treatment and is further processed at the same facility or at separate sludge treatment plants.
Wastewater treatment refers to processes used to remove contaminants from wastewater. The treated effluent is typically discharged to a receiving water body with the aim of limiting adverse environmental impacts. Sewage is usually treated at sewage treatment plants. Industrial wastewater may be treated at facilities designed for industrial processes or, in some cases, at municipal sewage treatment plants. When the latter occurs, industries generally perform on-site pretreatment before discharge to the municipal system. Other specialized treatment plants exist for agricultural wastewater and leachate. Treatment processes commonly include phase separation, biological and chemical transformation steps, and polishing to improve effluent quality. Sludge is the principal by-product generated during treatment and is further processed at the same facility or at separate sludge treatment plants.
Idaho Transportation Department
Q4925016 EXACT TITLE 0.920
QID OVERLAP: Q4925016 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (11): "agency", "department", "federal", "funding", "idaho", "infrastructure", "operations", "organization", "planning", "programs", "transportation". | EXACT TITLE in government_civic: "Idaho Transportation Department". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
agencydepartmentfederalfundingidahoinfrastructureoperationsorganizationplanningprogramstransportation
governmental organization responsible for state transportation infrastructure. This includes ongoing operations and maintenance as well as planning for future needs of the state and its citizens.
Overview Idaho's state transportation system consists of more than 12,200 miles (19,600 km) (lane miles) of roads, more than 1,800 bridges, approximately 1,630 miles (2,620 km) of rail lines, 126 public-use airports, and the Port of Lewiston. The agency is also responsible for 29 rest areas and 12 ports of entry. History The Idaho Legislature created the State Highway Commission 113 years ago in 1913. The group consisted of the Secretary of State, the State Engineer and three other members to be appointed by the governor.
plan, build and maintain new state highways alter, improve or discontinue any state highway purchase, condemn, or otherwise obtain necessary easements have general supervision of all highways within the state expend the fund created for the construction, maintenance and improvement of state highways maintain and improve state highways make and enforce rules employ a Chief Engineer and assistants supervise registration of vehicles keep a complete record of all activities and expenses In 1919, the Commission was abolished and its functions were transferred to a Bureau of Highways in the Department of Public Works. A property tax was enacted by the Legislature to fund roads for the state and bonds were issued to build a highway system. In 1950, the Idaho Department of Highways was reorganized and placed under the direction of a governing Board. In 1974, the Idaho Department of Highways became the Idaho Transportation Department. The Department of Motor Vehicles originally reported to the Idaho Department of Law Enforcement, but was transferred to ITD in 1982. Organization ITD is organized into five divisions and six district offices. The agency serves under an appointed seven member Idaho Transportation Board. The board establishes state transportation policy and guides the planning, development and management of the Idaho transportation network. The board is appointed by the governor. One board member represents each of the six regional districts.
Idaho Legislature
Q4256974 EXACT TITLE 0.920
QID OVERLAP: Q4256974 in government_civic (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (11): "boise", "data", "district", "districts", "even", "government", "idaho", "legislature", "population", "residents", "single". | EXACT TITLE in government_civic: "Idaho Legislature".
boisedatadistrictdistrictsevengovernmentidaholegislaturepopulationresidentssingle
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
W
Q7973730 EXACT TITLE 0.920
QID OVERLAP: Q7973730 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (11): "conflict", "different", "groundwater", "irrigation", "law", "legal", "physical", "river", "source", "systems", "water". | EXACT TITLE in government_civic: "Water right". | EXACT TITLE in land_use_planning: "Water right".
conflictdifferentgroundwaterirrigationlawlegalphysicalriversourcesystemswater
ith plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
Community-based allocation of water In some jurisdictions, appropriative water rights can be granted directly to communities. Here, water is reserved to provide sufficient capacity for the future growth of that particular community. For example, California provides communities and other water users within watersheds senior status over appropriative (use-based) water rights solely because they are located where the water originates and naturally flows. A second example of community-based water rights is pueblo water rights. As recognized by California, pueblo water rights are grants to individual settlements (i.e. pueblos) over all streams and rivers flowing through the city and to all groundwater aquifers underlying that particular city. The pueblo's claim expands with the needs of the city and may be used to supply the needs of areas that are later annexed to the city. While California recognizes pueblo water rights, pueblo water rights are controversial.
Boise River
Q891080 EXACT TITLE 0.900
QID OVERLAP: Q891080 in government_civic (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (10): "agricultural", "boise", "drains", "idaho", "river", "southwestern", "square", "urban", "watershed", "western". | EXACT TITLE in land_use_planning: "Boise River".
agriculturalboisedrainsidahoriversouthwesternsquareurbanwatershedwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Meridian, Idaho
Q1085274 QID OVERLAP 0.830
QID OVERLAP: Q1085274 in government_civic (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population". | URL->A (1): https://meridiancity.org/.
adaamongboisecapitalcitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Hearing (law)
Q545861 EXACT TITLE 0.820
QID OVERLAP: Q545861 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (6): "agency", "civil", "formal", "government", "hearing", "law". | EXACT TITLE in government_civic: "Hearing (law)". | EXACT TITLE in land_use_planning: "Hearing (law)".
agencycivilformalgovernmenthearinglaw
In law, a hearing is the formal examination of a case (civil or criminal) before a judge. It is a proceeding before a court or other decision-making body or officer, such as a government agency or a legislative committee. Description A hearing is generally distinguished from a trial in that it is usually shorter and often less formal. During the course of litigation, oral arguments are presented in support of motions at hearings. The purpose of these arguments may be to resolve the case without further trial, such as through a motion to dismiss or for summary judgment, or to decide discrete issues of law, such as the admissibility of evidence, which will determine how the trial proceeds.
Congressional hearing Unofficial hearing Preliminary hearings are used to determine whether there is sufficient evidence to require a trial. In a preliminary hearing, a judge listens to arguments and evidence from both sides before deciding whether the case should proceed to trial. Motion hearings are held when a party asks the court to take a specific action in the case. For example, a party may request that certain evidence be excluded from trial or that a case be dismissed before trial. In a motion hearing, each side presents arguments and evidence to the judge, who then makes a decision based on the law and facts presented. Evidentiary hearings are used to resolve disputes related to evidence in a case. During an evidentiary hearing, parties present arguments and evidence related to the admissibility of certain evidence or the validity of expert testimony. The judge then makes a ruling on whether the evidence in question can be presented at trial. Depositions are another type of hearing commonly used in the US legal system. Depositions involve sworn testimony from a witness or party in a case, taken outside of court and recorded by a court reporter. Depositions are often used to gather information before trial or to impeach the credibility of a witness at trial. In the mid-20th century, as a result of what has been called the "due process revolution," a series of Supreme Court decisions expanded the rights of individuals in legal proceedings and required more formal procedures and protections. One key decision during this period was Goldberg v. Kelly (1970), which involved a challenge to the system for terminating welfare benefits in New York. The Court held that the Due Process Clause of the Fourteenth Amendment requires that individuals have the opportunity to be heard and present evidence before their benefits are terminated. The decision in Goldberg helped to establish the principle that many administrative decisions require some form of hearing or other procedure to ensure that individuals are not deprived of their rights without due process of law. It also illustrated that what constitutes a hearing can depend on the context. In Goldberg, the goal of a speedy decision was held to "justify the limitation of the pre-termination hearing to minimum procedural safeguards", which included such basic matters as the right to appear and to cross-examine witnesses, but did not include "a complete record and a comprehensive opinion".
Description A hearing is generally distinguished from a trial in that it is usually shorter and often less formal. During the course of litigation, oral arguments are presented in support of motions at hearings. The purpose of these arguments may be to resolve the case without further trial, such as through a motion to dismiss or for summary judgment, or to decide discrete issues of law, such as the admissibility of evidence, which will determine how the trial proceeds.
A
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (39): "activities", "activity", "administration", "administrative", "agencies", "another", "bodies", "built", "civil", "control", "coordinate", "courts", "created", "decisions", "division", "economic", "education", "enforcement", "environmental", "governing"....
activitiesactivityadministrationadministrativeagenciesanotherbodiesbuiltcivilcontrolcoordinatecourtscreateddecisionsdivisioneconomiceducationenforcementenvironmentalgoverninggovernmentincreaseinfluenceinternationalitselfjudiciallawlegalmodelpolitical+9
Administrative law is a division of law governing the activities of executive branch agencies of government. Administrative law includes executive branch rulemaking (executive branch rules are generally referred to as "regulations"), adjudication, and the enforcement of laws.
Scope of administrative law German legal scholarship does not have an agreed-upon definition for public administration. In one sense, administration – more precisely, everything that is subject to administrative law – is conceptualized as being all state activity of a certain type (material definition of public administration). This approach leads to disputes about whether to treat acts of public authority as acts of administration (and therefore executive) even when they are performed by component parts of the state (that is to say, the government) that the law formally classifies as a legislative or a judicial body: For instance, the parliament may impose a fine on one of its members for misbehavior, or a presiding judge may direct a disruptive member of the public to be removed from the viewing gallery. The opposite approach – the formalist definition of public administration – begins its examination by considering all those public authorities intended (judging by their lawful charter, organizational context, internal structure, and performed tasks) to do the work of public administration, and equates their functioning with public administration. There is some danger of circular reasoning, since the formal categorization of the organizational unit may, in turn, derive from some material conception of its function. Some functions that might, in the material view, be seen as not of the executive type, and thus not as belonging to the field of administration (such as the creation of rules with the force of law, which are usually thought of as legislative), would then be held to the standards of administrative law, and not another field of law. This discussion is of seen as being of particular importance when considering the role of administrative law in maintaining the division of government powers. For this purpose, a traditional approach tries negatively to define administration by subtracting those operations of the state which cannot be called administration, namely law-making and adjudication. Using this negative definition, though, requires law-making and adjudication to be defined first, and leaves some activities that are a poor fit for the term "administration", such as the cabinet government's political leadership decisions, within the bounds of the definition. Positive definitions abound, but none has won out over the others, or been entirely convincing to scholars of German administrative law. Nevertheless, certain features may be seen as being characteristic of administration: According to Maurer and Waldhoff, administration is social engineering (exerting influence on the non-state, societal domain) (1), oriented towards some conception of the (ever-changing) public interest (2), that consists of taking action in the present, with a view to engineering the future (3), and that comprises concrete measures to regulate individual cases and to realize particular plans (4). Scholarly treatises of German administrative law are almost always split into two parts: doctrines and rules that can be found across-the-board (allgemeines Verwaltungsrecht); and doctrines and rules that exist only in certain parts of administrative law (German: besonderes Verwaltungsrecht, lit. 'special administrative law') – e.g.
Judicial application The law governing the adjudication of questions of administrative law before the courts of general administrative jurisdiction (German: Verwaltungsgerichte) is the Code on Administrative Courts (German: Verwaltungsgerichtsordnung, abbreviated VwGO), which was enacted in 1960. Though the VwGO was not conceived as a full codification of court process for the courts of general administrative jurisdiction, and VwGO § 173 directs these courts to apply Germany's Code of Civil Procedure wherever the VwGO lacks special rules, proceedings before the courts of general administrative jurisdiction are mostly distinct from civil proceedings before the courts of general jurisdiction. The VwGO also does not apply to the courts of special administrative jurisdiction over tax disputes (German: Finanzgerichte) or over social benefits disputes (German: Sozialgerichte). Italy In Italy, administrative law is known as Diritto amministrativo, a branch of public law whose rules govern the organization of the public administration and the activities of the pursuit of the public interest of the public administration and the relationship between this and the citizens. Its genesis is related to the principle of division of powers of the State.
I
Q6073798 QID OVERLAP 0.800
QID OVERLAP: Q6073798 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (21): "authority", "boundaries", "corporation", "created", "district", "districts", "entity", "geographic", "government", "irrigation", "landowners", "large", "legislature", "local", "power", "projects", "public", "statute", "subdivision", "tax"....
authorityboundariescorporationcreateddistrictdistrictsentitygeographicgovernmentirrigationlandownerslargelegislaturelocalpowerprojectspublicstatutesubdivisiontaxwater
division of the State government, with definite geographic boundaries, organized, and having taxing power to obtain and distribute water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn.
r irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district
igation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district References External links Federal lands included in state irrigation districts "The Nevada Irrigation District Act"
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in government_civic (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (16): "ada", "boise", "capital", "district", "highway", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "population", "private", "roads", "southwestern", "streets".
adaboisecapitaldistricthighwayhomeidahojurisdictionlargestlocalmetropolitanpopulationprivateroadssouthwesternstreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (18): "ada", "annual", "boise", "capital", "counties", "downtown", "employers", "home", "idaho", "locally", "major", "metropolitan", "population", "river", "southwestern", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownemployershomeidaholocallymajormetropolitanpopulationriversouthwesterntechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Public utility
Q1951366 QID OVERLAP 0.800
QID OVERLAP: Q1951366 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (35): "access", "cannot", "commission", "control", "costs", "different", "entity", "federal", "forms", "government", "infrastructure", "large", "lines", "local", "maintains", "market", "multiple", "occur", "operates", "organization"....
accesscannotcommissioncontrolcostsdifferententityfederalformsgovernmentinfrastructurelargelineslocalmaintainsmarketmultipleoccuroperatesorganizationpipelinesproductionpublicregulationrepresentscalestatewidesupplysystemstelephone+5
or completely) sourced from clean and renewable energy in order to produce sustainable electricity. Of these, wind turbines and solar panels are those used most frequently. Whether broadband internet access should be a public utility is a question that was being discussed with the rise of internet usage. This is a question that was being asked due to the telephone service being considered a public utility. Since arguably broadband internet access has taken over telephone service, perhaps it should be a public utility. The Federal Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear.
ion that was being discussed with the rise of internet usage. This is a question that was being asked due to the telephone service being considered a public utility. Since arguably broadband internet access has taken over telephone service, perhaps it should be a public utility. The Federal Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear.
Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear. Due to the telephone service having been considered a public utility, the FCC made broadband internet access a public utility in the United States. Management Public utilities have historically been considered to be a natural monopoly. This school of thought holds that the most cost-efficient way of doing business is through a single firm because these are capital-intensive businesses with unusually large economies of scale and high fixed costs associated with building and operating the infrastructure, e.g. power plants, telephone lines and water treatment facilities. However, over the past several decades, traditional public utilities' monopoly position has eroded. For instance, wholesale electricity generation markets, electric transmission networks, electricity retailing and customer choice, telecommunications, some types of public transit and postal services have become competitive in some countries and the trend towards liberalization, deregulation and privatization of public utilities is growing.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (34): "agency", "associated", "become", "building", "cities", "commercial", "costs", "development", "dynamics", "environmental", "geographic", "growth", "housing", "industrial", "infrastructure", "land", "large", "planning", "population", "private"....
agencyassociatedbecomebuildingcitiescommercialcostsdevelopmentdynamicsenvironmentalgeographicgrowthhousingindustrialinfrastructurelandlargeplanningpopulationprivatepropertyprotectionrapidrequireresidentialrevenueroadsspecialsupporttax+4
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Another prominent form of retail development in areas characterized by sprawl is the shopping mall. Unlike the strip mall, this is usually composed of a single building surrounded by a parking lot that contains multiple shops, usually "anchored" by one or more department stores. The function and size is also distinct from the strip mall. The focus is almost exclusively on recreational shopping rather than daily goods. Shopping malls also tend to serve a wider (regional) public and require higher-order infrastructure such as highway access and can have floorspaces in excess of 1 million sq ft (93,000 m2). Shopping malls are often detrimental to downtown shopping centres of nearby cities since the shopping malls act as a surrogate for the city centre. Some downtowns have responded to this challenge by building shopping centres of their own. Fast food chains are often built early in areas with low property values where the population is expected to boom and where large traffic is predicted, and set a precedent for future development. Eric Schlosser, in his book Fast Food Nation, argues that fast food chains accelerate suburban sprawl and help set its tone with their expansive parking lots, flashy signs, and plastic architecture (65). Duany Plater Zyberk & Company believe that this reinforces a destructive pattern of growth in an endless quest to move away from the sprawl that only results in creating more of it. Effects Environmental One of the major environmental problems associated with urban sprawl is land consumption, habitat loss, land pollution, subsequent reduction in biodiversity and destruction of local ecosystems. A review by Brian Czech and colleagues, finds that urbanization endangers more species and is more geographically ubiquitous in the mainland United States than any other human activity. Urban sprawl is disruptive to native flora & fauna and introduces invasive plants into their environments, which are considered to be harmful to local biomes. Although the effects can be mitigated through careful maintenance of native vegetation, the process of ecological succession and public education, sprawl represents one of the primary threats to biodiversity. Regions with high birth rates and immigration are therefore faced with environmental problems due to unplanned urban growth and emerging megacities such as Kolkata, Shenzen, and Chongqing. Unregulated urban sprawl in these areas contributes to severe pollution, resource depletion, and ecosystem degradation. For instance, Kolkata's expansion has led to extensive deforestation and wetland destruction, endangering biodiversity and increasing flood risks. Additionally, Chongqing, as one of China's fastest-growing urban centers. struggles with severe air pollution due to its reliance on coal-powered industries, with particulate matter (PM2.5) levels often exceeding World Health Organization safety limits. The rapid expansion of urban infrastructure in such megacities increases greenhouse gas emissions, with transportation and construction sectors contributing significantly to climate change.
F
Q329497 QID OVERLAP 0.800
QID OVERLAP: Q329497 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (27): "access", "act", "bodies", "constitutional", "cost", "data", "decision", "development", "establish", "exist", "general", "government", "information", "institutions", "legal", "making", "means", "policy", "practice", "private"....
accessactbodiesconstitutionalcostdatadecisiondevelopmentestablishexistgeneralgovernmentinformationinstitutionslegalmakingmeanspolicypracticeprivateprotectionpublicrequestsresponserightssupportthem
Freedom of information laws are designed to grant the general public access to data held by government bodies and, where applicable, entities on the private sector. The emergence of freedom of information legislation is a response to increasing dissatisfaction with the lack of transparency on matters such as government policy development and decision making. In recent years the term "Access to Information Act" has also been used. Freedom of Information laws establish "right-to-know" legal provisions whereby requests for information of public interest, often (but not exclusively) government-related, must be obliged and provided at little or no cost, subject to certain exceptions. A broader sense of the duty to publish and promote openness is already stated in most constitutions. However, constitutional provisions may not, in practice, suffice to effect the right to access information if specific support legislation does not exist. Additionally, the United Nations' Sustainable Development Goal 16 is to establish that public access to information is entitled the protection of fundamental freedoms, as a means to ensure accountable, inclusive and just institutions. Over 100 countries around the world have implemented some form of freedom of information legislation. Sweden's Freedom of the Press Act of 1766 is the oldest in the world. Historically, freedom of information laws were. Aside from Sweden, no other state had them until after the UN’s 1948 Universal Declaration of Human Rights. Freedom of information laws increased substantially from the 1990s onwards.
xceptions. A broader sense of the duty to publish and promote openness is already stated in most constitutions. However, constitutional provisions may not, in practice, suffice to effect the right to access information if specific support legislation does not exist. Additionally, the United Nations' Sustainable Development Goal 16 is to establish that public access to information is entitled the protection of fundamental freedoms, as a means to ensure accountable, inclusive and just institutions. Over 100 countries around the world have implemented some form of freedom of information legislation. Sweden's Freedom of the Press Act of 1766 is the oldest in the world. Historically, freedom of information laws were. Aside from Sweden, no other state had them until after the UN’s 1948 Universal Declaration of Human Rights. Freedom of information laws increased substantially from the 1990s onwards.
actice, suffice to effect the right to access information if specific support legislation does not exist. Additionally, the United Nations' Sustainable Development Goal 16 is to establish that public access to information is entitled the protection of fundamental freedoms, as a means to ensure accountable, inclusive and just institutions. Over 100 countries around the world have implemented some form of freedom of information legislation. Sweden's Freedom of the Press Act of 1766 is the oldest in the world. Historically, freedom of information laws were. Aside from Sweden, no other state had them until after the UN’s 1948 Universal Declaration of Human Rights. Freedom of information laws increased substantially from the 1990s onwards.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (35): "agency", "assessment", "began", "conservation", "department", "education", "enforcement", "engineers", "environmental", "equivalent", "establishing", "federal", "federally", "financial", "government", "governments", "hearings", "independent", "information", "legal"....
agencyassessmentbeganconservationdepartmenteducationenforcementengineersenvironmentalequivalentestablishingfederalfederallyfinancialgovernmentgovernmentshearingsindependentinformationlegallocalmeasuresnationalofficespermittingpowersprogramsproposedprotectionpublic+5
The Environmental Protection Agency (EPA) is an independent agency of the United States government tasked with environmental protection matters. President Richard Nixon proposed the establishment of EPA on July 9, 1970; it began operation on December 2, 1970, after Nixon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
r is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
or is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
United States Department of Housing and Urban Development
Q811595 QID OVERLAP 0.800
QID OVERLAP: Q811595 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (17): "administers", "agency", "department", "departments", "development", "directly", "federal", "financing", "founded", "government", "home", "housing", "member", "policies", "program", "reports", "urban".
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfinancingfoundedgovernmenthomehousingmemberpoliciesprogramreportsurban
The United States Department of Housing and Urban Development (HUD) is one of the executive departments of the U.S. federal government. It administers federal housing and urban development laws. It is headed by the secretary of housing and urban development, who reports directly to the president of the United States and is a member of the president's Cabinet. Although its beginnings were in the House and Home Financing Agency, it was founded as a Cabinet department in 1965, as part of the "Great Society" program of President Lyndon B.
Community Planning and Development: Many major affordable housing and homelessness programs are administered under Community Planning and Development.
y of housing and urban development, who reports directly to the president of the United States and is a member of the president's Cabinet. Although its beginnings were in the House and Home Financing Agency, it was founded as a Cabinet department in 1965, as part of the "Great Society" program of President Lyndon B. Johnson, to develop and execute policies on housing and metropolises. History The idea of a department of Urban Affairs was proposed in a 1957 report to President Dwight D. Eisenhower, led by New York governor Nelson A. Rockefeller. The idea of a department of Housing and Urban Affairs was taken up by President John F. Kennedy, with Pennsylvania Senator and Kennedy ally Joseph S. Clark Jr. listing it as one of the top seven legislative priorities for the administration in internal documents. The department was established on September 9, 1965, when President Lyndon B. Johnson signed the Department of Housing and Urban Development Act into law. It stipulated that the department was to be created no later than November 8, sixty days following the date of enactment. The actual implementation was postponed until January 14, 1966, following the completion of a special study group report on the federal role in solving urban problems. HUD is administered by the U.S. secretary of housing and urban development. Its headquarters was located in the Robert C. Weaver Federal Building from 1968 to 2025, when HUD announced that it would move to Alexandria, Virginia.
Complete streets
Q5156515 QID OVERLAP 0.800
QID OVERLAP: Q5156515 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (23): "access", "community", "design", "economic", "engineers", "environmental", "health", "highway", "home", "living", "maintained", "operated", "planned", "planners", "policy", "public", "related", "requires", "safety", "streets"....
accesscommunitydesigneconomicengineersenvironmentalhealthhighwayhomelivingmaintainedoperatedplannedplannerspolicypublicrelatedrequiressafetystreetstraffictransportationurban
Complete streets is a transportation policy and design approach that requires streets to be planned, designed, operated and maintained to enable safe, convenient and comfortable travel and access for users of all ages and abilities regardless of their mode of transportation. Complete Streets allow for safe travel by those walking, cycling, driving automobiles, riding public transportation, or delivering goods. The term is often used by transportation advocates, urban planners, traffic and highway engineers, public health practitioners, and community members in the United States and Canada. Complete Streets are promoted as offering improved safety, health, economic, and environmental outcomes.
ity members in the United States and Canada. Complete Streets are promoted as offering improved safety, health, economic, and environmental outcomes. Complete Streets emphasize the importance of safe access for all users, not just automobiles. Related concepts include living streets, Woonerf, and home zones. History After World War II, many communities in the United States were designed to facilitate easy and fast access to destinations via automobile. In rural and suburban communities, people often rely on the automobile as their sole means of transportation and even in areas with public transportation and safe places to walk and bicycle, they live in a state of automobile dependence wherein automobiles are the central focus of transportation, infrastructure and land use policies to the extent that other modes of transportation, such as walking, cycling and mass transit, have become impractical. Oregon enacted the first Complete Streets-like policy in the United States in 1971, requiring that new or rebuilt roads accommodate bicycles and pedestrians, and also calling on state and local governments to fund pedestrian and bicycle facilities in the public right-of-way. Since then, 16 additional state legislatures have adopted Complete Streets laws. In 2003, Barbara McCann, who would later become the Executive Director of the National Complete Streets Coalition, coordinated a search for a replacement for the term "routine accommodation." The term "complete streets" was suggested by David Goldberg, the communications director for Smart Growth America, and it was adopted by a coalition of advocacy groups to refer both to a comprehensive approach to street design and to the coalition itself. The National Complete Streets Coalition was founded in 2005 by a coalition of advocacy and trade groups, including AARP, the American Planning Association and the American Society of Landscape Architects. The American Public Transportation Association, Blue Cross Blue Shield Minnesota, the National Association of Realtors, and the Institute of Transportation Engineers are examples of other current Coalition Steering Committee members. Federal complete streets legislation was proposed in 2008 and 2009, but failed to become law. In 2010, the U.S. Department of Transportation issued a policy statement on bicycle and pedestrian accommodation, declaring its support for their inclusion in federal-aid transportation projects and encouraging community organizations, public transportation agencies, and state and local governments to adopt similar policies. By early 2013, more than 490 jurisdictions in United States had adopted a Complete Streets policy, including twenty-seven states, the District of Columbia, and the Commonwealth of Puerto Rico. Some of these jurisdictions passed legislation enacting their policies into law, while others chose to implemented their policies by executive order or internal policy. Still more jurisdictions have passed non-binding resolutions in support of Complete Streets, or created transportation plans that incorporate Complete Streets principles. A federal Complete Streets Act has been introduced in the U.S.
not just automobiles. Related concepts include living streets, Woonerf, and home zones. History After World War II, many communities in the United States were designed to facilitate easy and fast access to destinations via automobile. In rural and suburban communities, people often rely on the automobile as their sole means of transportation and even in areas with public transportation and safe places to walk and bicycle, they live in a state of automobile dependence wherein automobiles are the central focus of transportation, infrastructure and land use policies to the extent that other modes of transportation, such as walking, cycling and mass transit, have become impractical. Oregon enacted the first Complete Streets-like policy in the United States in 1971, requiring that new or rebuilt roads accommodate bicycles and pedestrians, and also calling on state and local governments to fund pedestrian and bicycle facilities in the public right-of-way. Since then, 16 additional state legislatures have adopted Complete Streets laws. In 2003, Barbara McCann, who would later become the Executive Director of the National Complete Streets Coalition, coordinated a search for a replacement for the term "routine accommodation." The term "complete streets" was suggested by David Goldberg, the communications director for Smart Growth America, and it was adopted by a coalition of advocacy groups to refer both to a comprehensive approach to street design and to the coalition itself. The National Complete Streets Coalition was founded in 2005 by a coalition of advocacy and trade groups, including AARP, the American Planning Association and the American Society of Landscape Architects. The American Public Transportation Association, Blue Cross Blue Shield Minnesota, the National Association of Realtors, and the Institute of Transportation Engineers are examples of other current Coalition Steering Committee members. Federal complete streets legislation was proposed in 2008 and 2009, but failed to become law. In 2010, the U.S. Department of Transportation issued a policy statement on bicycle and pedestrian accommodation, declaring its support for their inclusion in federal-aid transportation projects and encouraging community organizations, public transportation agencies, and state and local governments to adopt similar policies. By early 2013, more than 490 jurisdictions in United States had adopted a Complete Streets policy, including twenty-seven states, the District of Columbia, and the Commonwealth of Puerto Rico. Some of these jurisdictions passed legislation enacting their policies into law, while others chose to implemented their policies by executive order or internal policy. Still more jurisdictions have passed non-binding resolutions in support of Complete Streets, or created transportation plans that incorporate Complete Streets principles. A federal Complete Streets Act has been introduced in the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "interstate", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
boisecanyoncollegehomeidahointerstatemeaningmeridianmetropolitannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Idaho Supreme Court
Q5987471 EXACT TITLE 0.780
QID OVERLAP: Q5987471 in government_civic (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (4): "building", "courts", "decisions", "idaho". | EXACT TITLE in government_civic: "Idaho Supreme Court".
buildingcourtsdecisionsidaho
he Idaho Supreme Court are binding on all other Idaho state courts. The only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
Video coverage The Idaho Supreme Court first permitted live video and audio coverage from its chambers in late 1978. See also Courts of Idaho References External links Idaho State Judiciary Idaho Architecture Project.org - Idaho Supreme Court building American Courthouses – Idaho Supreme Court building
Star, Idaho
Q1516815 QID OVERLAP 0.740
QID OVERLAP: Q1516815 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (12): "ada", "boise", "canyon", "district", "growing", "idaho", "metropolitan", "neighboring", "population", "school", "schools", "star".
adaboisecanyondistrictgrowingidahometropolitanneighboringpopulationschoolschoolsstar
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.740
QID OVERLAP: Q843258 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (12): "boise", "cities", "downtown", "highway", "home", "idaho", "interstate", "major", "metropolitan", "river", "routes", "serves".
boisecitiesdowntownhighwayhomeidahointerstatemajormetropolitanriverroutesserves
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
P
Q7245403 QID OVERLAP 0.720
QID OVERLAP: Q7245403 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (11): "agricultural", "household", "industrial", "legal", "merely", "ownership", "remaining", "rights", "source", "system", "water".
agriculturalhouseholdindustriallegalmerelyownershipremainingrightssourcesystemwater
In the American legal system, prior appropriation water rights is the doctrine that the first person to take a quantity of water from a water source for "beneficial use" (agricultural, industrial or household) has the right to continue to use that quantity of water for that purpose. Subsequent users can take the remaining water for their own use if they do not impinge on the rights of previous users.
Nature of the right The legal details of prior appropriation vary from state to state. Under the prior appropriation system, the right is initially allotted to those who are "first in time of use"; these rights of withdrawal can then trade on the open market, like other property. For water sources with many users, a government or quasi-government agency is usually charged with overseeing allocations. Allocations involving water sources that cross state borders or international borders can be quite contentious, and are generally governed by federal court rulings, interstate agreements and international treaties. A claim of prior appropriation must prove four sub-claims: diversion (that the water had been withdrawn), priority (that the withdrawer had diverted water prior to the other claimant), intent (that the water had been withdrawn by design), and beneficial use (that the water was put to a publicly-acceptable end). If proved, the initial person to use a quantity of water from a water source for a beneficial use has the right to continue to use the same quantity of water for the same purpose. Subsequent users can use the remaining water for their own beneficial purposes provided that they do not impinge on the rights of previous users; this is the priority element of the doctrine. But neither can a senior user change the manner (i.e., location) in which they appropriate water to the detriment of a junior user. These Preservation of Conditions were granted to the second user after Farmers Highline Canal & Reservoir Co. v. City of Golden, 272 P.2d 629 (Colo. 1954). A senior water user could, for example, only have been using the water during a particular season. Then the purchaser of the water right could only use the water in the same season as when the right was established. In addition, the state may put additional conditions on the use of the water right to prevent polluting or inefficient uses of water. Beneficial use is commonly defined as agricultural, industrial or household use. The doctrine has historically excluded ecological purposes, such as maintaining a natural body of water and the wildlife that depends on it, but some jurisdictions now accept such claims. The extent to which private parties may own such rights varies among the states. Each water right has a yearly quantity and an appropriation date. Each year, the user with the earliest appropriation date (known as the "senior appropriator") may use up to their full allocation (provided the water source can supply it). Then the user with the next earliest appropriation date may use their full allocation and so on. In cases of water shortages, prior-appropriation does not require a senior user to utilize less water than usual. Therefore, during times of drought, users with junior appropriation dates might not receive their full allocation or even any water at all. When a water right is sold, it retains its original appropriation date. Only the amount of water historically consumed can be transferred if a water right is sold. For example, if alfalfa is grown using flood irrigation, the amount of the return flow may not be transferred, only the amount that would be necessary to irrigate the amount of alfalfa historically grown. Prior appropriation rights are subject to certain adverse possession-type rules to reduce speculation. Withdrawal rights can be lost or shrunk over time if unused for a certain number of years, or if a litigant can demonstrate that the water's use is not beneficial.
Criticism Each drop of rain falling through the sky has already been allocated to a user. Leave the hose running between rinses while you wash your car and you won't run afoul of the law; but if you gather a pailful of rainwater and pour on your tomato plant, look over your shoulder for a water cop. You will be preventing those raindrops from entering the watershed, depriving people downstream from the surrounding creeks and rivers of their rights to use their apportioned amounts of streamflow. The doctrine of prior appropriation comes crashing up against the imperative to conserve scarce water. Colorado made it legal for some homeowners to harvest rain and snow from their roofs. Tucson is encouraging its citizens to gather rainwater. Santa Fe made catchment devices mandatory for new dwellings. But, in Utah and Washington (with the exception of Seattle), harvesting raindrops is still a crime. Even though water markets increasingly gain ground, many criticize the prior appropriation system for failing to adequately adjust to society's evolving values and needs. Environmentalists and recreational river-users demand more water be left in rivers and streams, but courts have been slow to accept these requests as beneficial uses. Conversely, the tool of beneficial use is too tied to custom to encourage users to conserve. An appropriator who uses water inefficiently retains the right to the full allotment, but an appropriator who uses only a portion risks losing the right to the rest, and water right markets remain too illiquid to purchase any excess. As a result, the vast majority of water in the West still is allocated to agricultural uses despite cries for additional water from growing cities. High demand can cause an over-appropriation of the waters, in which there are more water rights for a particular stream than water actually available. This leads to an apparent inefficiency: if a water source is over-appropriated, the latest users will almost never see water from their claims.
Garden City, Idaho
Q1516892 QID OVERLAP 0.680
QID OVERLAP: Q1516892 in government_civic (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "population", "separate".
adaboisegardengovernmentidahometropolitanmunicipalpopulationseparate
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Kuna, Idaho
QID OVERLAP 0.660
QID OVERLAP: Q1515177 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
boisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in government_civic (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "population".
adaboisedowntowneagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
174 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP174 edges
🌿 BRANCH142 edges
0.500
Road ↗ Q34442 EXACT TITLE
accessanothercycledesignhighwayslandlocalmovementprivatepublicroadroadssidewalksstreetstraffictypesurbanwhose
SHARED TOKENS (18): "access", "another", "cycle", "design", "highways", "land", "local", "movement", "private", "public", "road", "roads", "sidewalks", "streets", "traffic", "types", "urban", "whose". | EXACT TITLE in government_civic: "Road". | EXACT TITLE in land_use_planning: "Road".
0.500
Cartography ↗ Q42515 EXACT TITLE
boundariesdesigngeographicgisinformationlandmakingmapsmediamodeledphysicalpoliticalpracticalpracticerepresentroadsstudysystems
SHARED TOKENS (18): "boundaries", "design", "geographic", "gis", "information", "land", "making", "maps", "media", "modeled", "physical", "political", "practical", "practice", "represent", "roads", "study", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.500
activitiesactivityagenciesattachedcommunitydevelopeddevelopmentsdynamicseconomicestimatesevenformalgeographicgrowinggrowthincorporatedinformationland-usemetropolitanmodel
SHARED TOKENS (39): "activities", "activity", "agencies", "attached", "community", "developed", "developments", "dynamics", "economic", "estimates", "even", "formal", "geographic", "growing", "growth", "incorporated", "information", "land-use", "metropolitan", "model".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
academicanalysisanotherattachedbusinesscoordinatesdatadefinitionengineeringfoundationgeographicgeographygisinformationinstitutionalinsuranceintegratedknowledgemanagementmultiple
SHARED TOKENS (36): "academic", "analysis", "another", "attached", "business", "coordinates", "data", "definition", "engineering", "foundation", "geographic", "geography", "gis", "information", "institutional", "insurance", "integrated", "knowledge", "management", "multiple".... | EXACT TITLE in government_civic: "Geographic information system". | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
academicactionsaddressadministrationadministrativeanalysisbusinessescommunitycontemporarycontexteconomiceffectiveexperiencefoundedfunctionsgovernmentinstitutionsmanagementnonprofitorganization
SHARED TOKENS (38): "academic", "actions", "address", "administration", "administrative", "analysis", "businesses", "community", "contemporary", "context", "economic", "effective", "experience", "founded", "functions", "government", "institutions", "management", "nonprofit", "organization".... | EXACT TITLE in government_civic: "Public administration".
0.500
authorityboundariescontainsdepartmentdepartmentsdistrictexistfireoperatesorganizationorganizationspersonnelprivateprofessionalpublicspecial
SHARED TOKENS (16): "authority", "boundaries", "contains", "department", "departments", "district", "exist", "fire", "operates", "organization", "organizations", "personnel", "private", "professional", "public", "special". | EXACT TITLE in government_civic: "Fire department".
0.500
activitiesactivityadvocacyconservationcreatedenvironmentalgovernmentsgrowthimpactmeasuresmultiplepopulationpracticeprotectionresourcestechnology
SHARED TOKENS (16): "activities", "activity", "advocacy", "conservation", "created", "environmental", "governments", "growth", "impact", "measures", "multiple", "population", "practice", "protection", "resources", "technology". | EXACT TITLE in land_use_planning: "Environmental protection".
0.500
authoritybodiescommissioncommissionsdecisionsdevelopmenteconomicfinancialgovernmentjurisdictionland-uselocalplanningplanspolicypubliczoning
SHARED TOKENS (17): "authority", "bodies", "commission", "commissions", "decisions", "development", "economic", "financial", "government", "jurisdiction", "land-use", "local", "planning", "plans", "policy", "public", "zoning". | EXACT TITLE in government_civic: "Planning Commission". | EXACT TITLE in land_use_planning: "Planning Commission".
0.500
accessagencieschangecommunityconditionscontemporarycreateddevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentalfacilitiesfirmsfocusedfunction
SHARED TOKENS (48): "access", "agencies", "change", "community", "conditions", "contemporary", "created", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environmental", "facilities", "firms", "focused", "function".... | EXACT TITLE in government_civic: "Infrastructure". | EXACT TITLE in land_use_planning: "Infrastructure".
0.500
administrativebureaudistrictdistrictsexistfiscalfunctionfunctionsgovernmentsindependentlocalmunicipalrelatedschoolseparatelysinglespecialsubstantial
SHARED TOKENS (18): "administrative", "bureau", "district", "districts", "exist", "fiscal", "function", "functions", "governments", "independent", "local", "municipal", "related", "school", "separately", "single", "special", "substantial". | EXACT TITLE in government_civic: "Special district (United States)".
0.500
actappliedassessmentassociationauthoritycentralchangecitiescommunityconditionsconflictsconservationcostscreatingdefinitiondependdependsdesigndevelopmentdistricts
SHARED TOKENS (49): "act", "applied", "assessment", "association", "authority", "central", "change", "cities", "community", "conditions", "conflicts", "conservation", "costs", "creating", "definition", "depend", "depends", "design", "development", "districts".... | EXACT TITLE in land_use_planning: "Land-use planning".
0.500
accessaddressaddressingamongbusinessescapacitycitiescommunitydevelopersdevelopmentdevelopseconomiceducationemployersformalformsfoundedgovernmenthistoryhome
SHARED TOKENS (44): "access", "address", "addressing", "among", "businesses", "capacity", "cities", "community", "developers", "development", "develops", "economic", "education", "employers", "formal", "forms", "founded", "government", "history", "home".... | EXACT TITLE in government_civic: "Workforce development". | EXACT TITLE in land_use_planning: "Workforce development".
0.500
activitiesagenciesagriculturalassessmentconversiondevelopmentdifferentdistrictseasementseducationestablishingfarmlandgovernmentgovernmentsgrowinghistoriclandlocalnationaloperated
SHARED TOKENS (34): "activities", "agencies", "agricultural", "assessment", "conversion", "development", "different", "districts", "easements", "education", "establishing", "farmland", "government", "governments", "growing", "historic", "land", "local", "national", "operated".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
Rulemaking ↗ Q2479254 EXACT TITLE
administrativeagenciescreatecreatedenvironmentalgeneralgovernmentgrowthindependentlawmandatesmeanspolicyprocessprogramsprotectionrulemakingsafetystatutestypes
SHARED TOKENS (20): "administrative", "agencies", "create", "created", "environmental", "general", "government", "growth", "independent", "law", "mandates", "means", "policy", "process", "programs", "protection", "rulemaking", "safety", "statutes", "types". | EXACT TITLE in government_civic: "Rulemaking". | EXACT TITLE in land_use_planning: "Rulemaking".
0.500
analysisappliedcurrentdatadesigndifferentengineeringformalformsgeographiclargeplacementresearchrestrictedscalestructuresstudiesstudyurban
SHARED TOKENS (19): "analysis", "applied", "current", "data", "design", "different", "engineering", "formal", "forms", "geographic", "large", "placement", "research", "restricted", "scale", "structures", "studies", "study", "urban". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.500
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmenteconomicfeefeesgovernmentgrowthimpactimprovementsjurisdictionslocalpopulationprojectproposedpublic
SHARED TOKENS (17): "capital", "construction", "costs", "development", "economic", "fee", "fees", "government", "growth", "impact", "improvements", "jurisdictions", "local", "population", "project", "proposed", "public". | EXACT TITLE in government_civic: "Impact fee". | EXACT TITLE in land_use_planning: "Impact fee".
0.500
assetscanalscapitalcategorycommunityconstructedconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthealthinfrastructuremunicipaloperatorparksphysical
SHARED TOKENS (34): "assets", "canals", "capital", "category", "community", "constructed", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "health", "infrastructure", "municipal", "operator", "parks", "physical".... | EXACT TITLE in government_civic: "Public works". | EXACT TITLE in land_use_planning: "Public works".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
administrationagenciesagencycoordinatesdevelopeddevelopmentdistributedenvironmentalfederalfoundationfundedgrantshighwaylandmetropolitanmodelingnationalopenorgplanning
SHARED TOKENS (32): "administration", "agencies", "agency", "coordinates", "developed", "development", "distributed", "environmental", "federal", "foundation", "funded", "grants", "highway", "land", "metropolitan", "modeling", "national", "open", "org", "planning".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
Wetland ↗ Q170321 EXACT TITLE
actadditionamongassessmentbuildingchangeconservationcontroldifferentdistinctenvironmentalexistfloodfunctionfunctionsgroundwaterhealthidentifyinfrastructureinternational
SHARED TOKENS (38): "act", "addition", "among", "assessment", "building", "change", "conservation", "control", "different", "distinct", "environmental", "exist", "flood", "function", "functions", "groundwater", "health", "identify", "infrastructure", "international".... | EXACT TITLE in government_civic: "Wetland". | EXACT TITLE in land_use_planning: "Wetland".
0.500
actionsadministrativeauthoritycourtsdecisiongovernmentjudicialjurisdictionspowerpowersprocedureprocessreviewseparationstatute
SHARED TOKENS (15): "actions", "administrative", "authority", "courts", "decision", "government", "judicial", "jurisdictions", "power", "powers", "procedure", "process", "review", "separation", "statute". | EXACT TITLE in government_civic: "Judicial review". | EXACT TITLE in land_use_planning: "Judicial review".
0.500
accessactchangedepartmentseligibleevenevidenceexistformsgoverninginformationjurisdictionslawlicensenationalofficesplacespopulationprocessproduction
SHARED TOKENS (29): "access", "act", "change", "departments", "eligible", "even", "evidence", "exist", "forms", "governing", "information", "jurisdictions", "law", "license", "national", "offices", "places", "population", "process", "production".... | EXACT TITLE in government_civic: "Voter registration".
0.500
associatedbeyondconnectionsdatadescriptionsdevelopmentdevelopmentsgraphknowledgelinkedmodelobjectsopenprojectsrelationshipsrepresentrepresentationresearchsystemsuses
SHARED TOKENS (20): "associated", "beyond", "connections", "data", "descriptions", "development", "developments", "graph", "knowledge", "linked", "model", "objects", "open", "projects", "relationships", "represent", "representation", "research", "systems", "uses". | EXACT TITLE in government_civic: "Knowledge graph". | EXACT TITLE in land_use_planning: "Knowledge graph".
0.500
actagenciesagencyagriculturalagricultureassessmentassistanceconservationdepartmenteffectsimprovementinvestmentlandownerslocalprivateprogramsprojectprotectqualityresources
SHARED TOKENS (24): "act", "agencies", "agency", "agricultural", "agriculture", "assessment", "assistance", "conservation", "department", "effects", "improvement", "investment", "landowners", "local", "private", "programs", "project", "protect", "quality", "resources".... | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
administrativeagencyappliedbuildingcommercialconnectionsconstructiondesigndevelopmentfunctionsinstitutionalintegratedmultipleneighborhoodpedestrianplanningpolicyprivateprojectsresidential
SHARED TOKENS (25): "administrative", "agency", "applied", "building", "commercial", "connections", "construction", "design", "development", "functions", "institutional", "integrated", "multiple", "neighborhood", "pedestrian", "planning", "policy", "private", "projects", "residential".... | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
actattorneyboisecivilclaimsdistrictfederalgovernmentidahojurisdictionlitigationnationalofficeparkwhose
SHARED TOKENS (15): "act", "attorney", "boise", "civil", "claims", "district", "federal", "government", "idaho", "jurisdiction", "litigation", "national", "office", "park", "whose". | EXACT TITLE in government_civic: "United States District Court for the District of Idaho".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilconstructiondefinitiondevelopmentengineeringestablishformsgeometrygisgovernmenthistorylandlawlegalmappingmapsownershipplanning
SHARED TOKENS (30): "analysis", "boundaries", "civil", "construction", "definition", "development", "engineering", "establish", "forms", "geometry", "gis", "government", "history", "land", "law", "legal", "mapping", "maps", "ownership", "planning".... | EXACT TITLE in land_use_planning: "Surveying".
0.500
accessibilityactivitiesadministrationadoptedanalysisanotherarchitecturebuiltbusinesscapitalcategorycitiescivilcodescommunitycreatingdesigndevelopmentdifferenteconomic
SHARED TOKENS (66): "accessibility", "activities", "administration", "adopted", "analysis", "another", "architecture", "built", "business", "capital", "category", "cities", "civil", "codes", "community", "creating", "design", "development", "different", "economic".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
Bridge ↗ Q12280 EXACT TITLE
builtcommunityconnectingconnectionconstructedconstructioncreatedesigneffectsengineeringengineersformsfoundationindustrialintendedlocalmajornetworkphysicalprocesses
SHARED TOKENS (33): "built", "community", "connecting", "connection", "constructed", "construction", "create", "design", "effects", "engineering", "engineers", "forms", "foundation", "industrial", "intended", "local", "major", "network", "physical", "processes".... | EXACT TITLE in government_civic: "Bridge".
0.500
actaddressaddressingadministeredagencyassistancecodifiedconservationcontroldirectlyengineersenvironmentalfederalfundinggoverninggovernmentsgroundwaterimprovementlawmajor
SHARED TOKENS (29): "act", "address", "addressing", "administered", "agency", "assistance", "codified", "conservation", "control", "directly", "engineers", "environmental", "federal", "funding", "governing", "governments", "groundwater", "improvement", "law", "major".... | EXACT TITLE in land_use_planning: "Clean Water Act".
0.500
actadministeredadministrationagencyassistanceclaimscommunityconstructioncontrolcostcostscreatedcreatingdevelopmenteffectiveemergencyenforcementfederalfloodfloodplain
SHARED TOKENS (39): "act", "administered", "administration", "agency", "assistance", "claims", "community", "construction", "control", "cost", "costs", "created", "creating", "development", "effective", "emergency", "enforcement", "federal", "flood", "floodplain".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
additionaffordabilityaffordableassociateddemandeconomicemergencyexistformalformsgovernmenthomehouseholdhouseholdshousingincreasesinformallocalnationalownership
SHARED TOKENS (22): "addition", "affordability", "affordable", "associated", "demand", "economic", "emergency", "exist", "formal", "forms", "government", "home", "household", "households", "housing", "increases", "informal", "local", "national", "ownership".... | EXACT TITLE in government_civic: "Affordable housing". | EXACT TITLE in land_use_planning: "Affordable housing".
0.500
Plat ↗ Q831939 EXACT TITLE
anotherbecomeboardcommissiondepartmentdescriptionsgeneralgoverninginformationlandlegallegallylocalofficeplanningplatsportionspublicratherreview
SHARED TOKENS (30): "another", "become", "board", "commission", "department", "descriptions", "general", "governing", "information", "land", "legal", "legally", "local", "office", "planning", "plats", "portions", "public", "rather", "review".... | EXACT TITLE in government_civic: "Plat". | EXACT TITLE in land_use_planning: "Plat".
0.500
Irrigation ↗ Q11453 EXACT TITLE
additionagriculturalagricultureappliescentralcollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddrainageeffectsenvironmentalgroundwatergrowthimprovementsirrigation
SHARED TOKENS (42): "addition", "agricultural", "agriculture", "applies", "central", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "drainage", "effects", "environmental", "groundwater", "growth", "improvements", "irrigation".... | EXACT TITLE in government_civic: "Irrigation". | EXACT TITLE in land_use_planning: "Irrigation".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisarchitectsarrangementboundariesbuildingcodesconditionsconstructioncontractorcountiescreatingdesigndevelopmentdrainageengineersfacilitiesgardenhistoricalimprovementsinfrastructure
SHARED TOKENS (48): "analysis", "architects", "arrangement", "boundaries", "building", "codes", "conditions", "construction", "contractor", "counties", "creating", "design", "development", "drainage", "engineers", "facilities", "garden", "historical", "improvements", "infrastructure".... | EXACT TITLE in land_use_planning: "Site plan".
0.500
agenciesbuiltcanalscivilconstructiondepartmentsdesigndistinguishengineeringfirmsfocusedgovernmentinfrastructurelocallymunicipalnationalphysicalpipelinesprivateprofessional
SHARED TOKENS (24): "agencies", "built", "canals", "civil", "construction", "departments", "design", "distinguish", "engineering", "firms", "focused", "government", "infrastructure", "locally", "municipal", "national", "physical", "pipelines", "private", "professional".... | EXACT TITLE in government_civic: "Civil engineering". | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
academicallocationamongcentraldecisiondirecteconomiceconomicseconomyeffectsfinanceframeworkgovernmentgovernmentsmarketpolicypoliticalpublicresearchresources
SHARED TOKENS (23): "academic", "allocation", "among", "central", "decision", "direct", "economic", "economics", "economy", "effects", "finance", "framework", "government", "governments", "market", "policy", "political", "public", "research", "resources".... | EXACT TITLE in government_civic: "Public finance". | EXACT TITLE in land_use_planning: "Public finance".
0.500
administrativeauthoritybecomeboardbodiesbuildingcodecommissioncommissionersconsolidatedcontrolcouncilcountiescourtsdistinctelectedenforcementestablishevenfiscal
SHARED TOKENS (34): "administrative", "authority", "become", "board", "bodies", "building", "code", "commission", "commissioners", "consolidated", "control", "council", "counties", "courts", "distinct", "elected", "enforcement", "establish", "even", "fiscal".... | EXACT TITLE in government_civic: "County commission".
0.500
actadditionadministrationadministrativeassetsauthorityboardbodiescentralcitiescommunitycontrolcouncilcountiesdefinesdefinitiondefinitionsdifferentdistrictselected
SHARED TOKENS (63): "act", "addition", "administration", "administrative", "assets", "authority", "board", "bodies", "central", "cities", "community", "control", "council", "counties", "defines", "definition", "definitions", "different", "districts", "elected".... | EXACT TITLE in government_civic: "Local government". | EXACT TITLE in land_use_planning: "Local government".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingdeterminedevelopeddevelopmentdifferentdiffersgoverngovernmentgovernmentsgrowthindustriallandland-uselocalplacesplanningpolicyprocedureproperty
SHARED TOKENS (30): "activities", "building", "determine", "developed", "development", "different", "differs", "govern", "government", "governments", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "procedure", "property".... | EXACT TITLE in government_civic: "Zoning". | EXACT TITLE in land_use_planning: "Zoning".
0.500
additionbuiltbusinessescentralcitiesconcentrationdemographicdevelopmenteconomicenvironmentalformationformsgrowinggrowthhistorichouseholdsinformalmodelmovementplanned
SHARED TOKENS (27): "addition", "built", "businesses", "central", "cities", "concentration", "demographic", "development", "economic", "environmental", "formation", "forms", "growing", "growth", "historic", "households", "informal", "model", "movement", "planned".... | EXACT TITLE in government_civic: "Suburbanization".
0.500
accessactcontinuingcreatedexpendituresfederalfederallyformationfundedfundinggovernedgovernmenthighwaylawlocalmetropolitanorganizationoutsideparticipationplanning
SHARED TOKENS (32): "access", "act", "continuing", "created", "expenditures", "federal", "federally", "formation", "funded", "funding", "governed", "government", "highway", "law", "local", "metropolitan", "organization", "outside", "participation", "planning".... | EXACT TITLE in government_civic: "Metropolitan planning organization".
0.500
activitiesaddressadministrativecitiesdevelopmenteconomicenvironmentalfarmlandgrowthindustrialinfrastructurelandland-usemanagementnationalnetworkplacementplanningplansprotection
SHARED TOKENS (31): "activities", "address", "administrative", "cities", "development", "economic", "environmental", "farmland", "growth", "industrial", "infrastructure", "land", "land-use", "management", "national", "network", "placement", "planning", "plans", "protection".... | EXACT TITLE in government_civic: "Regional planning". | EXACT TITLE in land_use_planning: "Regional planning".
0.500
activityanalysisanotherassociatedbuildingcentralcitiescontroldesigndevelopmentdifferentenvironmentalformationformsfunctionsgeographyhistoricmapsmaterialmeans
SHARED TOKENS (37): "activity", "analysis", "another", "associated", "building", "central", "cities", "control", "design", "development", "different", "environmental", "formation", "forms", "functions", "geography", "historic", "maps", "material", "means".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
agenciesarchitectsarchitectureconditionsconstructioncontroldesignengineeringenvironmentalestategeneralinfrastructurejurisdictionslicensemanagementmasterparksplanningprivateprocesses
SHARED TOKENS (29): "agencies", "architects", "architecture", "conditions", "construction", "control", "design", "engineering", "environmental", "estate", "general", "infrastructure", "jurisdictions", "license", "management", "master", "parks", "planning", "private", "processes".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
boundariescertificationformallicensemasteroutsideplacementpotentialpracticeprofessionalregulatedstudysystemtradetraining
SHARED TOKENS (15): "boundaries", "certification", "formal", "license", "master", "outside", "placement", "potential", "practice", "professional", "regulated", "study", "system", "trade", "training". | EXACT TITLE in government_civic: "Apprenticeship".
0.500
activitiesauthoritycapacityconductconflictsconstitutionalenforcementexercisefederalgeneralgovernmentgovernmentshealthinterstatejurisdictionlawlegalmeansmeasuresneed
SHARED TOKENS (32): "activities", "authority", "capacity", "conduct", "conflicts", "constitutional", "enforcement", "exercise", "federal", "general", "government", "governments", "health", "interstate", "jurisdiction", "law", "legal", "means", "measures", "need".... | EXACT TITLE in government_civic: "Police power (United States constitutional law)".
0.500
actionsactivityaddressaddressingchangeciviccommunitygovernmentparticipationpoliticalprocessprotectpublicqualitytogether
SHARED TOKENS (15): "actions", "activity", "address", "addressing", "change", "civic", "community", "government", "participation", "political", "process", "protect", "public", "quality", "together". | EXACT TITLE in government_civic: "Civic engagement".
0.500
assessedauthorityestategoverninggovernmentimprovementsjurisdictionjurisdictionslandmultiplenationalperformspropertyrealrequiressystemtaxtransactiontransfervalue
SHARED TOKENS (21): "assessed", "authority", "estate", "governing", "government", "improvements", "jurisdiction", "jurisdictions", "land", "multiple", "national", "performs", "property", "real", "requires", "system", "tax", "transaction", "transfer", "value".... | EXACT TITLE in government_civic: "Property tax".
0.500
Urban design ↗ Q63100 EXACT TITLE
additionarchitecturecitiescommunityconnectdesigneconomicenvironmentalhistoricalimpactlocalpagephysicalplanningprocessesprojectpublicregionalrelatedsurrounding
SHARED TOKENS (23): "addition", "architecture", "cities", "community", "connect", "design", "economic", "environmental", "historical", "impact", "local", "page", "physical", "planning", "processes", "project", "public", "regional", "related", "surrounding".... | EXACT TITLE in land_use_planning: "Urban design".
0.500
actamongarticleauthorityboundariescommissionscreateddecisionsdistrictdistrictselectedestablishfederalindependentjudiciallegislaturepoliticalpopulationprocessrequired
SHARED TOKENS (23): "act", "among", "article", "authority", "boundaries", "commissions", "created", "decisions", "district", "districts", "elected", "establish", "federal", "independent", "judicial", "legislature", "political", "population", "process", "required".... | EXACT TITLE in government_civic: "Redistricting".
0.500
accessassociationcostsdefinitiondevelopmenteconomicestatefinancialformsfundedfundinggeneralgeographicgovernmenthistoricalinfrastructureintegratedintendedinternationalinvestment
SHARED TOKENS (46): "access", "association", "costs", "definition", "development", "economic", "estate", "financial", "forms", "funded", "funding", "general", "geographic", "government", "historical", "infrastructure", "integrated", "intended", "international", "investment".... | EXACT TITLE in government_civic: "Public transport". | EXACT TITLE in land_use_planning: "Public transport".
0.500
federalfederallyfundingimprovementlong-rangemetropolitanorganizationsplanplanningplansprogramprojectsregionalrequirementseektransportation
SHARED TOKENS (16): "federal", "federally", "funding", "improvement", "long-range", "metropolitan", "organizations", "plan", "planning", "plans", "program", "projects", "regional", "requirement", "seek", "transportation". | EXACT TITLE in government_civic: "Transportation improvement program".
0.500
agenciesattorneyconsumercreatedelectedenforcementgeneralidaholawlegallocalofficeownershippropertyprotectionproviderepresentation
SHARED TOKENS (17): "agencies", "attorney", "consumer", "created", "elected", "enforcement", "general", "idaho", "law", "legal", "local", "office", "ownership", "property", "protection", "provide", "representation". | EXACT TITLE in government_civic: "Idaho Attorney General".
0.500
Annexation ↗ EXACT TITLE
acquisitionactactionsannexationanotherbodiescontrolcurrentdescribesdescribingdistinctinternationallawlegalmeansphysicalpoliticalterritorytitle
SHARED TOKENS (19): "acquisition", "act", "actions", "annexation", "another", "bodies", "control", "current", "describes", "describing", "distinct", "international", "law", "legal", "means", "physical", "political", "territory", "title". | EXACT TITLE in government_civic: "Annexation". | EXACT TITLE in land_use_planning: "Annexation".
0.500
actactionsagenciesagencyauthoritycouncilcourtscreateddecisionsdefinitioneffectsenvironmentalestablishedevaluatefederalfinalgovernmentimpactlawmodeled
SHARED TOKENS (32): "act", "actions", "agencies", "agency", "authority", "council", "courts", "created", "decisions", "definition", "effects", "environmental", "established", "evaluate", "federal", "final", "government", "impact", "law", "modeled".... | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
0.500
adoptedappliedarchitectsauthoritybecomesbeganbodiesbuildingcodecodescomplianceconstructioncontrolcouncildepartmentsdesigndevelopersdistricteffectselectrical
SHARED TOKENS (50): "adopted", "applied", "architects", "authority", "becomes", "began", "bodies", "building", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "developers", "district", "effects", "electrical".... | EXACT TITLE in government_civic: "Building code". | EXACT TITLE in land_use_planning: "Building code".
0.500
affectsagencyauthoritybusinessesconstructioncontractsdirecteconomiceconomygivinggovernmentgovernmentsgrowthinternationallocalnonprofitorganizationorganizationsprivateprocess
SHARED TOKENS (32): "affects", "agency", "authority", "businesses", "construction", "contracts", "direct", "economic", "economy", "giving", "government", "governments", "growth", "international", "local", "nonprofit", "organization", "organizations", "private", "process".... | EXACT TITLE in government_civic: "Government procurement".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcanalcanalscontrolcreatecurrentdrainagefloodincreaseirrigationmanagementpressureresourcesriverseriessourcesourcessupplyvalley
SHARED TOKENS (21): "building", "built", "canal", "canals", "control", "create", "current", "drainage", "flood", "increase", "irrigation", "management", "pressure", "resources", "river", "series", "source", "sources", "supply", "valley".... | EXACT TITLE in government_civic: "Canal". | EXACT TITLE in land_use_planning: "Canal".
0.500
activitiesagriculturalagricultureannualapprovalcollectioncommissioncontextcontrolleddefinitionsdevelopmentevenfarmlandformsirrigationlandmeansorganizationproductionrequire
SHARED TOKENS (23): "activities", "agricultural", "agriculture", "annual", "approval", "collection", "commission", "context", "controlled", "definitions", "development", "even", "farmland", "forms", "irrigation", "land", "means", "organization", "production", "require".... | EXACT TITLE in government_civic: "Agricultural land". | EXACT TITLE in land_use_planning: "Agricultural land".
0.500
Light rail ↗ Q1268865 EXACT TITLE
capacityconditionsdefinitionsdifferentequivalentexistmeaningmodesmultipleoperatesoperatingoperationsrapidstreetssystemsystemstechnologytogethertraffictransit
SHARED TOKENS (22): "capacity", "conditions", "definitions", "different", "equivalent", "exist", "meaning", "modes", "multiple", "operates", "operating", "operations", "rapid", "streets", "system", "systems", "technology", "together", "traffic", "transit".... | EXACT TITLE in land_use_planning: "Light rail".
0.500
academicacademicsactionsactivitiesaddressadministrationagenciesanalysiscategoriescivilcreatedcycledatadecisiondecisionsdesigndevelopeddirecteconomiceconomics
SHARED TOKENS (56): "academic", "academics", "actions", "activities", "address", "administration", "agencies", "analysis", "categories", "civil", "created", "cycle", "data", "decision", "decisions", "design", "developed", "direct", "economic", "economics".... | EXACT TITLE in government_civic: "Public policy".
0.500
activitiescommunitycurrentdevelopmentdocumentestablishingfoundationgeneralgrowthhousinglandlargemasterneighborhoodparcelplanplannersplanningplanspolicies
SHARED TOKENS (30): "activities", "community", "current", "development", "document", "establishing", "foundation", "general", "growth", "housing", "land", "large", "master", "neighborhood", "parcel", "plan", "planners", "planning", "plans", "policies".... | EXACT TITLE in land_use_planning: "Comprehensive planning".
0.480
actadministrationagencyassistancecommissioncreatedgovernmentindependentinformationnationalrequirementsresourceservessystem
SHARED TOKENS (14): "act", "administration", "agency", "assistance", "commission", "created", "government", "independent", "information", "national", "requirements", "resource", "serves", "system". | EXACT TITLE in government_civic: "Election Assistance Commission".
0.480
commercialdevelopersdevelopmenthousingindependentlyindustriallandlargeparksretailsinglesmallersubdivisionsubdivisions
SHARED TOKENS (14): "commercial", "developers", "development", "housing", "independently", "industrial", "land", "large", "parks", "retail", "single", "smaller", "subdivision", "subdivisions". | EXACT TITLE in government_civic: "Subdivision (land)". | EXACT TITLE in land_use_planning: "Subdivision (land)".
0.480
amongcommissioncommissionsdistrictdivisionlegalmeanspublicregulatedregulationregulatoryservesutilitiesutility
SHARED TOKENS (14): "among", "commission", "commissions", "district", "division", "legal", "means", "public", "regulated", "regulation", "regulatory", "serves", "utilities", "utility". | EXACT TITLE in government_civic: "Public utilities commission".
0.460
agenciescoordinatescouncildevelopmentdivisionenvironmentalfederalofficeofficespoliciespolicyqualityworks
SHARED TOKENS (13): "agencies", "coordinates", "council", "development", "division", "environmental", "federal", "office", "offices", "policies", "policy", "quality", "works". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.460
boiseconsumercreateddatademandfoundedidaholatestmajormarketproducedtechnologytogether
SHARED TOKENS (13): "boise", "consumer", "created", "data", "demand", "founded", "idaho", "latest", "major", "market", "produced", "technology", "together". | EXACT TITLE in land_use_planning: "Micron Technology".
0.460
Easement ↗ Q448405 EXACT TITLE
accessamonganothereasementsitselfjurisdictionslandlawpropertypublicrealrightsroad
SHARED TOKENS (13): "access", "among", "another", "easements", "itself", "jurisdictions", "land", "law", "property", "public", "real", "rights", "road". | EXACT TITLE in government_civic: "Easement". | EXACT TITLE in land_use_planning: "Easement".
0.460
assistancecannotestablishedfederalgovernmentgovernmentslegalofficeprovidepublicrepresentrepresentationrequires
SHARED TOKENS (13): "assistance", "cannot", "established", "federal", "government", "governments", "legal", "office", "provide", "public", "represent", "representation", "requires". | EXACT TITLE in government_civic: "Public defender".
0.440
administeredadministrationaffectdetermineeffectiveinstitutionaljurisdictionjurisdictionsprocessqualityrulesshape
SHARED TOKENS (12): "administered", "administration", "affect", "determine", "effective", "institutional", "jurisdiction", "jurisdictions", "process", "quality", "rules", "shape". | EXACT TITLE in government_civic: "Election administration".
0.440
Floodplain ↗ Q193110 EXACT TITLE
agriculturalcontroldevelopedexperiencefloodfloodplainlandriskriverurbanvalleywater
SHARED TOKENS (12): "agricultural", "control", "developed", "experience", "flood", "floodplain", "land", "risk", "river", "urban", "valley", "water". | EXACT TITLE in government_civic: "Floodplain". | EXACT TITLE in land_use_planning: "Floodplain".
0.440
administrativeappliesboardbuildingcodedevelopmentlandmunicipalordinancerulesstandardszoning
SHARED TOKENS (12): "administrative", "applies", "board", "building", "code", "development", "land", "municipal", "ordinance", "rules", "standards", "zoning". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.420
constitutionalfederalgovernmentslawprivateprocesspropertyprovideregulatoryrightsvalue
SHARED TOKENS (11): "constitutional", "federal", "governments", "law", "private", "process", "property", "provide", "regulatory", "rights", "value". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.380
Drainage ↗ Q7481320 EXACT TITLE
agriculturalconditionsdrainagegrowthlandneedproductionsupplieswater
SHARED TOKENS (9): "agricultural", "conditions", "drainage", "growth", "land", "need", "production", "supplies", "water". | EXACT TITLE in government_civic: "Drainage". | EXACT TITLE in land_use_planning: "Drainage".
0.380
containscycledirectlydistrictmemberoccurrelatedremainsriver
SHARED TOKENS (9): "contains", "cycle", "directly", "district", "member", "occur", "related", "remains", "river". | EXACT TITLE in government_civic: "West Nile virus".
0.360
finalmanagementofficialproceduresprocessprotectqualityreview
SHARED TOKENS (8): "final", "management", "official", "procedures", "process", "protect", "quality", "review". | EXACT TITLE in government_civic: "Election audit".
0.360
Mitigation ↗ Q6881760 EXACT TITLE
actionseffectsemergencylawmanagementmeasuresremainrisk
SHARED TOKENS (8): "actions", "effects", "emergency", "law", "management", "measures", "remain", "risk". | EXACT TITLE in government_civic: "Mitigation".
0.340
citiescorporationcountiesgoverninglegallocalmunicipal
SHARED TOKENS (7): "cities", "corporation", "counties", "governing", "legal", "local", "municipal". | EXACT TITLE in government_civic: "Municipal corporation".
0.320
districtlandordinancepermituseszoning
SHARED TOKENS (6): "district", "land", "ordinance", "permit", "uses", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.320
Sheriff ↗ Q578478 EXACT TITLE
developedgovernmenthistoricalindependentlyofficeofficial
SHARED TOKENS (6): "developed", "government", "historical", "independently", "office", "official". | EXACT TITLE in government_civic: "Sheriff".
0.310
constitutionalcurrentelectedgovernmentidahoofficeofficersposition
SHARED TOKENS (8): "constitutional", "current", "elected", "government", "idaho", "office", "officers", "position". | URL->A (1): https://sos.idaho.gov/.
0.300
actadministeramongassociationauthoritybureauconstructioncontractscreateddepartmentestablishedfederalfundedirrigationlandlawmajormeridiannationalorganization
SHARED TOKENS (34): "act", "administer", "among", "association", "authority", "bureau", "construction", "contracts", "created", "department", "established", "federal", "funded", "irrigation", "land", "law", "major", "meridian", "national", "organization"....
0.300
adaboisecanyoncitiescountieshomeidaholargestmeridianmetropolitannampapercentpopulationsouthwesterntreasurevalley
SHARED TOKENS (16): "ada", "boise", "canyon", "cities", "counties", "home", "idaho", "largest", "meridian", "metropolitan", "nampa", "percent", "population", "southwestern", "treasure", "valley".
0.300
additionagencybureaubusinessbusinessescommunitycurrentdatadecisionsdepartmentdepartmentseconomiceconomyfederalfiregovernmentinformationinfrastructurelocalmaking
SHARED TOKENS (32): "addition", "agency", "bureau", "business", "businesses", "community", "current", "data", "decisions", "department", "departments", "economic", "economy", "federal", "fire", "government", "information", "infrastructure", "local", "making"....
0.300
actadministeredagenciesauthoritycodeconservationdependdevelopmentdifferentdirectseconomicfederalgrowthinternationallawmeansnationalprotectrequiresrules
SHARED TOKENS (23): "act", "administered", "agencies", "authority", "code", "conservation", "depend", "development", "different", "directs", "economic", "federal", "growth", "international", "law", "means", "national", "protect", "requires", "rules"....
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmenteconomyemploymentfinancinggovernmentgovernmentsjurisdictionslawlocalnationalpermitpermitsplan
SHARED TOKENS (28): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "economy", "employment", "financing", "government", "governments", "jurisdictions", "law", "local", "national", "permit", "permits", "plan"....
0.300
informationmappingprocesssurveytypes
SHARED TOKENS (5): "information", "mapping", "process", "survey", "types". | EXACT TITLE in land_use_planning: "Soil survey".
0.300
actionsanotherarrangementbecomebeganchainconsolidationcorporationdifferentdirectlyeconomyfinalintegratedinternationallargemakingmanagementmarketmeasuresmember
SHARED TOKENS (34): "actions", "another", "arrangement", "become", "began", "chain", "consolidation", "corporation", "different", "directly", "economy", "final", "integrated", "international", "large", "making", "management", "market", "measures", "member"....
0.300
actadministrationagencycommissioncommissionerscreateddescribesfederalfinancefunctionfundinggovernmentindependentinformationlawpublicstatute
SHARED TOKENS (17): "act", "administration", "agency", "commission", "commissioners", "created", "describes", "federal", "finance", "function", "funding", "government", "independent", "information", "law", "public", "statute".
0.300
actualagriculturalcommunityconservationcontrolledcreatedevelopmentdistrictsenvironmentalgrowthhistoricinterestslandmanagementopenoverlaysplanningpreserveprivateresources
SHARED TOKENS (24): "actual", "agricultural", "community", "conservation", "controlled", "create", "development", "districts", "environmental", "growth", "historic", "interests", "land", "management", "open", "overlays", "planning", "preserve", "private", "resources"....
0.300
affordabilityaffordableamonganotherbuiltcitiescodeconstructedcontrolcontrolscostcreatedevelopersdevelopmenteffectsfeesfinancialfunctionshouseholdshousing
SHARED TOKENS (46): "affordability", "affordable", "among", "another", "built", "cities", "code", "constructed", "control", "controls", "cost", "create", "developers", "development", "effects", "fees", "financial", "functions", "households", "housing"....
0.300
additionagenciesboardbureauchaptercitiescivilconservationconsolidatedcouncilcountiescreatedatadistrictdistrictselectedevenfirefunctionsgeneral
SHARED TOKENS (52): "addition", "agencies", "board", "bureau", "chapter", "cities", "civil", "conservation", "consolidated", "council", "counties", "create", "data", "district", "districts", "elected", "even", "fire", "functions", "general"....
0.300
Public library ↗ Q28564 KW CROSS HIGH
academicaccessamongcivilcollectiondistinctexistformationfundedgeneralinformationlibrarymaterialsopenoperatedoutsidepopulationprofessionalsprovidepublic
SHARED TOKENS (28): "academic", "access", "among", "civil", "collection", "distinct", "exist", "formation", "funded", "general", "information", "library", "materials", "open", "operated", "outside", "population", "professionals", "provide", "public"....
0.300
affectagenciesboundarycreatingdrainageenvironmentalfunctionslandlandownersmanagementplanningplansprocessprogramsprojectsqualityresourcesrightsseekspecialists
SHARED TOKENS (26): "affect", "agencies", "boundary", "creating", "drainage", "environmental", "functions", "land", "landowners", "management", "planning", "plans", "process", "programs", "projects", "quality", "resources", "rights", "seek", "specialists"....
0.300
accessadditionadministrationaffectsagencybuildingbusinesscoordinatecreateddepartmentdevelopmentemergencyfederalfundinggovernmentgovernmentshousinginfrastructurelocalmajor
SHARED TOKENS (33): "access", "addition", "administration", "affects", "agency", "building", "business", "coordinate", "created", "department", "development", "emergency", "federal", "funding", "government", "governments", "housing", "infrastructure", "local", "major"....
0.300
actualadministrativeappliedappliesapprovalassessmentassociationcontextdecisiondecisionsdefinesdevelopmentdocumentationeffectsenvironmentalgovernedidentifyingimpactinternationaljudicial
SHARED TOKENS (43): "actual", "administrative", "applied", "applies", "approval", "assessment", "association", "context", "decision", "decisions", "defines", "development", "documentation", "effects", "environmental", "governed", "identifying", "impact", "international", "judicial"....
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcommissionconsolidatedconsolidationcontrolcreatedepartmentdirecteffectsentityfederalgovernedgovernment
SHARED TOKENS (45): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "commission", "consolidated", "consolidation", "control", "create", "department", "direct", "effects", "entity", "federal", "governed", "government"....
0.300
buildingcodescommercialdevelopeddevelopmentdevelopmentsdistrictenvironmentalhousingindustriallandopenparksplannedplanningplansprocessrecreationresidentialrights
SHARED TOKENS (26): "building", "codes", "commercial", "developed", "development", "developments", "district", "environmental", "housing", "industrial", "land", "open", "parks", "planned", "planning", "plans", "process", "recreation", "residential", "rights"....
0.300
affectagriculturalagriculturechangecivilconnectconservationconstructioncontrolengineeringenvironmentalevenfloodgroundwaterhealthimprovementinfluencelandland-uselarge
SHARED TOKENS (40): "affect", "agricultural", "agriculture", "change", "civil", "connect", "conservation", "construction", "control", "engineering", "environmental", "even", "flood", "groundwater", "health", "improvement", "influence", "land", "land-use", "large"....
0.300
actionsactivityaffectaffectinganotherassociatedbecomecommitmentconcerningconditionsconflictconflictscontextcreatecreatesdecisiondecisionsdefinitiondirectestablished
SHARED TOKENS (49): "actions", "activity", "affect", "affecting", "another", "associated", "become", "commitment", "concerning", "conditions", "conflict", "conflicts", "context", "create", "creates", "decision", "decisions", "definition", "direct", "established"....
0.300
businessescitiesconnectedconstructioncontainscostsdecisiondemanddesigndevelopeddifferentdrainageengineersevenhouseholdsindustrialintendedlandlargemanagement
SHARED TOKENS (42): "businesses", "cities", "connected", "construction", "contains", "costs", "decision", "demand", "design", "developed", "different", "drainage", "engineers", "even", "households", "industrial", "intended", "land", "large", "management"....
0.300
activityannualbuildingcannotcommunitydistrictevenfacilitiesfinalfiregovernmenthomeindependentinsidelocalofficeofficersofficesopenphysical
SHARED TOKENS (33): "activity", "annual", "building", "cannot", "community", "district", "even", "facilities", "final", "fire", "government", "home", "independent", "inside", "local", "office", "officers", "offices", "open", "physical"....
0.300
airportanalysisassessmentcapacitycollectioncostcostscurrentdatademandemploymentengineeringenvironmentalestimatesfinancialforecastimpactinfrastructuremodelplanned
SHARED TOKENS (28): "airport", "analysis", "assessment", "capacity", "collection", "cost", "costs", "current", "data", "demand", "employment", "engineering", "environmental", "estimates", "financial", "forecast", "impact", "infrastructure", "model", "planned"....
0.300
actactiveactivitiesadministeredagenciesauthoritybuildingbusinesscanalscapacitycivilconductconstructioncontroldepartmentdesigndirectdirectlyeconomyengineering
SHARED TOKENS (60): "act", "active", "activities", "administered", "agencies", "authority", "building", "business", "canals", "capacity", "civil", "conduct", "construction", "control", "department", "design", "direct", "directly", "economy", "engineering"....
0.300
adaboisecentralconnectedcontainsgardenhistoricidahoitselfmetropolitannationalpopulationrecreationroadsruralseriessouthwesternstarvalleywestern
SHARED TOKENS (20): "ada", "boise", "central", "connected", "contains", "garden", "historic", "idaho", "itself", "metropolitan", "national", "population", "recreation", "roads", "rural", "series", "southwestern", "star", "valley", "western".
0.300
activityagenciescommissioncourtsdepartmentsemergencyenforcementfacilitiesfederalinfrastructurejudiciallawlocalmajorofficersofficesoperatespoliceprivateproperty
SHARED TOKENS (26): "activity", "agencies", "commission", "courts", "departments", "emergency", "enforcement", "facilities", "federal", "infrastructure", "judicial", "law", "local", "major", "officers", "offices", "operates", "police", "private", "property"....
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
actanotherauthorityboundariesbuildingchangecommercialcommissioncommunitycontrolcouncilcourtscreatingcurrentdistrictdistrictsexercisegeneralgovernmenthistoric
SHARED TOKENS (46): "act", "another", "authority", "boundaries", "building", "change", "commercial", "commission", "community", "control", "council", "courts", "creating", "current", "district", "districts", "exercise", "general", "government", "historic"....
0.300
Fort Boise ↗ Q3077782 KW CROSS HIGH
becomeboiseboundarycanyoncapitaldevelopeddifferentdistrictestablishedgovernmenthistoricidahoriversettlementsouthwesternterritorywestern
SHARED TOKENS (17): "become", "boise", "boundary", "canyon", "capital", "developed", "different", "district", "established", "government", "historic", "idaho", "river", "settlement", "southwestern", "territory", "western".
0.300
additionalagenciesbeganbusinessesdepartmentemergencyfacilitiesfiremodelpersonnelplacesprovidepublicremainsrequestsresourcessubstantialsupportsystemstechnical
SHARED TOKENS (25): "additional", "agencies", "began", "businesses", "department", "emergency", "facilities", "fire", "model", "personnel", "places", "provide", "public", "remains", "requests", "resources", "substantial", "support", "systems", "technical"....
0.300
actagriculturebeganboardboisebureaucapacityconstructiondesignhomeidahoirrigationlawmaterialsnationaloperatedportionspowerprojectsprovide
SHARED TOKENS (29): "act", "agriculture", "began", "board", "boise", "bureau", "capacity", "construction", "design", "home", "idaho", "irrigation", "law", "materials", "national", "operated", "portions", "power", "projects", "provide"....
0.300
beyondchangecontrolcourtsdevelopeddisputesdocumentsenvironmentalfederalfederallyfinancefloodformationgoverninggrantshealthirrigationjudicialjurisdictionsland
SHARED TOKENS (36): "beyond", "change", "control", "courts", "developed", "disputes", "documents", "environmental", "federal", "federally", "finance", "flood", "formation", "governing", "grants", "health", "irrigation", "judicial", "jurisdictions", "land"....
0.300
administrationagenciesattorneyattorneysbuildingbureaucivilcontainscreateddepartmentdirectlydistrictsenforcementequivalentfederalfunctionsgeneralgovernmentheadquarteredjudicial
SHARED TOKENS (33): "administration", "agencies", "attorney", "attorneys", "building", "bureau", "civil", "contains", "created", "department", "directly", "districts", "enforcement", "equivalent", "federal", "functions", "general", "government", "headquartered", "judicial"....
0.300
authoritybuildingbusinesscapitalcommercialestatefunctionshousingintendedinvestmentlandlocalmultipleofficeofficespropertyrealresidentialretailsignificant
SHARED TOKENS (23): "authority", "building", "business", "capital", "commercial", "estate", "functions", "housing", "intended", "investment", "land", "local", "multiple", "office", "offices", "property", "real", "residential", "retail", "significant"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businessconnectedcurrentestablishedhighwayshistoricidahoimprovementsinterstatemakingownersriverroadsroutesseparateterritorytrafficvalleywestern
SHARED TOKENS (19): "business", "connected", "current", "established", "highways", "historic", "idaho", "improvements", "interstate", "making", "owners", "river", "roads", "routes", "separate", "territory", "traffic", "valley", "western".
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycostsdevelopmentemploymentgovernmentgrowthhealthhousinglandlong-rangeneighborhoodplanningpoliciespreservepublicregionalresourcesschoolsstreetstransportation
SHARED TOKENS (21): "community", "costs", "development", "employment", "government", "growth", "health", "housing", "land", "long-range", "neighborhood", "planning", "policies", "preserve", "public", "regional", "resources", "schools", "streets", "transportation"....
0.300
Street network ↗ Q358078 KW CROSS HIGH
affectanalysisbecomecitiesconnectedcreatingedgesfoundationhighwayhighwayslinesmovementnationalnetworkrepresentroadsstreetssystemtraffictransportation
SHARED TOKENS (20): "affect", "analysis", "become", "cities", "connected", "creating", "edges", "foundation", "highway", "highways", "lines", "movement", "national", "network", "represent", "roads", "streets", "system", "traffic", "transportation".
0.300
Parcel ↗ EXACT TITLE
deliverydynamicsgeographylandparcel
SHARED TOKENS (5): "delivery", "dynamics", "geography", "land", "parcel". | EXACT TITLE in government_civic: "Parcel". | EXACT TITLE in land_use_planning: "Parcel".
0.300
activityactualadvocacyagencybecomebodiesexpendituresfederalfirmsgovernancegovernmentgovernmentsindependentinfluencelocalmunicipalnationalpoliticalpowerprofessional
SHARED TOKENS (30): "activity", "actual", "advocacy", "agency", "become", "bodies", "expenditures", "federal", "firms", "governance", "government", "governments", "independent", "influence", "local", "municipal", "national", "political", "power", "professional"....
0.300
buildingbusinesscentraldevelopmentgrowthincreaseintegratedlandnetworkplanningprivatepublicresidentialscalesmallertransiturban
SHARED TOKENS (17): "building", "business", "central", "development", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "residential", "scale", "smaller", "transit", "urban".
0.300
amongannexationboundariescitiescontroldistinctgovernmentgovernmentsimpliesjurisdictionlawlocalmunicipalneighboringprocessresponseseekterritoryunincorporatedurban
SHARED TOKENS (21): "among", "annexation", "boundaries", "cities", "control", "distinct", "government", "governments", "implies", "jurisdiction", "law", "local", "municipal", "neighboring", "process", "response", "seek", "territory", "unincorporated", "urban"....
0.300
collegecommunityeconomiceducationformalformsgeneralinformalknowledgeproviderelatedschoolschoolsspecializedstudiestechnicaltechnologytradetraining
SHARED TOKENS (19): "college", "community", "economic", "education", "formal", "forms", "general", "informal", "knowledge", "provide", "related", "school", "schools", "specialized", "studies", "technical", "technology", "trade", "training".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycanalsconservationcreatedcycledifferentestategovernmenthighwayhighwayslandlegallineslocalmeanownershipphysicalprivaterealrestricted
SHARED TOKENS (30): "authority", "canals", "conservation", "created", "cycle", "different", "estate", "government", "highway", "highways", "land", "legal", "lines", "local", "mean", "ownership", "physical", "private", "real", "restricted"....
0.300
adaboisebuiltbureaucanalcanyoncountiesengineersidahoirrigationoperatedreclamationriversouthwesterntreasurevalleywaterwestern
SHARED TOKENS (18): "ada", "boise", "built", "bureau", "canal", "canyon", "counties", "engineers", "idaho", "irrigation", "operated", "reclamation", "river", "southwestern", "treasure", "valley", "water", "western".
0.300
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
agricultureboisebureaucivilcountiesengineeringengineershistoricidahoirrigationnationaloperatedprovidereclamationreservoirriversouthwesternwaterwestern
SHARED TOKENS (19): "agriculture", "boise", "bureau", "civil", "counties", "engineering", "engineers", "historic", "idaho", "irrigation", "national", "operated", "provide", "reclamation", "reservoir", "river", "southwestern", "water", "western".
0.300
foundedheadquarteredlargestmajorsupply
SHARED TOKENS (5): "founded", "headquartered", "largest", "major", "supply". | EXACT TITLE in land_use_planning: "Sekisui House".
0.300
activityamongassociationboisebureaucanyoncapacityconservationcontainscountiescreatedcreatesdirectlyedgefederalformationidaholargestlocalnampa
SHARED TOKENS (37): "activity", "among", "association", "boise", "bureau", "canyon", "capacity", "conservation", "contains", "counties", "created", "creates", "directly", "edge", "federal", "formation", "idaho", "largest", "local", "nampa"....
0.300
boisecontainscreateddistrictsfacilitieshomeidaholandmultiplenationalpercentrecreationresourcesriverwater
SHARED TOKENS (15): "boise", "contains", "created", "districts", "facilities", "home", "idaho", "land", "multiple", "national", "percent", "recreation", "resources", "river", "water".
0.300
affordabilityamongappliedauthoritybegancitiescitywideconstrainconstructiondistrictdistrictseconomiceconomyelectedenvironmentalestimatesexercisegovernmentsgrowinghousing
SHARED TOKENS (45): "affordability", "among", "applied", "authority", "began", "cities", "citywide", "constrain", "construction", "district", "districts", "economic", "economy", "elected", "environmental", "estimates", "exercise", "governments", "growing", "housing"....
0.300
adabeganboisebuiltbureauconstructioncontroldirectlyengineersfederalfloodformshighwayidahoirrigationmultipleoperatingoperationalparkpower
SHARED TOKENS (27): "ada", "began", "boise", "built", "bureau", "construction", "control", "directly", "engineers", "federal", "flood", "forms", "highway", "idaho", "irrigation", "multiple", "operating", "operational", "park", "power"....
0.300
academicactivitiesanalysisassociatedassociationbodiesdistinctethicalevidencefoundinggovernancehistoricalhistorylawmeanspoliticalpowerresearchrolesignificant
SHARED TOKENS (27): "academic", "activities", "analysis", "associated", "association", "bodies", "distinct", "ethical", "evidence", "founding", "governance", "historical", "history", "law", "means", "political", "power", "research", "role", "significant"....
0.300
communitydevelopmentdirectlydistricteconomicfinancingimprovementincreasesinfrastructureinvestmentmunicipalitiesneedprivateprogramprojectprojectspropertypublicredevelopmentrelated
SHARED TOKENS (24): "community", "development", "directly", "district", "economic", "financing", "improvement", "increases", "infrastructure", "investment", "municipalities", "need", "private", "program", "project", "projects", "property", "public", "redevelopment", "related"....
0.300
agriculturalagriculturebuildingcostdesigndevelopeddevelopmentdevelopmentsentitygeneralgovernmentlandopenoperatorprivatepublicratherrelatedrestrictedrural
SHARED TOKENS (23): "agricultural", "agriculture", "building", "cost", "design", "developed", "development", "developments", "entity", "general", "government", "land", "open", "operator", "private", "public", "rather", "related", "restricted", "rural"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherconnectdevelopmenteasementsevenexercisefeefinalfunctionsgovernmentimpactjurisdictionslandlegalmunicipalitiesownersownershippowerprivate
SHARED TOKENS (33): "acquisition", "another", "connect", "development", "easements", "even", "exercise", "fee", "final", "functions", "government", "impact", "jurisdictions", "land", "legal", "municipalities", "owners", "ownership", "power", "private"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorycontroldevelopmentfinancefinancialfinancingfirmsgeneralinvestmentmanagementoperationalownershipprivateprovidepublicratherrole
SHARED TOKENS (23): "active", "business", "capital", "category", "control", "development", "finance", "financial", "financing", "firms", "general", "investment", "management", "operational", "ownership", "private", "provide", "public", "rather", "role"....
0.300
administrativeagriculturearrangementchaincomplianceconservationconstraincontinuescreatesdevelopmentdocumenteasementsentityestablishedestateexercisefederalfinancialgovernmentgrants
SHARED TOKENS (54): "administrative", "agriculture", "arrangement", "chain", "compliance", "conservation", "constrain", "continues", "creates", "development", "document", "easements", "entity", "established", "estate", "exercise", "federal", "financial", "government", "grants"....
0.300
agencyboardboisecapitalcodedepartmentdistrictseducationelectedheadquarteredidahoinstructionofficialpublicschoolschoolsservesstudentssystemtitle
SHARED TOKENS (20): "agency", "board", "boise", "capital", "code", "department", "districts", "education", "elected", "headquartered", "idaho", "instruction", "official", "public", "school", "schools", "serves", "students", "system", "title".
0.300
civilcommitmentemergencygeneralgrewmanagementmeaningnationalplanningprogramsprotectprotectionresourcesresponseshiftedstructuresuses
SHARED TOKENS (17): "civil", "commitment", "emergency", "general", "grew", "management", "meaning", "national", "planning", "programs", "protect", "protection", "resources", "response", "shifted", "structures", "uses".
0.300
activitiesadministrationagencybureaudepartmentdivisionfederalhighwaymajorofficeprogramprogramspublicroadroadsroletransportation
SHARED TOKENS (17): "activities", "administration", "agency", "bureau", "department", "division", "federal", "highway", "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation".
0.300
additionagencyattorneyattorneysauthoritycodecountiescourtsdirectlydistrictelectedenforcementfederalgovernmentindependentjudicialjurisdictionjurisdictionslawlegal
SHARED TOKENS (28): "addition", "agency", "attorney", "attorneys", "authority", "code", "counties", "courts", "directly", "district", "elected", "enforcement", "federal", "government", "independent", "judicial", "jurisdiction", "jurisdictions", "law", "legal"....
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
addressaffordablearchitectureassociatedbuildingcommunitycongestioncontemporarycreatingdesigndevelopmentdevelopmentsestatefacilitieshistorichousingincreaseinfrastructurelandland-use
SHARED TOKENS (35): "address", "affordable", "architecture", "associated", "building", "community", "congestion", "contemporary", "creating", "design", "development", "developments", "estate", "facilities", "historic", "housing", "increase", "infrastructure", "land", "land-use"....
0.300
acquireactapprovalapprovalsarchitectsbuildingcommercialconstructioncontextcontractorscostscreatesdesigndeterminedevelopersdevelopmentdevelopmentsdifferenteconomicengineers
SHARED TOKENS (51): "acquire", "act", "approval", "approvals", "architects", "building", "commercial", "construction", "context", "contractors", "costs", "creates", "design", "determine", "developers", "development", "developments", "different", "economic", "engineers"....
0.300
adaarchitectsarchitecturebeganboisebuildingcapitalconstructioncostdepartmentdesigndistrictfederalfinalformationgovernmenthistorichomeidaholegislature
SHARED TOKENS (29): "ada", "architects", "architecture", "began", "boise", "building", "capital", "construction", "cost", "department", "design", "district", "federal", "final", "formation", "government", "historic", "home", "idaho", "legislature"....
🫐 BERRY32 edges
0.280
Right to property ↗ KW CROSS HIGH
articlecivileconomicgeneralinternationallegalownershippoliticalprivatepropertyprotectionrightssignificantspecified
SHARED TOKENS (14): "article", "civil", "economic", "general", "international", "legal", "ownership", "political", "private", "property", "protection", "rights", "significant", "specified".
0.280
accessassociatedconstructiondevelopmentdocumentseffectivegoverninggovernmentinformationinstitutionsmaintainsopenpracticepublic
SHARED TOKENS (14): "access", "associated", "construction", "development", "documents", "effective", "governing", "government", "information", "institutions", "maintains", "open", "practice", "public".
0.240
adoptedcitiescouncildirectlyelectedformsgovernmentlargelocalmunicipalitiesseparatelysystem
SHARED TOKENS (12): "adopted", "cities", "council", "directly", "elected", "forms", "government", "large", "local", "municipalities", "separately", "system".
0.240
Drinking water ↗ Q7892 KW CROSS HIGH
activityaffectedconditionsdependsdirectlyenvironmentalhealthmajorphysicalrequiredwaterwork
SHARED TOKENS (12): "activity", "affected", "conditions", "depends", "directly", "environmental", "health", "major", "physical", "required", "water", "work".
0.240
additionalattachedgardenhomememberprincipalpropertyprovidereceiveresidentialseparatesupport
SHARED TOKENS (12): "additional", "attached", "garden", "home", "member", "principal", "property", "provide", "receive", "residential", "separate", "support".
0.220
Septic tank ↗ Q386300 KW CROSS HIGH
connecteddevelopsgroundwateroccurprocessesruralsystemsystemsthereforetreatmentwastewater
SHARED TOKENS (11): "connected", "develops", "groundwater", "occur", "processes", "rural", "system", "systems", "therefore", "treatment", "wastewater".
0.220
activitybuiltdevelopedenvironmentalhealthlandpublicrisktransitionurbanwildfire
SHARED TOKENS (11): "activity", "built", "developed", "environmental", "health", "land", "public", "risk", "transition", "urban", "wildfire".
0.220
associatedboisecontainsextendsfederallyidaholargestmetropolitanpopulationsouthwesternvalley
SHARED TOKENS (11): "associated", "boise", "contains", "extends", "federally", "idaho", "largest", "metropolitan", "population", "southwestern", "valley".
0.200
affectdecisionsdirectdirectlyelectedgovernmentmodelpoliciespoliticalrather
SHARED TOKENS (10): "affect", "decisions", "direct", "directly", "elected", "government", "model", "policies", "political", "rather".
0.180
civilconstructionengineeringknowledgematerialsoverlappingrelatedstudyuses
SHARED TOKENS (9): "civil", "construction", "engineering", "knowledge", "materials", "overlapping", "related", "study", "uses".
0.180
citiesfederalgeneralidahomunicipaloccurofficesstatewidestudy
SHARED TOKENS (9): "cities", "federal", "general", "idaho", "municipal", "occur", "offices", "statewide", "study".
0.180
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
0.180
businessdevelopmentestateindustrialofficeofficesparkplannedrather
SHARED TOKENS (9): "business", "development", "estate", "industrial", "office", "offices", "park", "planned", "rather".
0.180
boisecontrolselectedheadquarteredidaholegislaturenationalofficesstatewide
SHARED TOKENS (9): "boise", "controls", "elected", "headquartered", "idaho", "legislature", "national", "offices", "statewide".
0.160
beganboisebuildingcreatedidaholegislatureoperationsstatute
SHARED TOKENS (8): "began", "boise", "building", "created", "idaho", "legislature", "operations", "statute".
0.160
decisionfocusedgeneralgovernmentinfluencemakingpoliticalprocess
SHARED TOKENS (8): "decision", "focused", "general", "government", "influence", "making", "political", "process".
0.140
actualcurrentestatemarketpropertyrealvalue
SHARED TOKENS (7): "actual", "current", "estate", "market", "property", "real", "value".
0.140
boisebuildingdistrictselectedidaholegislatureseparate
SHARED TOKENS (7): "boise", "building", "districts", "elected", "idaho", "legislature", "separate".
0.140
cannotconservationmanagementpracticepriorityprotecttypes
SHARED TOKENS (7): "cannot", "conservation", "management", "practice", "priority", "protect", "types".
0.140
constructionitselfmaterialsmeaningpropertyrealtitle
SHARED TOKENS (7): "construction", "itself", "materials", "meaning", "property", "real", "title".
0.140
articlecurrentgovernmentidaholegislatureofficepower
SHARED TOKENS (7): "article", "current", "government", "idaho", "legislature", "office", "power".
0.140
agriculturalcitiesidaholandlargestmajorriver
SHARED TOKENS (7): "agricultural", "cities", "idaho", "land", "largest", "major", "river".
0.140
changeeffectivemakingratherrelationshipssystemsystems
SHARED TOKENS (7): "change", "effective", "making", "rather", "relationships", "system", "systems".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
historyidahoproducedpublicsupporttrade
SHARED TOKENS (6): "history", "idaho", "produced", "public", "support", "trade".
0.120
boisehomeidaholargestmetropolitanpopulation
SHARED TOKENS (6): "boise", "home", "idaho", "largest", "metropolitan", "population".
0.120
constitutionalcurrentelectedidahoofficestatewide
SHARED TOKENS (6): "constitutional", "current", "elected", "idaho", "office", "statewide".
0.100
controleducationhealthpopulationprograms
SHARED TOKENS (5): "control", "education", "health", "population", "programs".
0.100
History of Idaho ↗ KW CROSS HIGH
activityassociatedhistoryidahowestern
SHARED TOKENS (5): "activity", "associated", "history", "idaho", "western".
0.100
Idaho Senate ↗ Q1494863 KW CROSS HIGH
boisedistrictelectedidaholegislature
SHARED TOKENS (5): "boise", "district", "elected", "idaho", "legislature".
0.100
constitutionalfinancialgovernmentidahooffice
SHARED TOKENS (5): "constitutional", "financial", "government", "idaho", "office".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Government Civic × Land Use Planning — Treasure Valley
HAIKU · HIGH GATE
How do Ada County and Boise city governments coordinate land use decisions with water management from the Bureau of Reclamation?
Ada County and Boise coordinate through the Treasure Valley metropolitan planning process, which integrates Bureau of Reclamation water allocations into zoning and development approvals. The Bureau of Reclamation's control over aquifer and groundwater resources directly constrains where urban renewal and new residential projects can proceed in the Treasure Valley.
What role does transportation planning play in how Boise and Ada County approve new land developments?
The Federal Transit Administration funds bus rapid transit corridors that Boise city planners designate as high-density development zones during land use reviews. Ada County incorporates Boise Airport access and regional transportation planning into comprehensive plans that determine where commercial and residential land uses concentrate.
How do Boise State University and the University of Idaho influence land use policy in the Treasure Valley?
Both institutions operate as major landholders and employers whose campus expansion plans trigger Ada County and Boise municipal land use reviews. College of Western Idaho similarly affects stormwater management and urban renewal planning through its facilities footprint in the greater Treasure Valley.
Why do stormwater regulations affect how Ada County approves residential and commercial subdivisions?
Ada County enforces stormwater standards tied to groundwater protection and aquifer recharge rates, requiring developers to design land uses that minimize runoff and wastewater overflow. Boise and Ada County governments have adopted these standards in their comprehensive plans to prevent contamination of the Treasure Valley's water supply.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Government Civic × Land Use Planning 40 QID bridges 214 edges 5,424 ext links 2026-07-17 21:04:35 UTC 25da9d512359f813
Government Civic corridor ↗ Land Use Planning corridor ↗ Land Use Planning × Government Civic ↗ boisestandard.org/standard ↗
Parent Corridors
Government Civic × All Other Verticals