—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Food ↔ relates to ↔ Basque Culture

13 Wikipedia bridge articles confirmed in both vertical ledgers. 209 deterministic cross-vertical edges. 5,696 external source links harvested. Every edge provenance-stamped. Every claim auditable.

13 QID Bridge Articles
209 Cross Edges
5,696 External Sources
240 Wikipedia Articles
12 🌲 Evergreen
133 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Food
× Basque Culture
QID Bridge Articles
13
confirmed Wikipedia overlap
Total Cross Edges
209
External Sources Harvested
5,696
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Food safety
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (13)
Food safetyBoise, IdahoTreasure ValleyBasquesTripadvisorBasque cuisineCaldwell, IdahoCharcuterieRestaurantPinchoAda County, IdahoCanyon County, IdahoLiquor license
Shared Semantics (20 tokens)
boiseidahobasquepopulationlocalfoodoregonregioncountryrelatedcapitallocallytreasurevalleywesternculturegroupcuisinecaldwellcanyon
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:55:42 UTC
Content Hash
e7dbf500023a5e4a
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
13 BRIDGES
Food safety
Q909821 EXACT TITLE 1.000
QID OVERLAP: Q909821 in food (tier:evergreen) and basque_culture (tier:branch). | SHARED TOKENS (15): "certification", "chain", "consumer", "death", "food", "foods", "health", "introduced", "labeling", "market", "organization", "related", "safety", "supply", "world". | EXACT TITLE in food: "Food safety".
certificationchainconsumerdeathfoodfoodshealthintroducedlabelingmarketorganizationrelatedsafetysupplyworld
to food labeling, food hygiene, food additives and pesticide residues; as well as policies on biotechnology and food and guidelines for the management of governmental import and export inspection and certification systems for foods. In considering market-to-consumer practices, the usual thought is that food ought to be safe in the market and the concern is safe delivery and preparation of the food for the consumer. Food safety, nutrition and food security are closely related. Unhealthy food creates a cycle of disease and malnutrition that affects infants and adults as well. Food can transmit pathogens, which can result in the illness or death of the person or other animals. The main types of pathogens are bacteria, viruses, parasites, and fungus. The World Health Organization estimated that foodborne pathogens cause 600 million cases of diseases and 420,000 deaths per year. Food can also serve as a growth and reproductive medium for pathogens. In developed countries, there are intricate standards for food preparation, whereas in lesser developed countries there are fewer standards and less enforcement of those standards.
Pakistan The Pure Food Ordinance 1960 consolidates and amends the law in relation to the preparation and the sale of foods. Its aim is to ensure purity of food being supplied to people in the market and, therefore, provides for preventing adulteration. Pakistan Hotels and Restaurant Act, 1976 applies to all hotels and restaurants in Pakistan and seeks to control and regulate the standard of service(s) by hotels and restaurants. In addition to other provisions, under section 22(2), the sale of food or beverages that are contaminated, not prepared hygienically or served in utensils that are not hygienic or clean is an offense. South Korea Ministry of Food and Drug Safety The Ministry of Food and Drug Safety has been working for food safety since 1945. It is part of the Government of South Korea. IOAS-Organic Certification Bodies Registered in KFDA: "Organic" or related claims can be labelled on food products when organic certificates are considered as valid by KFDA. KFDA admits organic certificates which can be issued by 1) IFOAM (International Federation of Organic Agriculture Movement) accredited certification bodies 2) Government accredited certification bodies – 328 bodies in 29 countries have been registered in KFDA. Food Import Report: According to Food Import Report, it is supposed to report or register what you import.
Ministry of Food and Drug Safety The Ministry of Food and Drug Safety has been working for food safety since 1945. It is part of the Government of South Korea. IOAS-Organic Certification Bodies Registered in KFDA: "Organic" or related claims can be labelled on food products when organic certificates are considered as valid by KFDA. KFDA admits organic certificates which can be issued by 1) IFOAM (International Federation of Organic Agriculture Movement) accredited certification bodies 2) Government accredited certification bodies – 328 bodies in 29 countries have been registered in KFDA. Food Import Report: According to Food Import Report, it is supposed to report or register what you import.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in food (tier:evergreen) and basque_culture (tier:evergreen). | SHARED TOKENS (19): "annual", "basque", "block", "boise", "capital", "capitol", "downtown", "idaho", "locally", "major", "museum", "music", "nevada", "north", "oregon", "population", "technology", "treasure", "valley". | EXACT TITLE in food: "Boise, Idaho". | EXACT TITLE in basque_culture: "Boise, Idaho".
annualbasqueblockboisecapitalcapitoldowntownidaholocallymajormuseummusicnevadanorthoregonpopulationtechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in food (tier:evergreen) and basque_culture (tier:evergreen). | SHARED TOKENS (10): "agricultural", "association", "boise", "idaho", "local", "oregon", "region", "treasure", "valley", "western". | EXACT TITLE in food: "Treasure Valley". | EXACT TITLE in basque_culture: "Treasure Valley".
agriculturalassociationboiseidaholocaloregonregiontreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Basques
Q126756 EXACT TITLE 0.880
QID OVERLAP: Q126756 in food (tier:branch) and basque_culture (tier:evergreen). | SHARED TOKENS (9): "around", "basque", "country", "culture", "direct", "ethnic", "group", "region", "western". | EXACT TITLE in basque_culture: "Basques".
aroundbasquecountryculturedirectethnicgroupregionwestern
ants of Neolithic European populations in Europe. Basques are indigenous to, and primarily inhabit, an area traditionally known as the Basque Country (Basque: Euskal Herria)—a region that is located around the western end of the Pyrenees on the coast of the Bay of Biscay and straddles parts of north-central Spain and south-western France. Etymology The English word Basque may be pronounced or and derives from the French Basque (French: [bask]), itself derived from Gascon Basco (pronounced [ˈbasku]), cognate with Spanish Vasco (pronounced [ˈbasko]). Those, in turn, come from Latin Vascō (pronounced [ˈwaskoː]; plural Vascōnēs—see history section below). The Latin /w/ generally evolved into the bilabials /b/ and /β̞/ in Gascon and Spanish, probably under the influence of Basque and the related Aquitanian (the Latin /w/ instead evolved into /v/ in French, Italian and other Romance languages). Several coins from the 2nd and the 1st centuries BC found in the Basque Country bear the inscription barscunes. The place in which they were minted is not certain but is thought to be somewhere near Pamplona, in the heartland of the area that historians believe was inhabited by the Vascones. Some scholars have suggested a Celtic etymology based on bhar-s-, meaning "summit", "point" or "leaves", according to which barscunes may have meant "the mountain people", "the tall ones" or "the proud ones", and others have posited a relationship to a Proto-Indo-European root *bar- meaning "border", "frontier", "march". In Basque, people call themselves the euskaldunak, singular euskaldun, formed from euskal- (i.e. "Basque (language)") and -dun (i.e. "one who has"); euskaldun literally means a Basque-speaker. Not all Basques are Basque-speakers. Therefore, the neologism euskotar, plural euskotarrak, was coined in the 19th century to mean a Basque person, whether Basque-speaking or not. Alfonso Irigoyen posits that the word euskara is derived from an ancient Basque verb enautsi "to say" (compare modern Basque esan) and the suffix -(k)ara ("way (of doing something)"). Thus, euskara would mean literally "way of saying" or "way of speaking". One item of evidence in favour of that hypothesis is found in the Spanish book Compendio Historial, written in 1571 by the Basque writer Esteban de Garibay. He records the name of the Basque language as enusquera. That may, however, be a writing mistake. In the 19th century, the Basque nationalist activist Sabino Arana posited an original root euzko, which he thought came from eguzkiko ("of the sun", related to the assumption of an original solar religion). On the basis of that putative root, Arana proposed the name Euzkadi for an independent Basque nation, composed of seven Basque historical territories.
Latin America Spanish author Miguel de Unamuno said: "There are at least two things that clearly can be attributed to Basques: the Society of Jesus and the Republic of Chile." Chilean historian Luis Thayer Ojeda estimated that 48 percent of immigrants to Chile in the 17th and 18th centuries were Basque. Estimates for the number of Basque descendants living in Chile range between 2.5 and 5 million; the Basque have been a major, if not the strongest, influence in the country's cultural and economic development. In Bolivia, the War of the Vicuñas and Basques (Spanish: Guerra de Vicuñas y Vascongados), was an armed conflict in Charcas Province that lasted between June 1622 and March 1625, fought between Basques and "Vicuñas"; an informal term for non-Basque Spaniards in Upper Peru, a name obtained through the habit of wearing hats made of vicuña skins. Competition over the control of the silver mines in Potosí, Lípez and Chichas surged in the early 17th century, pitting Basques and Vicuñas against each other. The Vicuñas had initially employed legal and political measures attempting to block the Basque attempts to monopolize control over the cabildo (municipal government) of Potosí and the silver mining sector. The war pitted different sectors of the viceregal administration against each other, as some supported the Basque claims for hegemony whilst others had a conciliatory approach to the Vicuña rebels. Personalities involved in the conflict included the president and oidores of the Royal Audiencia of Charcas, treasury officials and the corregidor of Potosí and the visitador (sent to the area in order to audit fiscal accounts). Basque place names are to be found in the Americas, such as Nueva Vizcaya (now Chihuahua and Durango, Mexico), New Navarre (now Sonora and Sinaloa, Mexico), Biscayne Bay (United States), and Aguereberry Point (United States). Nueva Vizcaya was the first province in the north of the Viceroyalty of New Spain (Mexico) to be explored and settled by the Spanish. It consisted mostly of the area which is today the states of Chihuahua and Durango (the original Durango is a known city in Biscay). In Mexico most descendants of Basque émigrés are concentrated in the cities of Monterrey, Saltillo, Reynosa, Camargo, and the states of Jalisco, Durango, Nuevo León, Tamaulipas, Coahuila, and Sonora. The Basques were important in the mining industry; many were ranchers and vaqueros (cowboys), and the rest opened small shops in major cities such as Mexico City, Guadalajara and Puebla. In Guatemala, most Basques have been concentrated in Sacatepequez Department, Antigua Guatemala, Jalapa for six generations now, while some have migrated to Guatemala City. In Colombia, a large number of Basques settled mainly in Antioquia and the Coffee Axis. In 1955, Joaquín Ospina said: "Is there something more similar to the Basque people than the "antioqueños". Also, writer Arturo Escobar Uribe said in his book "Mitos de Antioquia" (Myths of Antioquia) (1950): "Antioquia, which in its clean ascendance predominates the peninsular farmer of the Basque provinces, inherited the virtues of its ancestors. ... Despite the predominance of the white race, its extension in the mountains ... has projected over Colombia's map the prototype of its race; in Medellín with the industrial paisa, entrepreneur, strong and steady ... in its towns, the adventurer, arrogant, world-explorer. ... Its myths, which are an evidence of their deep credulity and an indubitable proof of their Iberian ancestor, are the sequel of the conqueror's blood which runs through their veins". Bambuco, a Colombian folk music, has Basque roots. United States The largest of several important Basque communities in the United States is in the area around Boise, Idaho, home to the Basque Museum and Cultural Center, host to an annual Basque festival, as well as a festival for the Basque diaspora every five years. Reno, Nevada, where the Center for Basque Studies and the Basque Studies Library are located at the University of Nevada, is another significant nucleus of Basque population. Elko, Nevada, sponsors an annual Basque festival that celebrates the dance, cuisine and cultures of the Basque peoples of Spanish, French and Mexican nationalities who have arrived in Nevada since the late 19th century. Texas has a large percentage of Hispanics descended from Basques who participated in the conquest of New Spain. Many of the original Tejanos had Basque blood, including those who fought in the Battle of the Alamo alongside many of the other Texans. Along the Mexican/Texan border, many Basque surnames can be found. The largest concentration of Basques who settled on Mexico's north-eastern "frontera", including the states of Chihuahua, Durango, Coahuila, Nuevo León, and Tamaulipas, also settled along Texas' Rio Grande from South Texas to West Texas. Many of the historic hidalgos, or noble families from this area, had gained their titles and land grants from Spain and Mexico; they still value their land. Some of North America's largest ranches, which were founded under these colonial land grants, can be found in this region. California has a major concentration of Basques, most notably in the San Joaquin Valley between Stockton, Fresno and Bakersfield. The city of Bakersfield has a large Basque community and the city has several Basque restaurants, including Noriega's which won the 2011 James Beard Foundation America's Classic Award. There is a history of Basque culture in Chino, California. In Chino, two annual Basque festivals celebrate the dance, cuisine, and culture of the peoples. The surrounding area of San Bernardino County has many Basque descendants as residents. They are mostly descendants of settlers from Spain and Mexico. These Basques in California are grouped in the group known as Californios. Basques of European Spanish-French and Latin American nationalities also settled throughout the western U.S.
I am French and Basque. There is no conflict, I am proud of both ... I have friends who are involved in the political side of things but that is not for me. My only interest is the culture, the Euskera language, the people, our history and ways. As a result of state language promotion, school policies, the effects of mass media and migration, today virtually all Basques (except for some children below school age) speak the official language of their state (Spanish or French). There are extremely few Basque monolingual speakers: essentially all Basque speakers are bilingual on both sides of the border. Spanish or French is typically the first language of citizens from other regions (who often feel no need to learn Basque), and Spanish or French is also the first language of many Basques, all of which maintains the dominance of the state tongues of both France and Spain. Recent Basque Government policies aim to change this pattern, as they are viewed as potential threats against mainstream usage of the minority tongue. The Basque language is thought to be a genetic language isolate in contrast with other European languages, the vast majority of which belong to the broad Indo-European language family. Another peculiarity of Basque is that it has probably been spoken continuously in situ, in and around its present territorial location, for longer than most other modern European languages, which are typically thought to have been introduced in historic or prehistoric times through population migrations or other processes of cultural transmission. However, popular stereotypes characterizing Basque as "the oldest language in Europe" and "unique among the world's languages" may be misunderstood and lead to erroneous assumptions. Over the centuries, Basque has remained in continuous contact with neighboring western European languages with which it has come to share numerous lexical properties and typological features; it is therefore misleading to exaggerate the "outlandish" character of Basque.
T
Q1770710 EXACT TITLE 0.880
QID OVERLAP: Q1770710 in food (tier:evergreen) and basque_culture (tier:evergreen). | SHARED TOKENS (9): "american", "billion", "brand", "com", "group", "july", "mobile", "operates", "tripadvisor". | EXACT TITLE in food: "Tripadvisor". | EXACT TITLE in basque_culture: "Tripadvisor".
americanbillionbrandcomgroupjulymobileoperatestripadvisor
Tripadvisor is an American company that operates online travel agencies, comparison shopping websites, and mobile apps with user-generated content. Its namesake brand, Tripadvisor.com, operates in 40 countries and 20 languages, and features approximately 1 billion reviews and opinions on roughly 8 million establishments. The company's other brands include Bokun.io, Cruise Critic, FlipKey, TheFork, Holiday Lettings, Housetrip, Jetsetter, Singleplatform, Niumba, SeatGuru, and Viator.
In February 2020, the company changed its name from TripAdvisor to Tripadvisor, using a lowercase "a". In April 2020, during the COVID-19 pandemic, Tripadvisor announced 600 layoffs in Canada and the United States and 300 more in other countries as part of a 25% reduction in workforce. The company also closed offices in downtown Boston and San Francisco. In July 2020, Tripadvisor sold 8 brands to Hopjump: Smarter Travel, Airfarewatchdog, BookingBuddy, OneTime, Oyster.com, Family Vacation Critic, What To Pack, and Holiday Watchdog. On December 8, 2020, China blocked 105 apps, including Tripadvisor, from mobile app stores. The Cyberspace Administration of China stated that the apps were "illegal", and that public concerns were raised around "obscene, pornographic and violent information or fraud, gambling and prostitution". In December 2020, the Tripadvisor.com website drew 90.2 million visits, and the Tripadvisor app was among the top 10 travel apps in 26 countries as of January 2021. In May 2022, Matt Goldberg was announced as the new CEO of Tripadvisor, replacing Stephen Kaufer. In April 2025, Tripadvisor completed a $430 million acquisition of its parent company, Liberty Tripadvisor Holdings. In November 2025, Tripadvisor announced plans to merge Viator and Tripadvisor under one team to create a new 'experience-led' operating model. In the same month, the company launched an AI-powered Tripadvisor app within ChatGPT. Users logged-in to ChatGPT can use the app to plan vacations, read reviews, and ask questions.
Breaches of advertising standards In September 2011, after receiving a complaint submitted by online investigations company KwikChex, the UK Advertising Standards Authority (ASA) launched a formal investigation into Tripadvisor's claims to provide trustworthy and honest reviews from travelers. The ASA found that Tripadvisor "should not claim or imply that all its reviews were from real travellers, or were honest, real or trusted", and as a result of the investigation, Tripadvisor was ordered to remove the slogan "reviews you can trust" from its UK website. It changed its hotel review section slogan to "reviews from our community." Tripadvisor said the branding change had been planned for some time and that changes began in June 2011, before the ASA investigation. ASA commented that "it was concerned that consumers might be fooled by fraudulent posts since the entries could be made without any form of verification", but recognized that Tripadvisor used "advanced and highly effective fraud systems" in an attempt to identify and remove fake content.Approximately 30 hotels have been penalized on the website by the company for suspicious reviews, including a Cornwall hotel that bribed guests to leave positive reviews of the hotel. Tripadvisor has stated that reviews are subject to a verification process that considers the IP address and email address of the author, and tries to detect any suspicious patterns or obscene or abusive language.
Basque cuisine
Q521179 EXACT TITLE 0.860
QID OVERLAP: Q521179 in food (tier:branch) and basque_culture (tier:evergreen). | SHARED TOKENS (8): "basque", "country", "cuisine", "local", "pintxos", "region", "sheep", "wine". | EXACT TITLE in basque_culture: "Basque cuisine".
basquecountrycuisinelocalpintxosregionsheepwine
Basque cuisine refers to the cuisine of the Basque Country and includes meats and fish grilled over hot coals, marmitako and lamb stews, cod, Tolosa bean dishes, paprikas from Lekeitio, pintxos (Basque tapas), Idiazabal sheep's cheese, txakoli (sparkling white wine), and Basque cider. A basquaise is a type of dish prepared in the style of Basque cuisine that often includes tomatoes and sweet or hot red peppers.
s cheese, txakoli (sparkling white wine), and Basque cider. A basquaise is a type of dish prepared in the style of Basque cuisine that often includes tomatoes and sweet or hot red peppers. Overview Basques have also been quick to absorb new ingredients and techniques from new settlers and from their own trade and exploration links. Jews expelled from Spain and Portugal created a chocolate and confectionery industry in Bayonne still well-known today, and part of a wider confectionery and pastry tradition across the Basque Country. Basques embraced the potato and the capsicum, used in hams, sausages and recipes, with pepper festivals around the area, notably Ezpeleta and Puente la Reina. Olive oil is more commonly used than other vegetable oils in Basque cooking. One of the staple cookbooks for traditional Basque dishes was initially published in 1933.
Overview Basques have also been quick to absorb new ingredients and techniques from new settlers and from their own trade and exploration links. Jews expelled from Spain and Portugal created a chocolate and confectionery industry in Bayonne still well-known today, and part of a wider confectionery and pastry tradition across the Basque Country. Basques embraced the potato and the capsicum, used in hams, sausages and recipes, with pepper festivals around the area, notably Ezpeleta and Puente la Reina. Olive oil is more commonly used than other vegetable oils in Basque cooking. One of the staple cookbooks for traditional Basque dishes was initially published in 1933.
Caldwell, Idaho
Q849592 EXACT TITLE 0.860
QID OVERLAP: Q849592 in food (tier:evergreen) and basque_culture (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "locally", "oregon", "population", "west". | EXACT TITLE in food: "Caldwell, Idaho".
boisecaldwellcanyonidaholocallyoregonpopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Charcuterie
Q260568 EXACT TITLE 0.840
QID OVERLAP: Q260568 in food (tier:branch) and basque_culture (tier:evergreen). | SHARED TOKENS (7): "cooking", "cuisine", "french", "pork", "products", "restaurants", "today". | EXACT TITLE in basque_culture: "Charcuterie".
cookingcuisinefrenchporkproductsrestaurantstoday
Emulsified sausage Emulsified sausages are cooked sausages with a very fine texture, using the combination of pork, beef, or poultry with fat, salt, cure, flavorings, and water. These ingredients are emulsified at high speed in a food processor or blender. During this process, the salt dissolves the muscle proteins, which helps to suspend the fat molecules. Temperature is an important part of the process: if the temperature rises above 60 °F (16 °C) for pork or 70 °F (21 °C) for beef, the emulsion will not hold and fat will leak from the sausage during the cooking process. Pâté, terrine, galantine, roulade Pâté and terrines are often cooked in a pastry crust or an earthenware container. Both the earthenware container and the dish itself are called a terrine. Pâté and terrine are very similar; the term pâté often suggests a finer-textured forcemeat using liver, whereas terrines are more often made of a coarser forcemeat. The meat is chopped or ground, along with heavy seasoning, which may include fat and aromatics. The seasoning is important, as they will generally be served cold, which mutes the flavors. The mixture is placed into a lined mold, covered, and cooked in a water bath to control the temperature, which will keep the forcemeat from separating, as the water bath slows the heating process of the terrine. Pâté and terrine are generally cooked to 160 °F (71 °C), while terrine made of foie gras are generally cooked to an internal temperature of 120 °F (59 °C). After the proper temperature is reached, the terrine is removed from the oven and placed into a cooling unit topped with a weight to compact the contents of the terrine.
Salt serves four main purposes in the preservation of food in the charcuterie kitchen. The first is inducing osmosis: this process involves the movement of water outside of the membranes of the cells, which in turn reabsorb the salted water back into the cell. This process assists in the destruction of harmful pathogens. The second is dehydration, which means the salt pulls excess water from the protein, which aids in the shelf life of the protein, as there is less moisture present for bacterial growth. Fermentation is the third, in which salt assists in halting the fermentation process which would otherwise completely break the meat down. Finally, salt assists in denaturing proteins, which in essence means the structure of the proteins is effectively shifted, similar to the effects of cooking. Before the discovery of nitrates and nitrites by German chemists around 1900, curing was done with unrefined salt and saltpeter. As saltpeter gives inconsistent results in preventing bacterial growth, nitrate and nitrite (in the forms of sodium nitrite and sodium nitrate) have increased in popularity for their consistent results. Nitrates take a considerably longer period of time to break down in cured foods than nitrites. Because of this, nitrates are the preferred curing salts for lengthy curing and drying periods. Nitrites are often used in foods that require a shorter curing time and are used for any item that will be fully cooked. Eventually, a portion of the nitrates will be converted into nitrites by bacterial action. Nitrite has multiple purposes in the curing process. One purpose is flavor, the nitrites giving a sharp, piquant flavor to the meat. Second, the nitrites react with substances in the meat to produce nitric oxide. Nitric oxide prevents iron from breaking down the fat in the meat, thus halting rancidity. The binding also creates the characteristic reddish color found in most cured meat. Finally, the nitrite inhibits the growth of botulism-causing organisms that would ordinarily thrive in the oxygen-deprived environment in the sausage casing. German scientists originally named botulism poisoning Wurstvergiftung ('sausage poisoning'). The term botulism derives its name from the Latin term for "sausage". Eating cured and processed meat products has been linked to a small increase in gastric cancer, as well as chronic obstructive pulmonary disease and colorectal cancer. The negative effects are presumed to be caused by nitrates and nitrites, as well as nitrosamines which are formed by nitrites reacting with meat.
Charcuterie board Lunch meat, also known as cold cuts – Precooked or cured meats that are sliced and served cold or hot List of dried foods List of smoked foods Salumi – Italian cured meat products usually made from pork Smallgoods – Culinary traditions of AustraliaPages displaying short descriptions of redirect targets Food preservation Fermentation in food processing Pickling Brining Curing (food preservation) Smoking (cooking) Food drying Jambon sec des Ardennes Embutido Notes References The Culinary Institute of America. Garde Manger: The Art and Craft of the Cold Kitchen. 3rd ed. Hoboken, NJ: John Wiley & Sons, 2008. ISBN 978-0-470-05590-8. McGee, Harold. On Food and Cooking: The Science and Lore of the Kitchen. New York: Simon and Schuster, 2004. ISBN 0-684-80001-2. Ruhlman, Michael and Polcyn, Brian. Charcuterie: The Craft of Salting, Smoking and Curing. New York: W. W. Norton & Company, 2008.
Restaurant
Q11707 EXACT TITLE 0.840
QID OVERLAP: Q11707 in food (tier:evergreen) and basque_culture (tier:evergreen). | SHARED TOKENS (7): "business", "family", "food", "restaurant", "restaurants", "serves", "single". | EXACT TITLE in food: "Restaurant". | EXACT TITLE in basque_culture: "Restaurant".
businessfamilyfoodrestaurantrestaurantsservessingle
A restaurant is a business that prepares and serves food and beverages to customers. Meals are generally served and eaten on the premises, but many restaurants also offer take-out and food delivery services.
A public eating-establishment similar to a restaurant is mentioned in a 512 BC record from Ancient Egypt. It served only one dish, a plate of cereal, wildfowl, and onions. A forerunner for the modern restaurant is the thermopolium, an establishment in Ancient Greece or Ancient Rome that sold and served ready-to-eat food and beverages. These establishments were somewhat similar in function to modern fast-food restaurants. They were most often frequented by people who lacked private kitchens. In the Roman Empire, they were popular among residents of insulae. In Pompeii, 158 thermopolia with service-counters have been identified throughout the town. They were concentrated along the main axis of the town and near public spaces where they were frequented by the locals. The Romans also had the popina, a wine bar which in addition to a variety of wines offered a limited selection of simple foods such as olives, bread, cheese, stews, sausage, and porridge. The popinae were known as places for the plebeians of the lower classes of Roman society to socialize. While some were confined to one standing room only, others had tables and stools and a few even had couches. Another early forerunner of the restaurant was the inn. Throughout the ancient world, inns were set up alongside roads to cater to people travelling between cities, offering lodging and food. Meals were typically served at a common table to guests. However, there were no menus or options to choose from. Early eating establishments recognizable as restaurants in the modern sense emerged in Song dynasty China during the 11th and 12th centuries. In large cities, such as Kaifeng and Hangzhou, food catering establishments catered to merchants who travelled between cities. Probably growing out of tea houses and taverns which catered to travellers, Kaifeng's restaurants blossomed into an industry that catered to locals as well as people from other regions of China. As travelling merchants were not used to the local cuisine of other cities, these establishments were set up to serve dishes familiar to merchants from other parts of China. Such establishments were located in the entertainment districts of major cities, alongside hotels, bars, and brothels. The larger and more opulent of these establishments offered a dining experience similar to modern restaurant culture. According to a Chinese manuscript from 1126, patrons of one such establishment were greeted with a selection of pre-plated demonstration dishes which represented food options. Customers had their orders taken by a team of waiters who would then sing their orders to the kitchen and distribute the dishes in the exact order in which they had been ordered. There is a direct correlation between the growth of the restaurant businesses and institutions of theatrical stage drama, gambling and prostitution which served the burgeoning merchant middle class during the Song dynasty. Restaurants catered to different styles of cuisine, price brackets, and religious requirements. Even within a single restaurant choices were available, and people ordered the entrée from written menus.
38,797 full-service restaurants 34,629 limited-service restaurants 741 contract and social caterers 6,749 drinking places Fully 63% of restaurants in Canada are independent brands. Chain restaurants account for the remaining 37%, and many of these are locally owned and operated franchises. European Union The EU-27 has an estimated 1.6 million businesses involved in 'accommodation & food services', more than 75% of which are small and medium enterprises. India The Indian restaurant industry is highly fragmented with more than 1.5 million outlets of which only around 3,000 of them are from the organised segment.
Pincho
Q1452513 QID OVERLAP 0.700
QID OVERLAP: Q1452513 in food (tier:branch) and basque_culture (tier:branch). | SHARED TOKENS (10): "bars", "basque", "country", "culture", "food", "local", "related", "small", "them", "traditional".
barsbasquecountryculturefoodlocalrelatedsmallthemtraditional
A pincho (Spanish: [ˈpintʃo]; literally "thorn" or "spike"), pintxo (Basque: [pintʃo]) or pinchu (Asturian: [ˈpintʃʊ]) is a small snack, typically eaten in bars or taverns. They are traditional in northern Spain and especially popular in the Basque country, Navarre, La Rioja, Cantabria, and Asturias. Pinchos are usually eaten in the company of friends or relatives; thus, they have a strong socializing component, and, in the Basque country and Navarre, they are usually regarded as a cornerstone of local culture and society. They are related to tapas, the main difference being that pinchos are usually 'spiked' with a skewer or toothpick, often to a piece of bread. They are served in individual portions and always ordered and paid for independently from the drinks. It is not impossible, however, for the same item to be called pincho in one place and tapa in another. They are called pinchos because many of them have a pincho (Spanish for spike), typically a toothpick —or a skewer for the larger varieties— through them.
opular in the Basque country, Navarre, La Rioja, Cantabria, and Asturias. Pinchos are usually eaten in the company of friends or relatives; thus, they have a strong socializing component, and, in the Basque country and Navarre, they are usually regarded as a cornerstone of local culture and society. They are related to tapas, the main difference being that pinchos are usually 'spiked' with a skewer or toothpick, often to a piece of bread. They are served in individual portions and always ordered and paid for independently from the drinks. It is not impossible, however, for the same item to be called pincho in one place and tapa in another. They are called pinchos because many of them have a pincho (Spanish for spike), typically a toothpick —or a skewer for the larger varieties— through them.
brochetas in Spanish) which, in Latin America and some parts of Spain, are called pinchos too (see pinchitos); in brochettes, the skewer or toothpick is needed to cook the food or keep it together. Basque pintxo A typical snack of the Basque Country and Navarre, "pinchos" consist of small slices of bread upon which an ingredient or mixture of ingredients is placed and fastened with a toothpick, which gives the food its name "pincho," meaning "spike." Pinchos are usually eaten as an appetizer, accompanied by a small glass of young white wine (called txakoli, pronounced [tʃakoˈli]) or beer (zurito, pronounced [s̻uˈɾito] quarter of a pint).
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in food (tier:branch) and basque_culture (tier:branch). | SHARED TOKENS (10): "boise", "capital", "district", "idaho", "largest", "local", "northwest", "population", "private", "second".
boisecapitaldistrictidaholargestlocalnorthwestpopulationprivatesecond
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in food (tier:branch) and basque_culture (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "largest", "population".
boisecaldwellcanyonidaholargestpopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Liquor license
Q3431927 QID OVERLAP 0.520
QID OVERLAP: Q3431927 in food (tier:branch) and basque_culture (tier:branch). | SHARED TOKENS (2): "businesses", "liquor".
businessesliquor
A liquor license (or liquor licence in most forms of Commonwealth English) is a governmentally issued permit for businesses to sell, manufacture, store, or otherwise use alcoholic beverages. Canada In Canada, liquor licenses are issued by the legal authority of each province to allow an individual or business to manufacture or sell alcoholic beverages. Usually several types of liquor licenses are available to apply for within each certain province. There are many regulations which apply to all types of liquor licenses. For example, each license must indicate the time, place and the maximum amount of sale. These licenses also apply to special events, which may occur outside of the normal setting in which alcohol is served. License holders must strictly follow all the terms and rules to avoid suspension, fines for non-compliance or revocation. Most provinces also specify identification regulations in determining eligibility of patrons.
Sale permit: These permits last for 12 hours and are authorized for charitable, educational, religious or community service functions. Prices for the alcoholic beverages served are set by the permit holder. Non-sale permit: These permits are used to authorize the serving of alcohol at functions outside a private dwelling, including weddings, staff parties, or reunions. Alcoholic beverages are not allowed to be sold with this permit. Cost-recovery permit: These permits are issued to private individuals for private functions such as weddings and reunions that are not eligible for a regular sale permit. Alcoholic beverages can be sold with this permit, but the price is limited to $2 per drink or the cost of the beverage (whichever is greater).
Tavern license: Issued primarily for the purpose of selling alcohol in public establishments including bars, pubs, restaurants and nightclubs. Special-use license: Issued for restaurants that do not primarily focus on alcoholic beverages but are served on special occasions. Manufacturer license: Issued to authorize applicants with establishments primarily based on the manufacturing of alcoholic beverages. Europe Finland In Finland, a liquor license from the Regional State Administrative Agency (Aluehallintavirasto) is needed for businesses manufacturing, serving or importing alcohol. Licenses are usually non-limited but licenses for limited periods also exist. A liquor license can be granted to any mature natural or legal person who has not been declared bankrupt. Persons applying for a license also need to be able to support themselves financially and be generally trustworthy. There also separate rules for the premises alcohol is served in. Liquor licenses are not transferable. Before 2018 Finnish liquor licenses were divided into classes A, B and C. A class A license allowed serving alcohol up to 80% per volume, a B class license up to 22% volume and a C class license only fermented beverages up to 4.7% per volume. In 2020, the typical cost for a liquor license in Finland was 450 to 650 euro.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
196 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP196 edges
🌿 BRANCH132 edges
0.530
awardbeardbusinesscaldwellidahojamesregionalrestaurantrestaurants
SHARED TOKENS (9): "award", "beard", "business", "caldwell", "idaho", "james", "regional", "restaurant", "restaurants". | URL->A (1): https://www.amanorestaurante.com/. | EXACT TITLE in food: "Amano (restaurant)".
0.500
centercommercialdevelopmentdistrictheritagehistoriclegalreceiveregionrelatedseparatesettingsmallstatussupplythroughouturban
SHARED TOKENS (17): "center", "commercial", "development", "district", "heritage", "historic", "legal", "receive", "region", "related", "separate", "setting", "small", "status", "supply", "throughout", "urban". | EXACT TITLE in basque_culture: "Historic district".
0.500
Diaspora ↗ EXACT TITLE
communitycontemporaryculturaleducationgeographicgrouphostlargestmovementmultipleoriginoutsidepeoplepopulationrecentregionsshapedsinglesocialtoday
SHARED TOKENS (20): "community", "contemporary", "cultural", "education", "geographic", "group", "host", "largest", "movement", "multiple", "origin", "outside", "people", "population", "recent", "regions", "shaped", "single", "social", "today". | EXACT TITLE in basque_culture: "Diaspora".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagriculturearoundboisecapitalcountrydeathdistinctearlygeographicidahojulylargestminingnationalnevadanorthnorthwestoregonpeople
SHARED TOKENS (32): "agricultural", "agriculture", "around", "boise", "capital", "country", "death", "distinct", "early", "geographic", "idaho", "july", "largest", "mining", "national", "nevada", "north", "northwest", "oregon", "people".... | EXACT TITLE in food: "Idaho". | EXACT TITLE in basque_culture: "Idaho".
0.500
becomecenturiescountrycuisineculinaryfoodfrenchhousemenunorthrestaurantrestaurantssanseasonalsinglesmallvalley
SHARED TOKENS (17): "become", "centuries", "country", "cuisine", "culinary", "food", "french", "house", "menu", "north", "restaurant", "restaurants", "san", "seasonal", "single", "small", "valley". | EXACT TITLE in food: "Tasting menu".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialcookingeventfoodfoodsgroupmenumodelprivatepubrestaurantrestaurantssafetyservesservingsettingspecific
SHARED TOKENS (18): "business", "commercial", "cooking", "event", "food", "foods", "group", "menu", "model", "private", "pub", "restaurant", "restaurants", "safety", "serves", "serving", "setting", "specific". | EXACT TITLE in basque_culture: "Catering".
0.500
becomecorporationsdrawshistoryinternationallatelegalmajornorthorganizationspolicyprominentpublicrelationshipssciencesecondshapedsystemwesternworld
SHARED TOKENS (20): "become", "corporations", "draws", "history", "international", "late", "legal", "major", "north", "organizations", "policy", "prominent", "public", "relationships", "science", "second", "shaped", "system", "western", "world". | EXACT TITLE in basque_culture: "International relations".
0.500
associationbuildingbusinesschaincorporatecorporationsdatadepartmentemployeeemployeesenvironmentalfoodsformfounderheldnationaloperatingownershipplanplanning
SHARED TOKENS (25): "association", "building", "business", "chain", "corporate", "corporations", "data", "department", "employee", "employees", "environmental", "foods", "form", "founder", "held", "national", "operating", "ownership", "plan", "planning".... | EXACT TITLE in food: "Employee stock ownership plan".
0.500
Archive ↗ Q166118 EXACT TITLE
collectionscommercialcourseculturaldistinctfacilityfunctionhistorylegallong-termorganizationpermanentproductprofessionalregularsciencesocial
SHARED TOKENS (17): "collections", "commercial", "course", "cultural", "distinct", "facility", "function", "history", "legal", "long-term", "organization", "permanent", "product", "professional", "regular", "science", "social". | EXACT TITLE in basque_culture: "Archive".
0.500
culturalculturedescribeddrawseventshistorichistoryidentitymediamuseumnaturalpeoplerelationshipssciencesocialspecific
SHARED TOKENS (16): "cultural", "culture", "described", "draws", "events", "historic", "history", "identity", "media", "museum", "natural", "people", "relationships", "science", "social", "specific". | EXACT TITLE in basque_culture: "Material culture".
0.500
activityalcoholamericanboisebureaucenterearlyentirelyidahonearlynorthnorthwestranchregionsecondvalleywine
SHARED TOKENS (17): "activity", "alcohol", "american", "boise", "bureau", "center", "early", "entirely", "idaho", "nearly", "north", "northwest", "ranch", "region", "second", "valley", "wine". | EXACT TITLE in food: "Eagle Foothills AVA".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbillionbusinesscommercialcountrydevelopmentenvironmentalfocusglobalinternationallimitedlocalmarketsorganizationorganizationsoutsidepeoplesecondsignificant
SHARED TOKENS (24): "activity", "beyond", "billion", "business", "commercial", "country", "development", "environmental", "focus", "global", "international", "limited", "local", "markets", "organization", "organizations", "outside", "people", "second", "significant".... | EXACT TITLE in food: "Tourism". | EXACT TITLE in basque_culture: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
americanannualbecomebusinessbusinessescomdirectoryemployeesformerfoundedmobileoperatespublicrevenuesalessansitesystemtablethroughout
SHARED TOKENS (21): "american", "annual", "become", "business", "businesses", "com", "directory", "employees", "former", "founded", "mobile", "operates", "public", "revenue", "sales", "san", "site", "system", "table", "throughout".... | EXACT TITLE in food: "Yelp".
0.500
agriculturalagriculturearoundcommercialconstructioncookingcoveredculturalculturecurrentdifferentdiningeventsexperiencefocusfoodformhealthhistoryimmigrant
SHARED TOKENS (36): "agricultural", "agriculture", "around", "commercial", "construction", "cooking", "covered", "cultural", "culture", "current", "different", "dining", "events", "experience", "focus", "food", "form", "health", "history", "immigrant".... | EXACT TITLE in food: "Food journalism".
0.500
WinCo Foods ↗ EXACT TITLE
americanboisecaliforniachaincomemployeesfoodfoodsfoundedheldidaholargestnevadaoperatedoregonretail
SHARED TOKENS (16): "american", "boise", "california", "chain", "com", "employees", "food", "foods", "founded", "held", "idaho", "largest", "nevada", "operated", "oregon", "retail". | EXACT TITLE in food: "WinCo Foods".
0.500
Metadata ↗ Q180160 EXACT TITLE
collectionscontextculturedatadifferentexperiencegivinggovernmenthistoryhtmlmuseumnationalorganizationspagepagessciencestructuretrafficwork
SHARED TOKENS (19): "collections", "context", "culture", "data", "different", "experience", "giving", "government", "history", "html", "museum", "national", "organizations", "page", "pages", "science", "structure", "traffic", "work". | EXACT TITLE in basque_culture: "Metadata".
0.500
Instacart ↗ Q22909236 EXACT TITLE
alcoholamericanbillionbusinessconsumerfoodfoundinggoodsmediamobilenearlynorthoperatesregionsretailsan
SHARED TOKENS (16): "alcohol", "american", "billion", "business", "consumer", "food", "founding", "goods", "media", "mobile", "nearly", "north", "operates", "regions", "retail", "san". | EXACT TITLE in food: "Instacart".
0.500
communityconnectedcontemporaryculturalculturedevelopmentenvironmentalfocusformheritagehistorylocalnaturalregionsignificantspecificspecificallythemtourismtraditions
SHARED TOKENS (20): "community", "connected", "contemporary", "cultural", "culture", "development", "environmental", "focus", "form", "heritage", "history", "local", "natural", "region", "significant", "specific", "specifically", "them", "tourism", "traditions". | EXACT TITLE in basque_culture: "Heritage tourism".
0.500
adjacentbasquecenturiescountryculturalcurrentdifferentearlyeducationformfrenchgovernmenthistoricintroducedlatemediaoriginpeoplepublicregion
SHARED TOKENS (25): "adjacent", "basque", "centuries", "country", "cultural", "current", "different", "early", "education", "form", "french", "government", "historic", "introduced", "late", "media", "origin", "people", "public", "region".... | EXACT TITLE in basque_culture: "Basque language".
0.500
Hotel ↗ Q27686 EXACT TITLE
additionalboutiquebusinesscenterculturedepartmentdepartmentsdestinationdirectearlyeventfacilityfoodformfunctionhospitalityhotelindependentkitchenlarge
SHARED TOKENS (40): "additional", "boutique", "business", "center", "culture", "department", "departments", "destination", "direct", "early", "event", "facility", "food", "form", "function", "hospitality", "hotel", "independent", "kitchen", "large".... | EXACT TITLE in food: "Hotel". | EXACT TITLE in basque_culture: "Hotel".
0.500
Ranch ↗ Q509028 EXACT TITLE
additionalamericanbureaufarminglargelimitednearlyoperateoperationspeopleprivateranchranchingrecentsheepthoughwestwestern
SHARED TOKENS (18): "additional", "american", "bureau", "farming", "large", "limited", "nearly", "operate", "operations", "people", "private", "ranch", "ranching", "recent", "sheep", "though", "west", "western". | EXACT TITLE in food: "Ranch". | EXACT TITLE in basque_culture: "Ranch".
0.500
Malbec ↗ Q1414045 EXACT TITLE
differententirelyfrenchproduceproducedratherregionregionssystemthoughthroughouttraditionalvalleywestwine
SHARED TOKENS (15): "different", "entirely", "french", "produce", "produced", "rather", "region", "regions", "system", "though", "throughout", "traditional", "valley", "west", "wine". | EXACT TITLE in food: "Malbec".
0.500
americanannualannuallyaroundcapitalcentercookingculturalculturedifferentethniceventfestivalfoodsheldheritagehostedinternationaljulylargest
SHARED TOKENS (30): "american", "annual", "annually", "around", "capital", "center", "cooking", "cultural", "culture", "different", "ethnic", "event", "festival", "foods", "held", "heritage", "hosted", "international", "july", "largest".... | EXACT TITLE in basque_culture: "Smithsonian Folklife Festival".
0.500
Bilbao ↗ Q8692 EXACT TITLE
activityadjacentannualbasquecapitalclubcommercialcommunitycountrydevelopmentfamilyfoundationhistoryinfrastructureinternationaljanuarylargestlatemuseumpopulation
SHARED TOKENS (30): "activity", "adjacent", "annual", "basque", "capital", "club", "commercial", "community", "country", "development", "family", "foundation", "history", "infrastructure", "international", "january", "largest", "late", "museum", "population".... | EXACT TITLE in basque_culture: "Bilbao".
0.500
Costco ↗ EXACT TITLE
americanaugustbrandbusinessbusinessescaliforniachainclubcorporatecorporationsformerfoundedhistoryhouselargestmembersmodelnorthopenedoperates
SHARED TOKENS (31): "american", "august", "brand", "business", "businesses", "california", "chain", "club", "corporate", "corporations", "former", "founded", "history", "house", "largest", "members", "model", "north", "opened", "operates".... | EXACT TITLE in food: "Costco".
0.500
Chobani ↗ Q5103456 EXACT TITLE
americanbrandemployeesfacilityfoodfoundedgivinglargestmarketoperatesownershipproducesproductssharetraditionalworld
SHARED TOKENS (16): "american", "brand", "employees", "facility", "food", "founded", "giving", "largest", "market", "operates", "ownership", "produces", "products", "share", "traditional", "world". | EXACT TITLE in food: "Chobani".
0.500
Livestock ↗ Q103459 EXACT TITLE
agriculturalagriculturecommercialculturaldiversifiedfarminggoodshealthmajormodernplayproduceproductspublicsettingsheepwelfare
SHARED TOKENS (17): "agricultural", "agriculture", "commercial", "cultural", "diversified", "farming", "goods", "health", "major", "modern", "play", "produce", "products", "public", "setting", "sheep", "welfare". | EXACT TITLE in basque_culture: "Livestock".
0.500
Food truck ↗ Q3303463 EXACT TITLE
becomebillioncommercialculturalfoodfrenchfusionglobalkitchenlargemajormobileoperationpeopleregionalrestaurantstreetthoughworkers
SHARED TOKENS (19): "become", "billion", "commercial", "cultural", "food", "french", "fusion", "global", "kitchen", "large", "major", "mobile", "operation", "people", "regional", "restaurant", "street", "though", "workers". | EXACT TITLE in food: "Food truck".
0.500
activityboisebusinesseducationfoundedhealthidahoindependentinstitutionmemberprogrampublicresearchschoolwest
SHARED TOKENS (15): "activity", "boise", "business", "education", "founded", "health", "idaho", "independent", "institution", "member", "program", "public", "research", "school", "west". | EXACT TITLE in basque_culture: "Boise State University".
0.500
Supermarket ↗ Q180846 EXACT TITLE
alcoholamericanaroundbakedchaindepartmenteateryfacilityfinancialfoodfoodsgoodslargelimitedmobilenearprocessingproduceproductsregions
SHARED TOKENS (32): "alcohol", "american", "around", "baked", "chain", "department", "eatery", "facility", "financial", "food", "foods", "goods", "large", "limited", "mobile", "near", "processing", "produce", "products", "regions".... | EXACT TITLE in food: "Supermarket".
0.500
Local food ↗ Q2674120 EXACT TITLE
chaincommunityconsumerdifferentexplicitlyfarmingfoodgeographicglobalhealthlocalmodelproducedproducersproximityregionrelatedrepresentssocialstructure
SHARED TOKENS (23): "chain", "community", "consumer", "different", "explicitly", "farming", "food", "geographic", "global", "health", "local", "model", "produced", "producers", "proximity", "region", "related", "represents", "social", "structure".... | EXACT TITLE in food: "Local food".
0.500
Albertsons ↗ Q2831861 EXACT TITLE
albertsonsamericanbillionblockboisecapitalchaincorporatecorporationsdifferentearlyemployeesformerfoundedidahojanuarylargestnorthregionalrevenue
SHARED TOKENS (22): "albertsons", "american", "billion", "block", "boise", "capital", "chain", "corporate", "corporations", "different", "early", "employees", "former", "founded", "idaho", "january", "largest", "north", "regional", "revenue".... | EXACT TITLE in food: "Albertsons". | EXACT TITLE in basque_culture: "Albertsons".
0.500
Museum ↗ Q33506 EXACT TITLE
annuallycollectionscountryexhibitionsfocusheritagehistoryhostinstitutionlargelocalmuseumnaturaloutsideprivatepublicsciencesignificantvisitorsworld
SHARED TOKENS (20): "annually", "collections", "country", "exhibitions", "focus", "heritage", "history", "host", "institution", "large", "local", "museum", "natural", "outside", "private", "public", "science", "significant", "visitors", "world". | EXACT TITLE in food: "Museum". | EXACT TITLE in basque_culture: "Museum".
0.500
cuisineculinaryculturalculturediversityethniceventsfoodfoodslocallynorthregionaltraditionaltraditionsworld
SHARED TOKENS (15): "cuisine", "culinary", "cultural", "culture", "diversity", "ethnic", "events", "food", "foods", "locally", "north", "regional", "traditional", "traditions", "world". | EXACT TITLE in food: "Indian cuisine".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagriculturedirectlydistributedenvironmentalformfulllandscapeminingnaturalnetworkoperationoperationsoutsideproductionsmallsocialsystemtableworld
SHARED TOKENS (20): "agricultural", "agriculture", "directly", "distributed", "environmental", "form", "full", "landscape", "mining", "natural", "network", "operation", "operations", "outside", "production", "small", "social", "system", "table", "world". | EXACT TITLE in basque_culture: "Irrigation".
0.500
alcoholbecomedirectlyformgovernmentindependentmakersoperatedoperatingprivateproducersproductsratherstructuresystemwholesalewine
SHARED TOKENS (17): "alcohol", "become", "directly", "form", "government", "independent", "makers", "operated", "operating", "private", "producers", "products", "rather", "structure", "system", "wholesale", "wine". | EXACT TITLE in food: "Three-tier system (alcohol distribution)".
0.500
Pamplona ↗ Q10282 EXACT TITLE
annuallybasquecapitalclubcommunityearlyfestivalformfoundationheldjulylargestlatenearpopulationsanservingtraditional
SHARED TOKENS (18): "annually", "basque", "capital", "club", "community", "early", "festival", "form", "foundation", "held", "july", "largest", "late", "near", "population", "san", "serving", "traditional". | EXACT TITLE in basque_culture: "Pamplona".
0.500
activitycapitalchaincountryculturaldevelopmentethnicgeographicgovernmenthostidentityimmigrantinstitutionslargelong-termmarketmemberspeoplesharesocial
SHARED TOKENS (22): "activity", "capital", "chain", "country", "cultural", "development", "ethnic", "geographic", "government", "host", "identity", "immigrant", "institutions", "large", "long-term", "market", "members", "people", "share", "social".... | EXACT TITLE in basque_culture: "Ethnic enclave".
0.500
businesscommunityentityinstitutionlocalmissionnonprofitnonprofitsoperatedoperatesoperationsorganizationorganizationsprivateprogrampublicratherreceiverevenuesocial
SHARED TOKENS (21): "business", "community", "entity", "institution", "local", "mission", "nonprofit", "nonprofits", "operated", "operates", "operations", "organization", "organizations", "private", "program", "public", "rather", "receive", "revenue", "social".... | EXACT TITLE in basque_culture: "Nonprofit organization".
0.500
agriculturedirectfamilyfoodformlocallocallymarketmodelmovementoriginranchrestaurantrestaurantssafetysalesschoolservingsmallsocial
SHARED TOKENS (21): "agriculture", "direct", "family", "food", "form", "local", "locally", "market", "model", "movement", "origin", "ranch", "restaurant", "restaurants", "safety", "sales", "school", "serving", "small", "social".... | EXACT TITLE in food: "Farm-to-table".
0.500
advancedbecomeculturaldesignearlyexperiencefeesgovernmentlandscapelegallimitedopenownershipprivatepublicrightssocialspaceurbanvisible
SHARED TOKENS (20): "advanced", "become", "cultural", "design", "early", "experience", "fees", "government", "landscape", "legal", "limited", "open", "ownership", "private", "public", "rights", "social", "space", "urban", "visible". | EXACT TITLE in basque_culture: "Public space".
0.500
DoorDash ↗ Q20714323 EXACT TITLE
americancategorydatafoodfoundedheldlargestlistingmarketoperatesoperatingplatformrestaurantssellingshareworkers
SHARED TOKENS (16): "american", "category", "data", "food", "founded", "held", "largest", "listing", "market", "operates", "operating", "platform", "restaurants", "selling", "share", "workers". | EXACT TITLE in food: "DoorDash".
0.480
americancaliforniafamilyfoundedidaholocalmarketnevadaoperatedoregonproductproductsretailretailer
SHARED TOKENS (14): "american", "california", "family", "founded", "idaho", "local", "market", "nevada", "operated", "oregon", "product", "products", "retail", "retailer". | EXACT TITLE in food: "Grocery Outlet".
0.480
Uber Eats ↗ Q21462723 EXACT TITLE
americanaugustbillionbrandcomfeesfoodglobalindependentlargestoperateoperationsplatformwestern
SHARED TOKENS (14): "american", "august", "billion", "brand", "com", "fees", "food", "global", "independent", "largest", "operate", "operations", "platform", "western". | EXACT TITLE in food: "Uber Eats".
0.480
basquecommunitycountrycourtculturalculturefrenchgovernmenthistoricpeopleregionschooltraditionswestern
SHARED TOKENS (14): "basque", "community", "country", "court", "cultural", "culture", "french", "government", "historic", "people", "region", "school", "traditions", "western". | EXACT TITLE in food: "Basque Country (greater region)". | EXACT TITLE in basque_culture: "Basque Country (greater region)".
0.480
Espresso ↗ Q180289 EXACT TITLE
becomebeyondculturalcultureformgivingmovementproducedproductionprofileregularservesservingsmall
SHARED TOKENS (14): "become", "beyond", "cultural", "culture", "form", "giving", "movement", "produced", "production", "profile", "regular", "serves", "serving", "small". | EXACT TITLE in food: "Espresso".
0.480
augustboisebuildingcapacitycurrentdowntowngivingidahoopenedpermanentprofessionalrightsstreetwestern
SHARED TOKENS (14): "august", "boise", "building", "capacity", "current", "downtown", "giving", "idaho", "opened", "permanent", "professional", "rights", "street", "western". | EXACT TITLE in basque_culture: "Idaho Central Arena".
0.480
Potato ↗ Q10998 EXACT TITLE
becomecenturiesdifferentfamilyfoodintroducedoriginproduceproductionregionsecondsinglesupplyworld
SHARED TOKENS (14): "become", "centuries", "different", "family", "food", "introduced", "origin", "produce", "production", "region", "second", "single", "supply", "world". | EXACT TITLE in food: "Potato".
0.460
activitybecomegovernmenthistorichistorylatemediamuseumoutsidepeoplepublicrelatedscience
SHARED TOKENS (13): "activity", "become", "government", "historic", "history", "late", "media", "museum", "outside", "people", "public", "related", "science". | EXACT TITLE in basque_culture: "Public history".
0.460
basquecapitalcommunitycountryculturedestinationeventsfestivalinternationalpopulationsansmalltourism
SHARED TOKENS (13): "basque", "capital", "community", "country", "culture", "destination", "events", "festival", "international", "population", "san", "small", "tourism". | EXACT TITLE in basque_culture: "San Sebastián".
0.460
Food & Wine ↗ EXACT TITLE
americanannuallycookingdiningeventfoodfoundedheldpeoplepublicrestaurantseasonalwine
SHARED TOKENS (13): "american", "annually", "cooking", "dining", "event", "food", "founded", "held", "people", "public", "restaurant", "seasonal", "wine". | EXACT TITLE in food: "Food & Wine".
0.460
agriculturalagriculturecookingdifferentenvironmentalfoodfoodsformimportantplayprocessingproductproducts
SHARED TOKENS (13): "agricultural", "agriculture", "cooking", "different", "environmental", "food", "foods", "form", "important", "play", "processing", "product", "products". | EXACT TITLE in food: "Food processing". | EXACT TITLE in basque_culture: "Food processing".
0.460
Paella ↗ Q212121 EXACT TITLE
adjacentaroundcommunitycuisineformfrenchlocalmodernopenpaellarestaurantthroughouttraditional
SHARED TOKENS (13): "adjacent", "around", "community", "cuisine", "form", "french", "local", "modern", "open", "paella", "restaurant", "throughout", "traditional". | EXACT TITLE in food: "Paella". | EXACT TITLE in basque_culture: "Paella".
0.460
Trikiti ↗ Q1999898 EXACT TITLE
basquecountryexpandinginternationalintroducedlatelocalmodernmusicseparatestandardtraditionalworkers
SHARED TOKENS (13): "basque", "country", "expanding", "international", "introduced", "late", "local", "modern", "music", "separate", "standard", "traditional", "workers". | EXACT TITLE in basque_culture: "Trikiti".
0.460
Accordion ↗ Q79838 EXACT TITLE
actsamericanblockdepartmentsexpandingfamilymusicnorthopenproduceregionsrelatedworld
SHARED TOKENS (13): "acts", "american", "block", "departments", "expanding", "family", "music", "north", "open", "produce", "regions", "related", "world". | EXACT TITLE in basque_culture: "Accordion".
0.440
businesscenturieserafocusformgovernmentlifelong-termphilanthropyprivatepublicrather
SHARED TOKENS (12): "business", "centuries", "era", "focus", "form", "government", "life", "long-term", "philanthropy", "private", "public", "rather". | EXACT TITLE in food: "Philanthropy". | EXACT TITLE in basque_culture: "Philanthropy".
0.440
datadifferenteventsformhistoryimportantlargelifepeopleprofessionaltraditionalwork
SHARED TOKENS (12): "data", "different", "events", "form", "history", "important", "large", "life", "people", "professional", "traditional", "work". | EXACT TITLE in basque_culture: "Oral history".
0.440
aroundcountryculinaryculturaldestinationexperienceheritagemusicproductsregiontourismtraditions
SHARED TOKENS (12): "around", "country", "culinary", "cultural", "destination", "experience", "heritage", "music", "products", "region", "tourism", "traditions". | EXACT TITLE in basque_culture: "Cultural tourism".
0.440
alcoholamericanboisebureaucanyondepartmentidahooregonproducersproductionvalleywine
SHARED TOKENS (12): "alcohol", "american", "boise", "bureau", "canyon", "department", "idaho", "oregon", "producers", "production", "valley", "wine". | EXACT TITLE in food: "Snake River Valley AVA".
0.420
Birria ↗ Q4916959 EXACT TITLE
arounddistinctformpeopleregionalrestaurantsstreettechniquesthroughouttodaywestern
SHARED TOKENS (11): "around", "distinct", "form", "people", "regional", "restaurants", "street", "techniques", "throughout", "today", "western". | EXACT TITLE in food: "Birria".
0.420
Farmworker ↗ Q5060555 EXACT TITLE
agriculturalagriculturecontextenvironmentalhealthproductionrelatedrightstechnologyvalleywork
SHARED TOKENS (11): "agricultural", "agriculture", "context", "environmental", "health", "production", "related", "rights", "technology", "valley", "work". | EXACT TITLE in food: "Farmworker".
0.420
becomecitiesfeesfoodhealthindependentmobilerestaurantrestaurantssupplierwholesale
SHARED TOKENS (11): "become", "cities", "fees", "food", "health", "independent", "mobile", "restaurant", "restaurants", "supplier", "wholesale". | EXACT TITLE in food: "Food delivery".
0.420
Genealogy ↗ Q47307 EXACT TITLE
additionalcommunityfamilyhistorylegalmembersnextresearchshapedtraditionswork
SHARED TOKENS (11): "additional", "community", "family", "history", "legal", "members", "next", "research", "shaped", "traditions", "work". | EXACT TITLE in basque_culture: "Genealogy".
0.420
Riesling ↗ Q456471 EXACT TITLE
californiadevelopmentfrenchoriginregionregionssignificantvalleywesternwineworld
SHARED TOKENS (11): "california", "development", "french", "origin", "region", "regions", "significant", "valley", "western", "wine", "world". | EXACT TITLE in food: "Riesling".
0.420
chaincountrydestinationimmigrantmakesmovementpeoplepolicyprogramrelationshipssocial
SHARED TOKENS (11): "chain", "country", "destination", "immigrant", "makes", "movement", "people", "policy", "program", "relationships", "social". | EXACT TITLE in basque_culture: "Chain migration".
0.400
differentdistincteducationfocushistorymodelresearchsciencesecondthroughout
SHARED TOKENS (10): "different", "distinct", "education", "focus", "history", "model", "research", "science", "second", "throughout". | EXACT TITLE in basque_culture: "Bilingual education".
0.400
Pandero ↗ Q4898607 EXACT TITLE
basquecountryfamilygroupheritagemusicregionsinglesmalltraditional
SHARED TOKENS (10): "basque", "country", "family", "group", "heritage", "music", "region", "single", "small", "traditional". | EXACT TITLE in basque_culture: "Pandero".
0.400
Syrah ↗ Q332720 EXACT TITLE
californiaproduceproducedprofileregionssinglethroughoutvalleywineworld
SHARED TOKENS (10): "california", "produce", "produced", "profile", "regions", "single", "throughout", "valley", "wine", "world". | EXACT TITLE in food: "Syrah".
0.400
americanaroundbarscitiesfoodhostednetworkpagerestaurantsroad
SHARED TOKENS (10): "american", "around", "bars", "cities", "food", "hosted", "network", "page", "restaurants", "road". | EXACT TITLE in food: "Diners, Drive-Ins and Dives".
0.400
americanboisefoodfrenchidaholargestprocessingproducersproductsworld
SHARED TOKENS (10): "american", "boise", "food", "french", "idaho", "largest", "processing", "producers", "products", "world". | EXACT TITLE in food: "Lamb Weston".
0.380
Mezcal ↗ Q726413 EXACT TITLE
americanearlyfamilyformlatememberoriginproductregions
SHARED TOKENS (9): "american", "early", "family", "form", "late", "member", "origin", "product", "regions". | EXACT TITLE in food: "Mezcal".
0.380
Tavern ↗ Q154250 EXACT TITLE
businessdifferenteateryfoodpeoplepubpublicreceivestandard
SHARED TOKENS (9): "business", "different", "eatery", "food", "people", "pub", "public", "receive", "standard". | EXACT TITLE in basque_culture: "Tavern".
0.380
Craft beer ↗ Q5487333 EXACT TITLE
beercenturiesemergedmovementproduceproductionpubtechniquestraditional
SHARED TOKENS (9): "beer", "centuries", "emerged", "movement", "produce", "production", "pub", "techniques", "traditional". | EXACT TITLE in food: "Craft beer".
0.380
buildingcentercommunityculturalcultureneighborhoodorganizationorganizationsprivate
SHARED TOKENS (9): "building", "center", "community", "cultural", "culture", "neighborhood", "organization", "organizations", "private". | EXACT TITLE in basque_culture: "Cultural center".
0.360
actsfoodformmajorprocessingproductionproductstraditional
SHARED TOKENS (8): "acts", "food", "form", "major", "processing", "production", "products", "traditional". | EXACT TITLE in food: "Nixtamalization".
0.360
basquecountryethnicoriginoutsidepeoplepopulationtraditional
SHARED TOKENS (8): "basque", "country", "ethnic", "origin", "outside", "people", "population", "traditional". | EXACT TITLE in basque_culture: "Basque diaspora".
0.360
bakedbarsfoodfrenchoriginregularrestaurantsthem
SHARED TOKENS (8): "baked", "bars", "food", "french", "origin", "regular", "restaurants", "them". | EXACT TITLE in food: "French fries".
0.360
Preschool ↗ Q1076052 EXACT TITLE
earlyeducationoperatedplaypublicpubliclyschoolspace
SHARED TOKENS (8): "early", "education", "operated", "play", "public", "publicly", "school", "space". | EXACT TITLE in basque_culture: "Preschool".
0.360
cuisineculinaryculturallocalregionregionssocialtraditions
SHARED TOKENS (8): "cuisine", "culinary", "cultural", "local", "region", "regions", "social", "traditions". | EXACT TITLE in food: "Eritrean cuisine".
0.360
boisebusinesscenterdistrictdowntownidaholargestnorth
SHARED TOKENS (8): "boise", "business", "center", "district", "downtown", "idaho", "largest", "north". | EXACT TITLE in food: "Downtown Boise". | EXACT TITLE in basque_culture: "Downtown Boise".
0.360
chainmodernnorthproducedrelatedstandardsupplythroughout
SHARED TOKENS (8): "chain", "modern", "north", "produced", "related", "standard", "supply", "throughout". | EXACT TITLE in food: "Specialty coffee".
0.360
buildculturalcultureimportantinstitutionsnationalpeoplepublic
SHARED TOKENS (8): "build", "cultural", "culture", "important", "institutions", "national", "people", "public". | EXACT TITLE in basque_culture: "Cultural diplomacy".
0.360
Cemetery ↗ Q39614 EXACT TITLE
culturalmemorialmodernparkpeoplespacespecificallywestern
SHARED TOKENS (8): "cultural", "memorial", "modern", "park", "people", "space", "specifically", "western". | EXACT TITLE in food: "Cemetery". | EXACT TITLE in basque_culture: "Cemetery".
0.360
Tempranillo ↗ Q519874 EXACT TITLE
earlierearlyproduceprofileregionregionsthroughoutwine
SHARED TOKENS (8): "earlier", "early", "produce", "profile", "region", "regions", "throughout", "wine". | EXACT TITLE in food: "Tempranillo".
0.340
Food code ↗ Q5465447 EXACT TITLE
codefoodinternationalnationalproductproductsregional
SHARED TOKENS (7): "code", "food", "international", "national", "product", "products", "regional". | EXACT TITLE in food: "Food code". | EXACT TITLE in basque_culture: "Food code".
0.340
centuriescitiesdevelopmentheritagehistoricproductsspecifically
SHARED TOKENS (7): "centuries", "cities", "development", "heritage", "historic", "products", "specifically". | EXACT TITLE in basque_culture: "Historic preservation".
0.340
Beer garden ↗ Q857909 EXACT TITLE
beercapitalfoodhalllocalpubrestaurant
SHARED TOKENS (7): "beer", "capital", "food", "hall", "local", "pub", "restaurant". | EXACT TITLE in food: "Beer garden".
0.340
blockentityorgorganizationorganizationsrecognitionresearch
SHARED TOKENS (7): "block", "entity", "org", "organization", "organizations", "recognition", "research". | EXACT TITLE in basque_culture: "Named-entity recognition".
0.340
Chorizo ↗ Q23374 EXACT TITLE
chorizocookingdifferentnationalporkproductsregional
SHARED TOKENS (7): "chorizo", "cooking", "different", "national", "pork", "products", "regional". | EXACT TITLE in food: "Chorizo". | EXACT TITLE in basque_culture: "Chorizo".
0.340
contextculturallargelimitednaturalprofessionaltechniques
SHARED TOKENS (7): "context", "cultural", "large", "limited", "natural", "professional", "techniques". | EXACT TITLE in basque_culture: "Machine translation".
0.340
Oyster bar ↗ Q7116364 EXACT TITLE
bardistinctfoodhouserestaurantservesserving
SHARED TOKENS (7): "bar", "distinct", "food", "house", "restaurant", "serves", "serving". | EXACT TITLE in food: "Oyster bar".
0.320
Food hall ↗ Q18355750 EXACT TITLE
departmentfoodhalllargeretailsold
SHARED TOKENS (6): "department", "food", "hall", "large", "retail", "sold". | EXACT TITLE in food: "Food hall".
0.320
Omakase ↗ Q7089494 EXACT TITLE
diningformmenurestaurantrestaurantsseasonal
SHARED TOKENS (6): "dining", "form", "menu", "restaurant", "restaurants", "seasonal". | EXACT TITLE in food: "Omakase".
0.320
Hay ↗ Q336989 EXACT TITLE
healthlargeprocessingproductionregularsheep
SHARED TOKENS (6): "health", "large", "processing", "production", "regular", "sheep". | EXACT TITLE in basque_culture: "Hay".
0.320
basquecountryculturalculturepeopleregion
SHARED TOKENS (6): "basque", "country", "cultural", "culture", "people", "region". | EXACT TITLE in food: "Basque Country". | EXACT TITLE in basque_culture: "Basque Country".
0.300
becomecommunityconnectingculturalculturecurrentdiversityhistoryidentitylimitednationalnaturalnextrecentsignificantspecificsystemthemthoughtoday
SHARED TOKENS (21): "become", "community", "connecting", "cultural", "culture", "current", "diversity", "history", "identity", "limited", "national", "natural", "next", "recent", "significant", "specific", "system", "them", "though", "today"....
0.300
americanbecomeculturalcultureethnicglobalgroupheritageinternationallegallocalmajornationalnaturalproductratherrelatedsignificantspecificthough
SHARED TOKENS (22): "american", "become", "cultural", "culture", "ethnic", "global", "group", "heritage", "international", "legal", "local", "major", "national", "natural", "product", "rather", "related", "significant", "specific", "though"....
0.300
americanbecomeculturaldeathdiversitydocumentingeducationheritagehistorypeoplepopulationreachedregionalsecondsocialspecificthemthroughoutworld
SHARED TOKENS (19): "american", "become", "cultural", "death", "diversity", "documenting", "education", "heritage", "history", "people", "population", "reached", "regional", "second", "social", "specific", "them", "throughout", "world".
0.300
Transhumance ↗ Q4657754 KW CROSS HIGH
formimportantmovementpeoplepermanentpopulationproductsregionsseasonalthemthroughouttraditionalverticalwesternworld
SHARED TOKENS (15): "form", "important", "movement", "people", "permanent", "population", "products", "regions", "seasonal", "them", "throughout", "traditional", "vertical", "western", "world".
0.300
becomebuildingdepartmentdistrictfinancialgovernmenthistorichistoryinclusionmultiplenationalnominationparkpublicrecognitionsitestructure
SHARED TOKENS (17): "become", "building", "department", "district", "financial", "government", "historic", "history", "inclusion", "multiple", "national", "nomination", "park", "public", "recognition", "site", "structure".
0.300
americanbillionbuildbureaubusinessbusinessescommunitycurrentdatadepartmentdepartmentsgovernmenthouseinfrastructurelocalmissionpeopleplanpopulationproduced
SHARED TOKENS (21): "american", "billion", "build", "bureau", "business", "businesses", "community", "current", "data", "department", "departments", "government", "house", "infrastructure", "local", "mission", "people", "plan", "population", "produced"....
0.300
culturedirectlyfoodslargelocalmarketmarketsopenpermanentproduceproductspublicretailsoldvendors
SHARED TOKENS (15): "culture", "directly", "foods", "large", "local", "market", "markets", "open", "permanent", "produce", "products", "public", "retail", "sold", "vendors".
0.300
americanculturaldatadiversityearlyenvironmentalethnicfamilyformerglobalgovernmenthistoryimmigrantinternationaljanuarylargestlegallimitedmajormembers
SHARED TOKENS (35): "american", "cultural", "data", "diversity", "early", "environmental", "ethnic", "family", "former", "global", "government", "history", "immigrant", "international", "january", "largest", "legal", "limited", "major", "members"....
0.300
additionalassociationbusinesscontextdepartmentsenvironmentalformfunctiongovernmentgrouplargelocalmembersmembershipoperationsorganizationorganizationspeopleprofessionalpublic
SHARED TOKENS (21): "additional", "association", "business", "context", "departments", "environmental", "form", "function", "government", "group", "large", "local", "members", "membership", "operations", "organization", "organizations", "people", "professional", "public"....
0.300
alcoholamericanannuallyarticlebarsbeercommunitycountrydistrictfacilitygovernmentjulylegalliquorlocallocallynationaloperatingoperationoregon
SHARED TOKENS (29): "alcohol", "american", "annually", "article", "bars", "beer", "community", "country", "district", "facility", "government", "july", "legal", "liquor", "local", "locally", "national", "operating", "operation", "oregon"....
0.300
boisebuildingdowntownformerfullhistorichouseidahonearoperatedsinglesitetablethoughwestern
SHARED TOKENS (15): "boise", "building", "downtown", "former", "full", "historic", "house", "idaho", "near", "operated", "single", "site", "table", "though", "western".
0.300
Empanada ↗ Q747457 EXACT TITLE
americanbakedcookingnorthwest
SHARED TOKENS (5): "american", "baked", "cooking", "north", "west". | EXACT TITLE in food: "Empanada".
0.300
americanancestralaugustdatadirectlyethnicgrouplargestnorthpeoplepermanentpopulationratherrecentsmallspecific
SHARED TOKENS (16): "american", "ancestral", "august", "data", "directly", "ethnic", "group", "largest", "north", "people", "permanent", "population", "rather", "recent", "small", "specific".
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in food: "Idaho Department of Health and Welfare". | EXACT TITLE in basque_culture: "Idaho Department of Health and Welfare".
0.300
Arts district ↗ Q1797194 KW CROSS HIGH
citiescommercialculturaldistrictlargemultiplemusicpeopleplanningproductionpublicratherresearchrestaurantsspaceurban
SHARED TOKENS (16): "cities", "commercial", "cultural", "district", "large", "multiple", "music", "people", "planning", "production", "public", "rather", "research", "restaurants", "space", "urban".
0.300
agriculturalagricultureciviccommunityconnectsconsumereventsfarmingfoodgoodsgroupimportantlocalmarketmarketsmembersmodelnorthorganizationpeople
SHARED TOKENS (32): "agricultural", "agriculture", "civic", "community", "connects", "consumer", "events", "farming", "food", "goods", "group", "important", "local", "market", "markets", "members", "model", "north", "organization", "people"....
0.300
agriculturalamericancenturiescookingcountrycuisineculinaryculturalcultureerafoodfoodsheritagehistoryimportantintroducedlocalporkproductsregional
SHARED TOKENS (30): "agricultural", "american", "centuries", "cooking", "country", "cuisine", "culinary", "cultural", "culture", "era", "food", "foods", "heritage", "history", "important", "introduced", "local", "pork", "products", "regional"....
0.300
activityfoundedidahopublicresearch
SHARED TOKENS (5): "activity", "founded", "idaho", "public", "research". | EXACT TITLE in basque_culture: "Idaho State University".
0.300
agriculturalagriculturecountrydifferentfoodidahoimportantlargestlifenearlyprocessingproducesproductionproductsrepresentssalessecondsignificant
SHARED TOKENS (18): "agricultural", "agriculture", "country", "different", "food", "idaho", "important", "largest", "life", "nearly", "processing", "produces", "production", "products", "represents", "sales", "second", "significant".
0.300
Vitoria-Gasteiz ↗ Q14318 KW CROSS HIGH
agriculturalaroundawardbasquecapitalcitiescommunitycountryculturaleventsfestivalfrenchglobalgovernmentheritagehouselargestmemorialnearlypopulation
SHARED TOKENS (24): "agricultural", "around", "award", "basque", "capital", "cities", "community", "country", "cultural", "events", "festival", "french", "global", "government", "heritage", "house", "largest", "memorial", "nearly", "population"....
0.300
Choir ↗ Q131186 EXACT TITLE
differenteramusicsmallspecifically
SHARED TOKENS (5): "different", "era", "music", "small", "specifically". | EXACT TITLE in basque_culture: "Choir".
0.300
Distillation ↗ Q101017 KW CROSS HIGH
alcoholbardistillerydiversityenvironmentalfootprintlargenearlyoperateoperatesoperationoperationsproduceproducesproductsseparate
SHARED TOKENS (16): "alcohol", "bar", "distillery", "diversity", "environmental", "footprint", "large", "nearly", "operate", "operates", "operation", "operations", "produce", "produces", "products", "separate".
0.300
Bistro ↗ Q866742 EXACT TITLE
formrestaurantservingsettingsmall
SHARED TOKENS (5): "form", "restaurant", "serving", "setting", "small". | EXACT TITLE in food: "Bistro".
0.300
App store ↗ Q3814081 KW CROSS HIGH
additionalcommercialcontemporarycontextexperiencefocuslicensingmediamobileoperatingplatformrelatedspecificsystemtodaytraditional
SHARED TOKENS (16): "additional", "commercial", "contemporary", "context", "experience", "focus", "licensing", "media", "mobile", "operating", "platform", "related", "specific", "system", "today", "traditional".
0.300
buildcountrydestinationeventexhibitionsfeesgovernmentheldhotelinfrastructurelocalmajormembershiporganizationorganizationsplayprivatespecificsupportingtourism
SHARED TOKENS (23): "build", "country", "destination", "event", "exhibitions", "fees", "government", "held", "hotel", "infrastructure", "local", "major", "membership", "organization", "organizations", "play", "private", "specific", "supporting", "tourism"....
0.300
Wine bar ↗ Q133575172 KW CROSS HIGH
additionalbarbarsbeerbusinessfunctionlicensingliquororiginprivateratherretailersellingspecificwine
SHARED TOKENS (15): "additional", "bar", "bars", "beer", "business", "function", "licensing", "liquor", "origin", "private", "rather", "retailer", "selling", "specific", "wine".
0.300
cookingcountrycuisineculinaryfoodfoodsimmigrantintroducedliquorlocallocallynationalproductsreachedregionregionaltodaytraditionsvisiblewine
SHARED TOKENS (20): "cooking", "country", "cuisine", "culinary", "food", "foods", "immigrant", "introduced", "liquor", "local", "locally", "national", "products", "reached", "region", "regional", "today", "traditions", "visible", "wine".
0.300
Tug of war ↗ Q102843 KW CROSS HIGH
activityclubcommunityculturaleventshistoryimportantinternationalmembersnationalprogramspecifictechniquesthoughthroughoutworld
SHARED TOKENS (16): "activity", "club", "community", "cultural", "events", "history", "important", "international", "members", "national", "program", "specific", "techniques", "though", "throughout", "world".
0.300
agriculturalbasquecommunitycountrydepartmentdestinationdistinctdistributedformformerfrenchhistoricjanuarymajornorthpopulationregiontraditionalwest
SHARED TOKENS (19): "agricultural", "basque", "community", "country", "department", "destination", "distinct", "distributed", "form", "former", "french", "historic", "january", "major", "north", "population", "region", "traditional", "west".
0.300
aroundbuildingcommunitydevelopmentdistinctexperiencehealthmodeloperateoperatingorganizationorganizationssocialspacework
SHARED TOKENS (15): "around", "building", "community", "development", "distinct", "experience", "health", "model", "operate", "operating", "organization", "organizations", "social", "space", "work".
0.300
Navarre ↗ Q4018 KW CROSS HIGH
annualbasquecapitalcommunityeventfestivalheldhistoricjulymakesnorthproducesregionsanwestern
SHARED TOKENS (15): "annual", "basque", "capital", "community", "event", "festival", "held", "historic", "july", "makes", "north", "produces", "region", "san", "western".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
brandbusinesscapitalchaincorporatedirectentityexplicitlyfeesfinanciallargelegallicensingmarketmodelproductsresearchrightssmallspecific
SHARED TOKENS (21): "brand", "business", "capital", "chain", "corporate", "direct", "entity", "explicitly", "fees", "financial", "large", "legal", "licensing", "market", "model", "products", "research", "rights", "small", "specific"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorydescribeddevelopmentfinanciallimitedlong-termownershipprivateproductproductspublicratherspecific
SHARED TOKENS (16): "active", "business", "capital", "category", "described", "development", "financial", "limited", "long-term", "ownership", "private", "product", "products", "public", "rather", "specific".
0.300
Basque pelota ↗ Q212845 KW CROSS HIGH
americanaroundbasquecountrycourtdifferentformfrenchinternationallostmodernnationalnevadaoperatedplayrelatedsafetyworld
SHARED TOKENS (18): "american", "around", "basque", "country", "court", "different", "form", "french", "international", "lost", "modern", "national", "nevada", "operated", "play", "related", "safety", "world".
0.300
Folk music ↗ Q43343 KW CROSS HIGH
beyondcommercialcontemporaryculturaldistinctearlierformformerfusionidentitymusicnationalpeoplereachedsecondtraditionalworld
SHARED TOKENS (17): "beyond", "commercial", "contemporary", "cultural", "distinct", "earlier", "form", "former", "fusion", "identity", "music", "national", "people", "reached", "second", "traditional", "world".
0.300
associationcodecommunitycorporateformfoundationinternationalnationalnonprofitoperatedoperationorganizationorganizationspublicsafetystatussupporting
SHARED TOKENS (17): "association", "code", "community", "corporate", "form", "foundation", "international", "national", "nonprofit", "operated", "operation", "organization", "organizations", "public", "safety", "status", "supporting".
0.300
boisedowntownidahonorthwestpopulation
SHARED TOKENS (5): "boise", "downtown", "idaho", "northwest", "population". | EXACT TITLE in food: "Eagle, Idaho".
🫐 BERRY64 edges
0.280
Simplot ↗ Q3484788 EXACT TITLE
agricultureamericanboiseidaho
SHARED TOKENS (4): "agriculture", "american", "boise", "idaho". | EXACT TITLE in food: "Simplot".
0.280
Fermentation ↗ Q41760 KW CROSS HIGH
differentfoodformhealthhostimportantnearlyproduceproductionproductsprofilesrelatedsupplywine
SHARED TOKENS (14): "different", "food", "form", "health", "host", "important", "nearly", "produce", "production", "products", "profiles", "related", "supply", "wine".
0.280
americanaroundassociationbecomecollectionscurationdatamediaplanningreadingrelatedsciencesinglesold
SHARED TOKENS (14): "american", "around", "association", "become", "collections", "curation", "data", "media", "planning", "reading", "related", "science", "single", "sold".
0.280
businessbusinessesdiningfoodkitchenmultipleoperaterestaurantrestaurantsseparateservessharesinglespace
SHARED TOKENS (14): "business", "businesses", "dining", "food", "kitchen", "multiple", "operate", "restaurant", "restaurants", "separate", "serves", "share", "single", "space".
0.280
americanannualannuallybureaucommunitydataformlargestlocalmajorplanprogramstatuswestern
SHARED TOKENS (14): "american", "annual", "annually", "bureau", "community", "data", "form", "largest", "local", "major", "plan", "program", "status", "western".
0.280
currentdepartmentdirectlyemployeesfocusfoodfoodsformerhealthproductspublicrelatedsafetywork
SHARED TOKENS (14): "current", "department", "directly", "employees", "focus", "food", "foods", "former", "health", "products", "public", "related", "safety", "work".
0.280
basqueeventfrenchtoday
SHARED TOKENS (4): "basque", "event", "french", "today". | EXACT TITLE in basque_culture: "Bertsolaritza".
0.260
contextcorpusform
SHARED TOKENS (3): "context", "corpus", "form". | EXACT TITLE in basque_culture: "Part-of-speech tagging".
0.260
americanidahomember
SHARED TOKENS (3): "american", "idaho", "member". | EXACT TITLE in basque_culture: "Pete Cenarrusa".
0.260
consumercorporatefoodfoodsmembersnationalnaturaloutsideprivateproductionpublicrathersocial
SHARED TOKENS (13): "consumer", "corporate", "food", "foods", "members", "national", "natural", "outside", "private", "production", "public", "rather", "social".
0.260
basquecountrypeople
SHARED TOKENS (3): "basque", "country", "people". | EXACT TITLE in food: "Basque dance". | EXACT TITLE in basque_culture: "Basque dance".
0.260
americanbeardcuisineculinarydescribedfoodfoundationjamesnonprofitorganizationprominentrelatedscholarships
SHARED TOKENS (13): "american", "beard", "cuisine", "culinary", "described", "food", "foundation", "james", "nonprofit", "organization", "prominent", "related", "scholarships".
0.260
Steakhouse ↗ Q3109696 EXACT TITLE
housemodernrestaurant
SHARED TOKENS (3): "house", "modern", "restaurant". | EXACT TITLE in food: "Steakhouse".
0.260
historicnationalpub
SHARED TOKENS (3): "historic", "national", "pub". | EXACT TITLE in basque_culture: "National Historic Preservation Act".
0.260
familynorthrelated
SHARED TOKENS (3): "family", "north", "related". | EXACT TITLE in food: "Huckleberry".
0.260
basquecommunitycountrydifferentethnicformfrenchgrouplatemovementregionstodaywestern
SHARED TOKENS (13): "basque", "community", "country", "different", "ethnic", "form", "french", "group", "late", "movement", "regions", "today", "western".
0.240
Gipuzkoa ↗ Q95010 KW CROSS HIGH
basquecapitalcitiescommunitycountrydepartmentfrenchimportantnorthpopulationsanwest
SHARED TOKENS (12): "basque", "capital", "cities", "community", "country", "department", "french", "important", "north", "population", "san", "west".
0.240
contextcountrydifferenteducationheritagepopulationproductionresearchsciencesecondsocialtechniques
SHARED TOKENS (12): "context", "country", "different", "education", "heritage", "population", "production", "research", "science", "second", "social", "techniques".
0.240
datafoundationallargemodelmodernnaturalnetworknextprocessingsafetytechnologytrained
SHARED TOKENS (12): "data", "foundational", "large", "model", "modern", "natural", "network", "next", "processing", "safety", "technology", "trained".
0.240
activityagricultureannuallargeoperationsrestaurantsseasonalsignificantstatusthemtourismworkers
SHARED TOKENS (12): "activity", "agriculture", "annual", "large", "operations", "restaurants", "seasonal", "significant", "status", "them", "tourism", "workers".
0.240
Natural wine ↗ Q3559389 KW CROSS HIGH
formfrenchlimitedmovementnaturalproducedproductionrathersmalltechniquestraditionalwine
SHARED TOKENS (12): "form", "french", "limited", "movement", "natural", "produced", "production", "rather", "small", "techniques", "traditional", "wine".
0.240
Lifting stone ↗ Q3997677 KW CROSS HIGH
aroundbasquecenteredcountryeventsnaturalnorthpeopleplatformthroughoutwestworld
SHARED TOKENS (12): "around", "basque", "centered", "country", "events", "natural", "north", "people", "platform", "throughout", "west", "world".
0.220
Sourdough ↗ Q3360560 EXACT TITLE
bakedproduces
SHARED TOKENS (2): "baked", "produces". | EXACT TITLE in food: "Sourdough".
0.220
boisecanyoncitiesidaholargestnearlynorthwestoregonpopulationtreasurevalley
SHARED TOKENS (11): "boise", "canyon", "cities", "idaho", "largest", "nearly", "northwest", "oregon", "population", "treasure", "valley".
0.220
basquefull
SHARED TOKENS (2): "basque", "full". | EXACT TITLE in basque_culture: "Basque Americans".
0.220
Txakoli ↗ Q1792144 KW CROSS HIGH
alcoholbasquecountryhistorylargemuseumnearpintxosproducedtodaywine
SHARED TOKENS (11): "alcohol", "basque", "country", "history", "large", "museum", "near", "pintxos", "produced", "today", "wine".
0.220
blockboisebuildingcapitaldistricthistoricidahonationalneighborhoodstreetwestern
SHARED TOKENS (11): "block", "boise", "building", "capital", "district", "historic", "idaho", "national", "neighborhood", "street", "western".
0.220
Trattoria ↗ Q1690553 EXACT TITLE
eateryrestaurant
SHARED TOKENS (2): "eatery", "restaurant". | EXACT TITLE in food: "Trattoria".
0.220
Folklore ↗ Q36192 KW CROSS HIGH
buildingculturalcultureformgroupnextpeopleregionschooltraditionaltraditions
SHARED TOKENS (11): "building", "cultural", "culture", "form", "group", "next", "people", "region", "school", "traditional", "traditions".
0.220
agriculturebecomebusinessbusinessesfamilyinternationalnextownershippeopleplanningsmall
SHARED TOKENS (11): "agriculture", "become", "business", "businesses", "family", "international", "next", "ownership", "people", "planning", "small".
0.210
Sour beer ↗ EXACT TITLE
beer
SHARED TOKENS (1): "beer". | EXACT TITLE in food: "Sour beer".
0.210
Injera ↗ Q935807 EXACT TITLE
dining
SHARED TOKENS (1): "dining". | EXACT TITLE in food: "Injera".
0.200
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
boisecanyonfootprintidahonorthwestpopulationprominentsecondwestwestern
SHARED TOKENS (10): "boise", "canyon", "footprint", "idaho", "northwest", "population", "prominent", "second", "west", "western".
0.200
agriculturalculturalcultureenvironmentalfoundedgrouppeopleproductresearchwestern
SHARED TOKENS (10): "agricultural", "cultural", "culture", "environmental", "founded", "group", "people", "product", "research", "western".
0.200
Álava ↗ KW CROSS HIGH
basquecapitalcommunitycountryformerinstitutionslargestnorthpopulationwest
SHARED TOKENS (10): "basque", "capital", "community", "country", "former", "institutions", "largest", "north", "population", "west".
0.200
americancookingcuisineculinarydistinctfoodsheritageregionspecifictraditions
SHARED TOKENS (10): "american", "cooking", "cuisine", "culinary", "distinct", "foods", "heritage", "region", "specific", "traditions".
0.200
annualawardbeardculinaryfoodfoundationjamesreceiverecognitionworld
SHARED TOKENS (10): "annual", "award", "beard", "culinary", "food", "foundation", "james", "receive", "recognition", "world".
0.180
agesbasquecountrycurrentdirectdirectlymodernstandardwestern
SHARED TOKENS (9): "ages", "basque", "country", "current", "direct", "directly", "modern", "standard", "western".
0.180
activitybuildbuildingcollectionscurationdataprocessingsciencethem
SHARED TOKENS (9): "activity", "build", "building", "collections", "curation", "data", "processing", "science", "them".
0.180
Urban renewal ↗ Q920600 KW CROSS HIGH
businessescitiesconstructiongovernmentinfrastructureprivatepublicredevelopmenturban
SHARED TOKENS (9): "businesses", "cities", "construction", "government", "infrastructure", "private", "public", "redevelopment", "urban".
0.180
Folk dance ↗ Q201022 KW CROSS HIGH
countryculturalethniclifenearlyoriginpeopleregiontraditional
SHARED TOKENS (9): "country", "cultural", "ethnic", "life", "nearly", "origin", "people", "region", "traditional".
0.180
barscategoryemployeeseventfoodhospitalityplanningrestaurantstourism
SHARED TOKENS (9): "bars", "category", "employees", "event", "food", "hospitality", "planning", "restaurants", "tourism".
0.180
augustdepartmentdistrictnationalnaturalparkpeoplepublicthem
SHARED TOKENS (9): "august", "department", "district", "national", "natural", "park", "people", "public", "them".
0.180
culturaldiversityearlierheritagehistoricrelatedtraditionswesternworld
SHARED TOKENS (9): "cultural", "diversity", "earlier", "heritage", "historic", "related", "traditions", "western", "world".
0.180
businessbusinessescommercialfamilymultipleorganizationownershiprelatedrelationships
SHARED TOKENS (9): "business", "businesses", "commercial", "family", "multiple", "organization", "ownership", "related", "relationships".
0.160
basquecommunitycountryfamilyimportantlocallyoriginrather
SHARED TOKENS (8): "basque", "community", "country", "family", "important", "locally", "origin", "rather".
0.140
majornaturalprocessingrecognitionrelatedsciencesystem
SHARED TOKENS (7): "major", "natural", "processing", "recognition", "related", "science", "system".
0.140
aroundcookingcuisineculinaryfoodstraditionaltraditions
SHARED TOKENS (7): "around", "cooking", "cuisine", "culinary", "foods", "traditional", "traditions".
0.140
Biscay ↗ Q93366 KW CROSS HIGH
basquecapitalcommunityfinanciallargestmajorthroughout
SHARED TOKENS (7): "basque", "capital", "community", "financial", "largest", "major", "throughout".
0.140
Viticulture ↗ KW CROSS HIGH
developmenthistorymodernsciencesitewesternwine
SHARED TOKENS (7): "development", "history", "modern", "science", "site", "western", "wine".
0.140
boisecenteridaholargestnevadapopulationvalley
SHARED TOKENS (7): "boise", "center", "idaho", "largest", "nevada", "population", "valley".
0.140
guidehealthmediapublicrestaurantrestaurantssanitation
SHARED TOKENS (7): "guide", "health", "media", "public", "restaurant", "restaurants", "sanitation".
0.120
experienceformproductproductsprofessionalpurchasing
SHARED TOKENS (6): "experience", "form", "product", "products", "professional", "purchasing".
0.120
beercategorycenturieslatenaturalsignificant
SHARED TOKENS (6): "beer", "category", "centuries", "late", "natural", "significant".
0.120
boisecapitalcitiesidahopopulationsecond
SHARED TOKENS (6): "boise", "capital", "cities", "idaho", "population", "second".
0.120
Sheep farming ↗ Q1790941 KW CROSS HIGH
buildfarmingmarketnearregionsheep
SHARED TOKENS (6): "build", "farming", "market", "near", "region", "sheep".
0.120
Foodie ↗ Q1435960 KW CROSS HIGH
aroundculturedifferentfoodfoodsrelated
SHARED TOKENS (6): "around", "culture", "different", "food", "foods", "related".
0.120
cuisineculinaryformlargeoutsideproducts
SHARED TOKENS (6): "cuisine", "culinary", "form", "large", "outside", "products".
0.100
commerciallargeproducesproductsprofile
SHARED TOKENS (5): "commercial", "large", "produces", "products", "profile".
0.100
Table d'hôte ↗ Q3048434 KW CROSS HIGH
frenchhostmenurestauranttable
SHARED TOKENS (5): "french", "host", "menu", "restaurant", "table".
0.100
americangeographicregionspecificwine
SHARED TOKENS (5): "american", "geographic", "region", "specific", "wine".
0.100
Jai alai ↗ Q1193361 KW CROSS HIGH
americanbasquecaliforniacountryfestival
SHARED TOKENS (5): "american", "basque", "california", "country", "festival".
0.100
districtgrovehistoricnationalstreet
SHARED TOKENS (5): "district", "grove", "historic", "national", "street".
0.100
boisecommunityidahooregonpopulation
SHARED TOKENS (5): "boise", "community", "idaho", "oregon", "population".
◈ Frequently Asked Questions
Food × Basque Culture — Treasure Valley
HAIKU · HIGH GATE
What Basque food traditions are served in Boise restaurants today?
Restaurants in Boise's Ada County serve pincho and charcuterie as direct expressions of Basque culinary heritage brought to the Treasure Valley by the region's Basque population. These dishes appear on menus with liquor licenses that reflect the wine and cider traditions central to Basque dining culture.
How did Basque food culture establish itself in the Treasure Valley?
Basque immigrants settled in Caldwell and the surrounding Treasure Valley, creating a local food culture anchored in their traditional cuisine including cured meats and prepared pinchos. Canyon County and Ada County restaurants continue serving these dishes as core elements of the region's Basque cultural identity.
Where can visitors find authentic Basque food in the Treasure Valley according to food safety and restaurant standards?
Boise and Caldwell restaurants with proper food safety compliance and liquor licenses operate as the primary venues for Basque cuisine in the Treasure Valley. Tripadvisor reviews document these establishments as sources for charcuterie, pinchos, and other dishes maintained within Basque culinary traditions.
What role does charcuterie play in Treasure Valley Basque restaurants?
Charcuterie serves as a signature element of Basque food culture in Ada County and Canyon County restaurants throughout Boise and Caldwell. These cured meat preparations reflect centuries of Basque food traditions now integrated into the Treasure Valley's local dining landscape under current food safety regulations.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Food × Basque Culture 13 QID bridges 209 edges 5,696 ext links 2026-07-17 20:55:42 UTC dd895162c10d4406
Food corridor ↗ Basque Culture corridor ↗ Basque Culture × Food ↗ boisestandard.org/standard ↗
Parent Corridors
Food × All Other Verticals