—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Data Center ↔ relates to ↔ Military

10 Wikipedia bridge articles confirmed in both vertical ledgers. 198 deterministic cross-vertical edges. 5,167 external source links harvested. Every edge provenance-stamped. Every claim auditable.

10 QID Bridge Articles
198 Cross Edges
5,167 External Sources
229 Wikipedia Articles
8 🌲 Evergreen
107 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Data Center
× Military
QID Bridge Articles
10
confirmed Wikipedia overlap
Total Cross Edges
198
External Sources Harvested
5,167
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Zoning
score: 1.0000  ·  type: exact_title_cross  ·  20 shared tokens
QID Bridge Titles (10)
ZoningLand-use planningTreasure ValleyIdaho Department of CommerceComputer securityBoise, IdahoNampa, IdahoAda County, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisedevelopmentlandlocalresourcesadacapitalgrowthland-useplanningsystemsessentialphysicalcommercetreasurevalleywesterntechnologylargest
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 20:19:37 UTC
Content Hash
eaf49e6a0fab2536
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
10 BRIDGES
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in data_center (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (20): "allowing", "buildings", "density", "development", "different", "government", "growth", "industrial", "land", "land-use", "local", "planning", "policy", "regulatory", "scale", "shape", "single", "size", "systems", "zoning". | EXACT TITLE in data_center: "Zoning". | EXACT TITLE in military: "Zoning".
allowingbuildingsdensitydevelopmentdifferentgovernmentgrowthindustriallandland-uselocalplanningpolicyregulatoryscaleshapesinglesizesystemszoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in data_center (tier:branch) and military (tier:evergreen). | SHARED TOKENS (26): "central", "changes", "conditions", "conservation", "depends", "design", "development", "environmental", "essential", "exposure", "facilities", "future", "land", "land-use", "means", "needs", "northern", "physical", "plan", "planning".... | EXACT TITLE in military: "Land-use planning".
centralchangesconditionsconservationdependsdesigndevelopmentenvironmentalessentialexposurefacilitiesfuturelandland-usemeansneedsnorthernphysicalplanplanningprojectregionalresourcessocialspecificallyview
Land use planning or land-use regulation is the process of regulating the use of land by a central authority. Usually, this is done to promote more desirable social and environmental outcomes as well as a more efficient use of resources. More specifically, the goals of modern land use planning often include environmental conservation, restraint of urban sprawl, minimization of transport costs, prevention of land use conflicts, and a reduction in exposure to pollutants. In the pursuit of these goals, planners assume that regulating the use of land will change the patterns of human behavior, and that these changes are beneficial. The first assumption, that regulating land use changes the patterns of human behavior is widely accepted. However, the second assumption – that these changes are beneficial – is contested, and depends on the location and regulations being discussed. In urban planning, land use planning seeks to order and regulate land use in an efficient and ethical way, thus preventing land use conflicts. Governments use land use planning to manage the development of land within their jurisdictions. In doing so, the governmental unit can plan for the needs of the community while safeguarding natural resources. To this end, it is the systematic assessment of land and water potential, alternatives for land use, and economic and social conditions in order to select and adopt the best land use options. Often one element of a comprehensive plan, a land use plan provides a vision for the future possibilities of development in neighborhoods, districts, cities, or any defined planning area. In the United States, the terms land use planning, regional planning, urban planning, and urban design are often used interchangeably, and will depend on the state, county, and/or project in question. Despite confusing nomenclature, the essential function of land use planning remains the same whatever term is applied. The Canadian Institute of Planners offers a definition that land use planning means the scientific, aesthetic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
Milan Milan city is located in northern Italy. It is the second most populous city in the country after Rome with a population of over 4 million (The CBD and its metropolitan Boroughs). Every area in Milan is a segment that starts from the center and reaches the city limits, so that central areas and peripheral areas are part of the same area. In Milan, zones are not identified by names but numbers. The city hall area 1 of Milan includes the entire historical center, starting from the geographical center of Milan in Piazza Duomo up to the Cerchia dei Bastioni. The town hall area 2 goes from Piazza della Repubblica to Crescenzago, Turro, Greco and Precotto.
and use conflicts, and a reduction in exposure to pollutants. In the pursuit of these goals, planners assume that regulating the use of land will change the patterns of human behavior, and that these changes are beneficial. The first assumption, that regulating land use changes the patterns of human behavior is widely accepted. However, the second assumption – that these changes are beneficial – is contested, and depends on the location and regulations being discussed. In urban planning, land use planning seeks to order and regulate land use in an efficient and ethical way, thus preventing land use conflicts. Governments use land use planning to manage the development of land within their jurisdictions. In doing so, the governmental unit can plan for the needs of the community while safeguarding natural resources. To this end, it is the systematic assessment of land and water potential, alternatives for land use, and economic and social conditions in order to select and adopt the best land use options. Often one element of a comprehensive plan, a land use plan provides a vision for the future possibilities of development in neighborhoods, districts, cities, or any defined planning area. In the United States, the terms land use planning, regional planning, urban planning, and urban design are often used interchangeably, and will depend on the state, county, and/or project in question. Despite confusing nomenclature, the essential function of land use planning remains the same whatever term is applied. The Canadian Institute of Planners offers a definition that land use planning means the scientific, aesthetic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in data_center (tier:evergreen) and military (tier:evergreen). | SHARED TOKENS (11): "boise", "commerce", "historically", "idaho", "land", "local", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in data_center: "Treasure Valley". | EXACT TITLE in military: "Treasure Valley".
boisecommercehistoricallyidaholandlocalregionresourcestreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Idaho Department of Commerce
Q17021846 EXACT TITLE 0.840
QID OVERLAP: Q17021846 in data_center (tier:branch) and military (tier:evergreen). | SHARED TOKENS (7): "commerce", "development", "growth", "idaho", "public", "resources", "state-level". | EXACT TITLE in military: "Idaho Department of Commerce".
commercedevelopmentgrowthidahopublicresourcesstate-level
The Idaho Department of Commerce is the state-level economic development agency for the State of Idaho.
Recreational technology Abundant recreational opportunities make Idaho a potential market for any business in the Recreational Technology industry. From the emerald green hillsides, timbered mountains and pristine lakes of the panhandle, to the jagged peaks of central Idaho, all the way down to the Snake River Basin with its wide open vistas and irrigated farm lands, the Gem State can provide companies with the right environment to help their businesses thrive. In addition, Idaho's diverse landscape is a prime research ground for companies to test their products in the environments where they would be used. Tourism Idaho acts as a primarily leisure-travel state. Building Idaho's economy by increasing visitor expenditures throughout the state is the goal of Idaho Department of Commerce's Tourism Development Division. The division's activities are funded by a two percent lodging tax, paid by travelers and collected by the state's hotel, motel and private campground owners. Tax collections have grown to over $9 million annually. Forty-five percent of the funds are used for statewide programs targeted to international and domestic consumers, tour operators, travel agents, travel journalists, and film industry marketing. Another forty-five percent is distributed to non-profit local and regional tourism development organizations through the Idaho Regional Travel and Convention Grant Program. The remaining ten percent is used for administration of the division. According to the U.S.
dits, and tax exemptions. Organization The department consists of five divisions: marketing; tourism development; international business; commercial innovation; and economic development. Economic Development Division Business Development provides counseling, networking, and revenue generating opportunities for entrepreneurs and helps businesses retain and develop their workforce. Community Development evaluates the economic strengths, weaknesses, and opportunities for local communities.
Computer security
Q3510521 QID OVERLAP 0.800
QID OVERLAP: Q3510521 in data_center (tier:branch) and military (tier:branch). | SHARED TOKENS (18): "becomes", "cybersecurity", "data", "digital", "disclosure", "essential", "expanded", "information", "infrastructure", "network", "networks", "physical", "provide", "security", "software", "systems", "technology", "therefore".
becomescybersecuritydatadigitaldisclosureessentialexpandedinformationinfrastructurenetworknetworksphysicalprovidesecuritysoftwaresystemstechnologytherefore
work standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
Computer security (also cybersecurity, digital security, or information technology (IT) security) is a subdiscipline within the field of information security. It focuses on protecting computer software, systems, and networks from threats that can lead to unauthorized information disclosure, theft, or damage to hardware, software, or data, as well as to the disruption or misdirection of the services they provide. The growing significance of computer security reflects the increasing dependence on computer systems, the Internet, and evolving wireless network standards. This reliance has expanded with the proliferation of smart devices, including smartphones, televisions, and other components of the Internet of things (IoT). As digital infrastructure becomes more embedded in everyday life, cybersecurity has emerged as a critical concern. The complexity of modern information systems—and the societal functions they underpin—has introduced new vulnerabilities. Systems that manage essential services, such as power grids, electoral processes, and finance, are particularly sensitive to security breaches. Although many aspects of computer security involve digital security, such as electronic passwords and encryption, physical security measures, such as metal locks, are still used to prevent unauthorized tampering.
IP address spoofing is where the attacker hijacks routing protocols to reroute the targets traffic to a vulnerable network node for traffic interception or injection. Message spoofing (via email, SMS or OTT messaging) is where the attacker spoofs the identity or carrier service while the target is using messaging protocols like email, SMS or OTT (IP-based) messaging apps. The attacker can then monitor conversations, launch social attacks or trigger zero-day-vulnerabilities to allow for further attacks. WiFi SSID spoofing is where the attacker simulates a Wi-Fi base station SSID to capture and modify internet traffic and transactions. The attacker can also use local network addressing and reduced network defenses to penetrate the target's firewall by breaching known vulnerabilities. Sometimes known as a Pineapple attack thanks to a popular device. See also Malicious association. DNS spoofing is where attackers hijack domain name assignments to redirect traffic to systems under the attackers' control, in order to surveil traffic or launch other attacks. SSL hijacking, typically coupled with another media-level MITM attack, is where the attacker spoofs the SSL authentication and encryption protocol by way of Certificate Authority injection in order to decrypt, surveil and modify traffic. See also TLS interception Multi-vector, polymorphic attacks Surfacing in 2017, a new class of multi-vector, polymorphic cyber threats combine several types of attacks and change form to avoid cybersecurity controls as they spread. Multi-vector polymorphic attacks, as the name describes, are both multi-vectored and polymorphic. Firstly, they are a singular attack that involves multiple methods of attack. In this sense, they are "multi-vectored" (i.e. the attack can use multiple means of propagation such as via the Web, email and applications).
Boise, Idaho
Q35775 QID OVERLAP 0.700
QID OVERLAP: Q35775 in data_center (tier:branch) and military (tier:branch). | SHARED TOKENS (10): "ada", "annual", "boise", "capital", "idaho", "major", "manufacturing", "technology", "treasure", "valley".
adaannualboisecapitalidahomajormanufacturingtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.640
QID OVERLAP: Q622633 in data_center (tier:branch) and military (tier:branch). | SHARED TOKENS (7): "according", "boise", "footprint", "idaho", "meaning", "west", "western".
accordingboisefootprintidahomeaningwestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Ada County, Idaho
Q109820 QID OVERLAP 0.640
QID OVERLAP: Q109820 in data_center (tier:evergreen) and military (tier:branch). | SHARED TOKENS (7): "ada", "boise", "capital", "idaho", "largest", "local", "private".
adaboisecapitalidaholargestlocalprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.580
QID OVERLAP: Q1085274 in data_center (tier:branch) and military (tier:branch). | SHARED TOKENS (4): "ada", "boise", "capital", "idaho".
adaboisecapitalidaho
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.560
QID OVERLAP: Q486078 in data_center (tier:branch) and military (tier:evergreen). | SHARED TOKENS (3): "boise", "idaho", "largest".
boiseidaholargest
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
188 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP188 edges
🌿 BRANCH105 edges
0.550
approximatelyattachedcoordinationforcesidaholocalnationalorganizedsupportsystem
SHARED TOKENS (10): "approximately", "attached", "coordination", "forces", "idaho", "local", "national", "organized", "support", "system". | URL->B (3): https://www.imd.idaho.gov/idaho-army-national-guard/, https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "Idaho Army National Guard".
0.500
Meta Platforms ↗ Q380 EXACT TITLE
businesscommunicationdevelopmentdigitalestablishedgloballargestmarketnetworkpercentplatformspublicsocialtechnologytoward
SHARED TOKENS (15): "business", "communication", "development", "digital", "established", "global", "largest", "market", "network", "percent", "platforms", "public", "social", "technology", "toward". | EXACT TITLE in data_center: "Meta Platforms".
0.500
approximatelyconservationdiversityenergyestateexistingfuturegovernmentidaholandmillionnationalnearlyofficeprivatepublicrightssystemthemwestern
SHARED TOKENS (20): "approximately", "conservation", "diversity", "energy", "estate", "existing", "future", "government", "idaho", "land", "million", "national", "nearly", "office", "private", "public", "rights", "system", "them", "western". | EXACT TITLE in military: "Bureau of Land Management".
0.500
constructiondisasteremergencyespeciallygovernmenthelpinfrastructurelimitedmainneedspermanentprovideprovidingresourcesresponsibilitysupport
SHARED TOKENS (16): "construction", "disaster", "emergency", "especially", "government", "help", "infrastructure", "limited", "main", "needs", "permanent", "provide", "providing", "resources", "responsibility", "support". | EXACT TITLE in military: "Disaster response".
0.500
Idaho ↗ Q1221 EXACT TITLE
approximatelyaroundassociatedboisecapitaldistinctidaholandlargestmanufacturingmillionnationalorganizedseparatesignificantsmallsouthtechnologywestwestern
SHARED TOKENS (20): "approximately", "around", "associated", "boise", "capital", "distinct", "idaho", "land", "largest", "manufacturing", "million", "national", "organized", "separate", "significant", "small", "south", "technology", "west", "western". | EXACT TITLE in data_center: "Idaho". | EXACT TITLE in military: "Idaho".
0.500
World War II ↗ Q362 EXACT TITLE
advancedcentralcontinueddocumentestablishedeventsexpansionforcesfutureglobalhistorymajormillionnearlyopeningpermanentsecuritysocialstructureswestern
SHARED TOKENS (20): "advanced", "central", "continued", "document", "established", "events", "expansion", "forces", "future", "global", "history", "major", "million", "nearly", "opening", "permanent", "security", "social", "structures", "western". | EXACT TITLE in military: "World War II".
0.500
activeairarticlecontrolforcesgovernmentlocalnationalorganizedrequireservesmallspecificallystate-levelsupport
SHARED TOKENS (15): "active", "air", "article", "control", "forces", "government", "local", "national", "organized", "require", "serve", "small", "specifically", "state-level", "support". | EXACT TITLE in military: "National Guard (United States)".
0.500
activityanotherbuiltchangescontroldecisionseducationenvironmentenvironmentalexpandedgovernmentlawmanufacturingmodelpublicsocialspecializedstructuresystemtraditional
SHARED TOKENS (20): "activity", "another", "built", "changes", "control", "decisions", "education", "environment", "environmental", "expanded", "government", "law", "manufacturing", "model", "public", "social", "specialized", "structure", "system", "traditional". | EXACT TITLE in military: "Administrative law".
0.500
airbecomebenefitscapacitycompetitivecurrentenergyenvironmentalespeciallyevenexpansionfinancialfuelgenerationgloballandlargelocalmainmajor
SHARED TOKENS (36): "air", "become", "benefits", "capacity", "competitive", "current", "energy", "environmental", "especially", "even", "expansion", "financial", "fuel", "generation", "global", "land", "large", "local", "main", "major".... | EXACT TITLE in data_center: "Renewable energy".
0.500
accordingairbecomeschangescompetitiveeffectsenvironmentessentialexposuregrowthhistoryknowledgelimitedmeaningregionsignificanttherefore
SHARED TOKENS (17): "according", "air", "becomes", "changes", "competitive", "effects", "environment", "essential", "exposure", "growth", "history", "knowledge", "limited", "meaning", "region", "significant", "therefore". | EXACT TITLE in data_center: "Critical load".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralcommercialconnectedcontrolcustomerdifferentelectricalenergygenerationimportantindustrialinfrastructurelargeoperatedsupplysystemutility
SHARED TOKENS (18): "approximately", "central", "commercial", "connected", "control", "customer", "different", "electrical", "energy", "generation", "important", "industrial", "infrastructure", "large", "operated", "supply", "system", "utility". | EXACT TITLE in data_center: "Substation".
0.500
accessaddressbusinessescapacitychangesdependingdevelopmenteducationgovernmenthistoricallyhistoryindustryjobsmatchingneedneedsnetworkprogramsprovidingpublic
SHARED TOKENS (32): "access", "address", "businesses", "capacity", "changes", "depending", "development", "education", "government", "historically", "history", "industry", "jobs", "matching", "need", "needs", "network", "programs", "providing", "public".... | EXACT TITLE in military: "Workforce development".
0.500
advancedanalysisarchitectureassociatedbecomecreatedisciplineeffectsenvironmentgrowthhistoryintelligenceknowledgelong-termnetworksoperationsplanningsoftwarespacesupport
SHARED TOKENS (22): "advanced", "analysis", "architecture", "associated", "become", "create", "discipline", "effects", "environment", "growth", "history", "intelligence", "knowledge", "long-term", "networks", "operations", "planning", "software", "space", "support".... | EXACT TITLE in data_center: "Artificial intelligence".
0.500
airattacheddedicatedforceshistoricallylandlogisticsnationalneedsoperationsorganizedprovidingseparateservesupport
SHARED TOKENS (15): "air", "attached", "dedicated", "forces", "historically", "land", "logistics", "national", "needs", "operations", "organized", "providing", "separate", "serve", "support". | EXACT TITLE in military: "Army aviation".
0.500
adaairbaseboisecentercommercialfacilityfireidahomillionnationaloperatedrightssouthsupportwestern
SHARED TOKENS (16): "ada", "air", "base", "boise", "center", "commercial", "facility", "fire", "idaho", "million", "national", "operated", "rights", "south", "support", "western". | EXACT TITLE in military: "Boise Airport".
0.500
LEED ↗ Q1521623 EXACT TITLE
addressanotherbuildingscertificationconservationconstructiondesignenergyenvironmentalexpandingframeworkhealthcarehelpindustrylocalofficeofficesoperatorspointprogram
SHARED TOKENS (30): "address", "another", "buildings", "certification", "conservation", "construction", "design", "energy", "environmental", "expanding", "framework", "healthcare", "help", "industry", "local", "office", "offices", "operators", "point", "program".... | EXACT TITLE in data_center: "LEED".
0.500
approximatelybusinessesconstructioncontractsgivingglobalgovernmentgrowthlocalorganizationsprivateprocurementpublicrequiresupplysystemsthereforevalue
SHARED TOKENS (18): "approximately", "businesses", "construction", "contracts", "giving", "global", "government", "growth", "local", "organizations", "private", "procurement", "public", "require", "supply", "systems", "therefore", "value". | EXACT TITLE in military: "Government procurement".
0.500
accessallowingcommunicationdatadevelopmentdigitalelectricalglobalindividualinformationmeansnetworksphysicalsignalssingletechnologyusers
SHARED TOKENS (17): "access", "allowing", "communication", "data", "development", "digital", "electrical", "global", "individual", "information", "means", "networks", "physical", "signals", "single", "technology", "users". | EXACT TITLE in military: "Telecommunications".
0.500
additionaladvancedbusinessesemergencyfacilitiesfirehistoricallyhospitalmodeloperatepointprimaryprovideprovidingpublicresourcessupportsystemstechnicalthem
SHARED TOKENS (22): "additional", "advanced", "businesses", "emergency", "facilities", "fire", "historically", "hospital", "model", "operate", "point", "primary", "provide", "providing", "public", "resources", "support", "systems", "technical", "them".... | EXACT TITLE in military: "Emergency medical services".
0.500
adaboisedevelopmenteducationidaholargeprimaryprogramspublicreportedsouthwesttechnicaltreasurevalleywesternworkforce
SHARED TOKENS (16): "ada", "boise", "development", "education", "idaho", "large", "primary", "programs", "public", "reported", "southwest", "technical", "treasure", "valley", "western", "workforce". | EXACT TITLE in military: "College of Western Idaho".
0.500
aroundcapitalconnectiondesigneddieselelectricalemergencyenergyevenfuelprovidesizespecificallysupplysupport
SHARED TOKENS (15): "around", "capital", "connection", "designed", "diesel", "electrical", "emergency", "energy", "even", "fuel", "provide", "size", "specifically", "supply", "support". | EXACT TITLE in data_center: "Diesel generator".
0.500
Data center ↗ Q671224 EXACT TITLE
accordingaroundassociatedcenterconditionsconnectioncontroldatademanddependingdifferentdigitaledgeelectricalenergyenvironmentalfacilitiesfacilityglobalgrowth
SHARED TOKENS (51): "according", "around", "associated", "center", "conditions", "connection", "control", "data", "demand", "depending", "different", "digital", "edge", "electrical", "energy", "environmental", "facilities", "facility", "global", "growth".... | EXACT TITLE in data_center: "Data center".
0.500
Cavalry ↗ Q47315 EXACT TITLE
advantagesbeyonddependingdesignedforcesindividuallandlatermainmeaningoperatingplatformspurelypurposeroleservesmall
SHARED TOKENS (17): "advantages", "beyond", "depending", "designed", "forces", "individual", "land", "later", "main", "meaning", "operating", "platforms", "purely", "purpose", "role", "serve", "small". | EXACT TITLE in military: "Cavalry".
0.500
accordingadaadditionalbaseboiseconservationdensitydifferentestablishedidahoimportantlandmainmillionnationaloriginalpublicsignificantsmallsouth
SHARED TOKENS (23): "according", "ada", "additional", "base", "boise", "conservation", "density", "different", "established", "idaho", "important", "land", "main", "million", "national", "original", "public", "significant", "small", "south".... | EXACT TITLE in military: "Morley Nelson Snake River Birds of Prey National Conservation Area".
0.480
Wildfire ↗ Q169950 EXACT TITLE
controlledcreatecreatesdisastereffectsespeciallyeventfireglobalgrowthimpactslandland-usephysical
SHARED TOKENS (14): "controlled", "create", "creates", "disaster", "effects", "especially", "event", "fire", "global", "growth", "impacts", "land", "land-use", "physical". | EXACT TITLE in military: "Wildfire".
0.480
accordingdescribesdevelopmentespeciallygrowthhistoricallyindividualinfrastructurelocalmarketpolicyregionsocialwest
SHARED TOKENS (14): "according", "describes", "development", "especially", "growth", "historically", "individual", "infrastructure", "local", "market", "policy", "region", "social", "west". | EXACT TITLE in data_center: "Economic development".
0.480
becomecentercommunicationcontrolcreatesdatadesignedelectricalimportantindustrymeanssmallsystemsystems
SHARED TOKENS (14): "become", "center", "communication", "control", "creates", "data", "designed", "electrical", "important", "industry", "means", "small", "system", "systems". | EXACT TITLE in data_center: "Redundancy (engineering)".
0.470
airbaseboiseidahonationalsupport
SHARED TOKENS (6): "air", "base", "boise", "idaho", "national", "support". | URL->B (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in military: "124th Fighter Wing".
0.470
boisehistoryidaholargestneartraining
SHARED TOKENS (6): "boise", "history", "idaho", "largest", "near", "training". | URL->B (1): https://www.idahomilitarymuseum.org/. | EXACT TITLE in military: "Idaho Military History Museum".
0.460
airbaseboisefacilityidahonearoperationsprimaryprovidesouthwestsupporttrainingwestern
SHARED TOKENS (13): "air", "base", "boise", "facility", "idaho", "near", "operations", "primary", "provide", "southwest", "support", "training", "western". | EXACT TITLE in military: "Mountain Home Air Force Base".
0.450
airboiseidahonationaloffice
SHARED TOKENS (5): "air", "boise", "idaho", "national", "office". | URL->B (1): https://www.124thfighterwing.ang.af.mil/. | EXACT TITLE in military: "Idaho Air National Guard".
0.450
boiseidaholargestnationalsupport
SHARED TOKENS (5): "boise", "idaho", "largest", "national", "support". | URL->B (1): https://www.imd.idaho.gov/idaho-army-national-guard/116th-calvary-brigade-combat-team/. | EXACT TITLE in military: "116th Cavalry Brigade Combat Team".
0.440
businesscontinuededucationestablishedeventforcesformergovernmentindustrymillionprimarythem
SHARED TOKENS (12): "business", "continued", "education", "established", "event", "forces", "former", "government", "industry", "million", "primary", "them". | EXACT TITLE in military: "Philippine–American War".
0.440
anotherbusinesscontractexistingmainneedprocurementprojectpublicreducesmallsupport
SHARED TOKENS (12): "another", "business", "contract", "existing", "main", "need", "procurement", "project", "public", "reduce", "small", "support". | EXACT TITLE in military: "Subcontractor".
0.440
activityboisebusinesseducationidahomillionprogramprogramspublicreportedschoolwest
SHARED TOKENS (12): "activity", "boise", "business", "education", "idaho", "million", "program", "programs", "public", "reported", "school", "west". | EXACT TITLE in military: "Boise State University".
0.440
Airspace ↗ Q272730 EXACT TITLE
airallocationcontrolcontrolledestablishedinformationnationaloperationsregulatoryspacetechnicalvertical
SHARED TOKENS (12): "air", "allocation", "control", "controlled", "established", "information", "national", "operations", "regulatory", "space", "technical", "vertical". | EXACT TITLE in military: "Airspace".
0.420
differentdisasteremergencyeventsimpactslocalneedsorganizationsprofessionalprovidingreduce
SHARED TOKENS (11): "different", "disaster", "emergency", "events", "impacts", "local", "needs", "organizations", "professional", "providing", "reduce". | EXACT TITLE in military: "Emergency management".
0.420
Site selection ↗ EXACT TITLE
businessdataexpandedfacilitygovernmentnationalneedsoperationsprojectscalesite
SHARED TOKENS (11): "business", "data", "expanded", "facility", "government", "national", "needs", "operations", "project", "scale", "site". | EXACT TITLE in data_center: "Site selection".
0.400
airconservationeducationenvironmentidahoprofessionalprogramspublicsupportsusa
SHARED TOKENS (10): "air", "conservation", "education", "environment", "idaho", "professional", "programs", "public", "supports", "usa". | EXACT TITLE in data_center: "Idaho Conservation League".
0.400
Fort Boise ↗ Q3077782 EXACT TITLE
becomeboisecapitaldifferentestablishedgovernmentidahonearnorthernwestern
SHARED TOKENS (10): "become", "boise", "capital", "different", "established", "government", "idaho", "near", "northern", "western". | EXACT TITLE in military: "Fort Boise".
0.380
approximatelydevelopmenteducationestablishedorganizationspolicyprogramspublicrelated
SHARED TOKENS (9): "approximately", "development", "education", "established", "organizations", "policy", "programs", "public", "related". | EXACT TITLE in military: "American Council on Education".
0.380
aircapacitydesigndevelopmentforcesmeansnationalprovidesupply
SHARED TOKENS (9): "air", "capacity", "design", "development", "forces", "means", "national", "provide", "supply". | EXACT TITLE in military: "Military aviation".
0.380
activityestablishedgovernmentnationalprogramresourcessupportunderstandingwork
SHARED TOKENS (9): "activity", "established", "government", "national", "program", "resources", "support", "understanding", "work". | EXACT TITLE in military: "Employer Support of the Guard and Reserve".
0.360
Colocation ↗ EXACT TITLE
businesscenterdataofficesinglespacestructuresystem
SHARED TOKENS (8): "business", "center", "data", "office", "single", "space", "structure", "system". | EXACT TITLE in data_center: "Colocation".
0.360
aroundbusinesselectricalgenerationidahopurchasedregulatedutility
SHARED TOKENS (8): "around", "business", "electrical", "generation", "idaho", "purchased", "regulated", "utility". | EXACT TITLE in data_center: "Idaho Power".
0.360
aircertificationcommercialcontrolgovernmentspacesurroundingtransportation
SHARED TOKENS (8): "air", "certification", "commercial", "control", "government", "space", "surrounding", "transportation". | EXACT TITLE in military: "Federal Aviation Administration".
0.360
aroundfireindividualintendedoperationsreadinesssupporttraining
SHARED TOKENS (8): "around", "fire", "individual", "intended", "operations", "readiness", "support", "training". | EXACT TITLE in military: "Brigade Combat Team".
0.360
businessconstraintscontextcontrolneedsprovidingrelatedunderstanding
SHARED TOKENS (8): "business", "constraints", "context", "control", "needs", "providing", "related", "understanding". | EXACT TITLE in military: "Mission command".
0.360
conditionscontrolgovernmentnationalprocurementrolesupplytraining
SHARED TOKENS (8): "conditions", "control", "government", "national", "procurement", "role", "supply", "training". | EXACT TITLE in military: "Title 32 of the United States Code".
0.340
activeairbecomemakesnationalregionrole
SHARED TOKENS (7): "active", "air", "become", "makes", "national", "region", "role". | EXACT TITLE in military: "Air National Guard".
0.340
benefitsdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (7): "benefits", "development", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in military: "Idaho Department of Labor".
0.340
differentespeciallylawphysicalsourcesystemsusers
SHARED TOKENS (7): "different", "especially", "law", "physical", "source", "systems", "users". | EXACT TITLE in data_center: "Water right".
0.340
communicationdataindividualinfrastructurephysicalprovidesystems
SHARED TOKENS (7): "communication", "data", "individual", "infrastructure", "physical", "provide", "systems". | EXACT TITLE in data_center: "Internet infrastructure".
0.340
designeddevelopmenteducationprofessionalprogramsschoolstraining
SHARED TOKENS (7): "designed", "development", "education", "professional", "programs", "schools", "training". | EXACT TITLE in military: "Professional military education".
0.340
Disaster recovery ↗ EXACT TITLE
disasteremergencyinformationinfrastructureplanprofessionaltechnology
SHARED TOKENS (7): "disaster", "emergency", "information", "infrastructure", "plan", "professional", "technology". | EXACT TITLE in data_center: "Disaster recovery".
0.340
airanotherdesignexpandingformerlawthem
SHARED TOKENS (7): "air", "another", "design", "expanding", "former", "law", "them". | EXACT TITLE in data_center: "Air cooling".
0.320
buildingsbuiltconservationdevelopmentenvironmentspecifically
SHARED TOKENS (6): "buildings", "built", "conservation", "development", "environment", "specifically". | EXACT TITLE in military: "Historic preservation".
0.320
idahooperatedprovidepublicutilitiesutility
SHARED TOKENS (6): "idaho", "operated", "provide", "public", "utilities", "utility". | EXACT TITLE in data_center: "Idaho Public Utilities Commission".
0.320
activityidahomainpercentprogramspublic
SHARED TOKENS (6): "activity", "idaho", "main", "percent", "programs", "public". | EXACT TITLE in military: "Idaho State University".
0.310
airboisegovernmentidahomainnationalsecurityserve
SHARED TOKENS (8): "air", "boise", "government", "idaho", "main", "national", "security", "serve". | URL->B (3): https://www.imd.idaho.gov/, https://www.imd.idaho.gov/idaho-air-national-guard/.
0.300
architectureassociateddatademanddigitalenvironmentinfrastructurelargemapnodenodesoperatingprovideprovidersreducerequireresourcesscalestoragesystem
SHARED TOKENS (20): "architecture", "associated", "data", "demand", "digital", "environment", "infrastructure", "large", "map", "node", "nodes", "operating", "provide", "providers", "reduce", "require", "resources", "scale", "storage", "system".
0.300
aircontinuedcontrolcoordinationdedicatedeffectsespeciallyfireforceslatermajorneedoperationsproximityrelatedrequiresupport
SHARED TOKENS (17): "air", "continued", "control", "coordination", "dedicated", "effects", "especially", "fire", "forces", "later", "major", "need", "operations", "proximity", "related", "require", "support".
0.300
contractorscustomergovernmentlawwork
SHARED TOKENS (5): "contractors", "customer", "government", "law", "work". | EXACT TITLE in military: "Prime contractor".
0.300
capacityconservationdemandenergygenerationgrowthintegratedlawlong-termmeansplanningpublicresourcesupplyutilitiesutility
SHARED TOKENS (16): "capacity", "conservation", "demand", "energy", "generation", "growth", "integrated", "law", "long-term", "means", "planning", "public", "resource", "supply", "utilities", "utility".
0.300
anothercapitalcontrolestablishedforcesformergovernmenthistorylargemajormeansmillionnorthernoperatingoperationsplanningpresencerelatedresponsibilitysecurity
SHARED TOKENS (22): "another", "capital", "control", "established", "forces", "former", "government", "history", "large", "major", "means", "million", "northern", "operating", "operations", "planning", "presence", "related", "responsibility", "security"....
0.300
activeactivityairbecomecannotcapacitycontroldependingdifferentdistinctemergencyforcesgovernmentindividuallawnationalnearlyoperateorganizedoriginal
SHARED TOKENS (24): "active", "activity", "air", "become", "cannot", "capacity", "control", "depending", "different", "distinct", "emergency", "forces", "government", "individual", "law", "national", "nearly", "operate", "organized", "original"....
0.300
Military engineering ↗ KW CROSS HIGH
accordingactivityconstructioncontrolelectricalenvironmentenvironmentalfireintelligencelogisticsmaintainoperateoperatingphysicalrelatedschoolsshapespecializedstructuressupport
SHARED TOKENS (22): "according", "activity", "construction", "control", "electrical", "environment", "environmental", "fire", "intelligence", "logistics", "maintain", "operate", "operating", "physical", "related", "schools", "shape", "specialized", "structures", "support"....
0.300
associatedbenefitsdisasterenougheventeventsexperiencefirelargemainphysicalpointrelatedreportedshowsupport
SHARED TOKENS (16): "associated", "benefits", "disaster", "enough", "event", "events", "experience", "fire", "large", "main", "physical", "point", "related", "reported", "show", "support".
0.300
additionalaroundcategorydeliverydevelopmentenvironmentinfrastructuremainmodeloperatingphysicalplatformprovidingresourcesscalesoftwaresystemstraditional
SHARED TOKENS (18): "additional", "around", "category", "delivery", "development", "environment", "infrastructure", "main", "model", "operating", "physical", "platform", "providing", "resources", "scale", "software", "systems", "traditional".
0.300
analysisbroadercapabilitiesdatadecisionsdisciplineenvironmentforcesinformationintelligencemaintainoperationaloperationsplanningprovideprovidingsourcestrainingtransition
SHARED TOKENS (19): "analysis", "broader", "capabilities", "data", "decisions", "discipline", "environment", "forces", "information", "intelligence", "maintain", "operational", "operations", "planning", "provide", "providing", "sources", "training", "transition".
0.300
allowingconnectionsdatadeliverydistinctinfrastructurelargenetworknetworksoperatephysicalpointprimaryprivateprovidersreduce
SHARED TOKENS (16): "allowing", "connections", "data", "delivery", "distinct", "infrastructure", "large", "network", "networks", "operate", "physical", "point", "primary", "private", "providers", "reduce".
0.300
datadeliverydifferentgeographicallyintelligencelargelayerlivenetworkoperatorsprovideproviderssecurityservesocialsoftwareusers
SHARED TOKENS (17): "data", "delivery", "different", "geographically", "intelligence", "large", "layer", "live", "network", "operators", "provide", "providers", "security", "serve", "social", "software", "users".
0.300
Peak demand ↗ Q3393666 KW CROSS HIGH
annualcapacitycommercialcustomerdemandelectricalenergyevenindividualindustrialoperatingpointsinglesupplytransitionutilitiesutility
SHARED TOKENS (17): "annual", "capacity", "commercial", "customer", "demand", "electrical", "energy", "even", "individual", "industrial", "operating", "point", "single", "supply", "transition", "utilities", "utility".
0.300
advancedanalysisaroundcommunicationcurrentforcesinformationinstitutionslatermaintainsecuritysignalssocialsystemsthem
SHARED TOKENS (15): "advanced", "analysis", "around", "communication", "current", "forces", "information", "institutions", "later", "maintain", "security", "signals", "social", "systems", "them".
0.300
accessallowsbecomebuiltconnectedcurrentdeliveryelectricalenergylargemarketsmeaningmillionnearlyneednetworkoperatesecuritysizesmall
SHARED TOKENS (23): "access", "allows", "become", "built", "connected", "current", "delivery", "electrical", "energy", "large", "markets", "meaning", "million", "nearly", "need", "network", "operate", "security", "size", "small"....
0.300
contextdecisionsdevelopmenteffectsenvironmentalimpactsjustifymajorparticipationplanplanspolicyprogramprojectprojectspublicpurposeratherrelevantrequire
SHARED TOKENS (21): "context", "decisions", "development", "effects", "environmental", "impacts", "justify", "major", "participation", "plan", "plans", "policy", "program", "project", "projects", "public", "purpose", "rather", "relevant", "require"....
0.300
activityanotherbusinesscapitalcentralcompetitivecontrolcreateeffectsgovernmentlawmarketoperatingoperationsprovidingregulatoryrequiresinglesize
SHARED TOKENS (19): "activity", "another", "business", "capital", "central", "competitive", "control", "create", "effects", "government", "law", "market", "operating", "operations", "providing", "regulatory", "require", "single", "size".
0.300
additionalcontrolcontrolsdataestablishedfinancialframeworkinformationintegratedintendedinternaloperatingorganizationsprovidepublicrelevantreportreportingsystemsystems
SHARED TOKENS (21): "additional", "control", "controls", "data", "established", "financial", "framework", "information", "integrated", "intended", "internal", "operating", "organizations", "provide", "public", "relevant", "report", "reporting", "system", "systems"....
0.300
accessbusinessbusinesseschangesdataimportantinformationlocalnetworknetworksprivateprovidersprovidingpublicsecurityservingtechnology
SHARED TOKENS (17): "access", "business", "businesses", "changes", "data", "important", "information", "local", "network", "networks", "private", "providers", "providing", "public", "security", "serving", "technology".
0.300
accessaccountingbusinesscapabilitiescapacitycategorycommercialconnectionsdatadevelopmentessentialexistingfutureglobalinformationintegratedlargemainmanufacturingmarket
SHARED TOKENS (37): "access", "accounting", "business", "capabilities", "capacity", "category", "commercial", "connections", "data", "development", "essential", "existing", "future", "global", "information", "integrated", "large", "main", "manufacturing", "market"....
0.300
centerconnecteddatadeliverydesignedgeexpandedmodelnearnetworksphysicallyreducesourcesstoragesystemsusers
SHARED TOKENS (16): "center", "connected", "data", "delivery", "design", "edge", "expanded", "model", "near", "networks", "physically", "reduce", "sources", "storage", "systems", "users".
0.300
aroundcapitalcontractcontractingdevelopmentfinancialgovernmenthospitalsinfrastructureinstitutionsinvestmentlong-termoperatingprivateprojectspublicpurposerelatedreturnschools
SHARED TOKENS (24): "around", "capital", "contract", "contracting", "development", "financial", "government", "hospitals", "infrastructure", "institutions", "investment", "long-term", "operating", "private", "projects", "public", "purpose", "related", "return", "schools"....
0.300
benefitseducationemergencyestablishedexpandedfacilitiesfuturegovernmenthealthcareinsurancelong-termnationalofficesprogramproviding
SHARED TOKENS (15): "benefits", "education", "emergency", "established", "expanded", "facilities", "future", "government", "healthcare", "insurance", "long-term", "national", "offices", "program", "providing".
0.300
activecentercommercialdataevenfacilitiesfacilityframeworkgeographicallyinfrastructurelargeoperationalphysicalprovidersratherremainrequiresinglesupplysystem
SHARED TOKENS (21): "active", "center", "commercial", "data", "even", "facilities", "facility", "framework", "geographically", "infrastructure", "large", "operational", "physical", "providers", "rather", "remain", "require", "single", "supply", "system"....
0.300
activeairapproximatelycontrolestablishedforcesglobalintegratedintelligencelandlargestnationaloperationaloperationssecuritysupportthem
SHARED TOKENS (17): "active", "air", "approximately", "control", "established", "forces", "global", "integrated", "intelligence", "land", "largest", "national", "operational", "operations", "security", "support", "them".
0.300
accordingbasecannotconditionscontrolledcoordinationdecisionsdependingdistinctioneffectsemploymentforcesinvolvinglimitedmodeloperationsproducingprovidepurposereadiness
SHARED TOKENS (28): "according", "base", "cannot", "conditions", "controlled", "coordination", "decisions", "depending", "distinction", "effects", "employment", "forces", "involving", "limited", "model", "operations", "producing", "provide", "purpose", "readiness"....
0.300
addressaircannotdemanddevelopmenteducationenergyenvironmentenvironmentalexpandedglobalimpactsindividualindustrialindustryinstitutionslandlargelivemajor
SHARED TOKENS (30): "address", "air", "cannot", "demand", "development", "education", "energy", "environment", "environmental", "expanded", "global", "impacts", "individual", "industrial", "industry", "institutions", "land", "large", "live", "major"....
0.300
articlebecomecapitalcommercecontractsgovernmentlargestlawnationalofficeofficesprovideserveservingstructuresupportthem
SHARED TOKENS (17): "article", "become", "capital", "commerce", "contracts", "government", "largest", "law", "national", "office", "offices", "provide", "serve", "serving", "structure", "support", "them".
0.300
advancedaircontractcontractsdevelopmentforcesgovernmentintelligencelogisticsmillionnationalofficeoperationsprojectsprovideregionalrelatedschoolschoolssecurity
SHARED TOKENS (22): "advanced", "air", "contract", "contracts", "development", "forces", "government", "intelligence", "logistics", "million", "national", "office", "operations", "projects", "provide", "regional", "related", "school", "schools", "security"....
0.300
allowingcompliancedifferentenergyfuellimitedmarketpercentpolicyprivateprogramsregulatoryresourcessourcessupplysupportingutilities
SHARED TOKENS (17): "allowing", "compliance", "different", "energy", "fuel", "limited", "market", "percent", "policy", "private", "programs", "regulatory", "resources", "sources", "supply", "supporting", "utilities".
0.300
cannotconstructiondesigndevelopmentdisciplineevenfacilitiesforceslogisticsoperationsplanningpurposestoragesupplysupport
SHARED TOKENS (15): "cannot", "construction", "design", "development", "discipline", "even", "facilities", "forces", "logistics", "operations", "planning", "purpose", "storage", "supply", "support".
0.300
accordingassociatedbusinesscapabilitiescentralcustomerinformationinfrastructureintegratedneedoperatingoperationalorganizationsorganizedrelevanceresourcesrolesecuresupportsupports
SHARED TOKENS (23): "according", "associated", "business", "capabilities", "central", "customer", "information", "infrastructure", "integrated", "need", "operating", "operational", "organizations", "organized", "relevance", "resources", "role", "secure", "support", "supports"....
0.300
anotherarticlebuildingscentercentralconstructioncontinueddedicateddesignexpandedforcesglobalhistoryinfrastructureintelligencelawlong-termmarketmillionnational
SHARED TOKENS (35): "another", "article", "buildings", "center", "central", "construction", "continued", "dedicated", "design", "expanded", "forces", "global", "history", "infrastructure", "intelligence", "law", "long-term", "market", "million", "national"....
0.300
airdifferentnationalorganizationsorganized
SHARED TOKENS (5): "air", "different", "national", "organizations", "organized". | EXACT TITLE in military: "Army National Guard".
0.300
Solar power ↗ Q1483757 KW CROSS HIGH
builtcapacitycommercialconcentratedconversioncurrentenergygenerationglobalimportantlargepolicyprimarysecuritysinglesmallsourcesystemsystems
SHARED TOKENS (19): "built", "capacity", "commercial", "concentrated", "conversion", "current", "energy", "generation", "global", "important", "large", "policy", "primary", "security", "single", "small", "source", "system", "systems".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancialfirmfirmsinvestmentlimitedlong-termoperationalprivateprovidepublicratherrole
SHARED TOKENS (21): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "financial", "firm", "firms", "investment", "limited", "long-term", "operational", "private", "provide", "public", "rather", "role"....
0.300
builtbusinessbusinessescommercialcontractcontractscustomerdependingdesignedenergyespeciallyfirmsfuelgenerationgovernmentlong-termmarketratherreportedrole
SHARED TOKENS (23): "built", "business", "businesses", "commercial", "contract", "contracts", "customer", "depending", "designed", "energy", "especially", "firms", "fuel", "generation", "government", "long-term", "market", "rather", "reported", "role"....
0.300
Outsourcing ↗ Q61515 KW CROSS HIGH
anotherbusinesscentercontractingcontrolevenfacilityfirmindustrialinternaljobslaterlimitedmanufacturingoperationalpresenceprivateproviderspublicseparate
SHARED TOKENS (22): "another", "business", "center", "contracting", "control", "even", "facility", "firm", "industrial", "internal", "jobs", "later", "limited", "manufacturing", "operational", "presence", "private", "providers", "public", "separate"....
0.300
accordingallowscapacitycentralcompliancecustomerdatadedicatedglobalgovernmentinfrastructurelocalmarketmarketsmodelnetworkoperatingphysicalplatformsprovide
SHARED TOKENS (34): "according", "allows", "capacity", "central", "compliance", "customer", "data", "dedicated", "global", "government", "infrastructure", "local", "market", "markets", "model", "network", "operating", "physical", "platforms", "provide"....
0.300
additionaladvancedarounddescribesdevelopmentemploymentessentialexperienceindividualinstitutionsknowledgeorganizationsplanningprofessionalregulatoryresourcesschoolssupporttrainingwork
SHARED TOKENS (20): "additional", "advanced", "around", "describes", "development", "employment", "essential", "experience", "individual", "institutions", "knowledge", "organizations", "planning", "professional", "regulatory", "resources", "schools", "support", "training", "work".
0.300
aroundbuildingsbusinessdatadesignedelectricalemergencyenergylargeprovidesinglesizesourcesourcessupplysystem
SHARED TOKENS (16): "around", "buildings", "business", "data", "designed", "electrical", "emergency", "energy", "large", "provide", "single", "size", "source", "sources", "supply", "system".
0.300
airaroundcapabilitiesdesigndesignedfacilitiesforcesintendedlandprogramproviderolestatedsupportsystems
SHARED TOKENS (15): "air", "around", "capabilities", "design", "designed", "facilities", "forces", "intended", "land", "program", "provide", "role", "stated", "support", "systems".
0.300
annualaroundcertificationcontinueddifferenteffectsenergyexistingframeworkglobalgovernmentinvestmentlargestmainmeaningnationalneedorganizationsrequiresmall
SHARED TOKENS (20): "annual", "around", "certification", "continued", "different", "effects", "energy", "existing", "framework", "global", "government", "investment", "largest", "main", "meaning", "national", "need", "organizations", "require", "small".
0.300
aircompetitiveeducationforcesoperateoperationsorganizedparticipationpercentprogramprogramsratherrelatedreturnschoolschoolsseparateservespacetraining
SHARED TOKENS (20): "air", "competitive", "education", "forces", "operate", "operations", "organized", "participation", "percent", "program", "programs", "rather", "related", "return", "school", "schools", "separate", "serve", "space", "training".
0.300
accessbusinesscontroldatadigitaldisciplinedisclosuregovernmentimpactsindustryinformationinfrastructureintendedinternalknowledgemajornetworksoperationsphysicalplanning
SHARED TOKENS (31): "access", "business", "control", "data", "digital", "discipline", "disclosure", "government", "impacts", "industry", "information", "infrastructure", "intended", "internal", "knowledge", "major", "networks", "operations", "physical", "planning"....
🫐 BERRY83 edges
0.280
commercecontrolscybersecuritygovernmenthelpinformationintendednationalprogramsproviderelatedsecuritysystemstechnology
SHARED TOKENS (14): "commerce", "controls", "cybersecurity", "government", "help", "information", "intended", "national", "programs", "provide", "related", "security", "systems", "technology".
0.280
aircontrolenergyenvironmentfinancialforceslogisticsnationalofficeoperationsorganizedsecurityspacetechnology
SHARED TOKENS (14): "air", "control", "energy", "environment", "financial", "forces", "logistics", "national", "office", "operations", "organized", "security", "space", "technology".
0.280
accordingaircentraldesigneddevelopmentintegratedinternaloperatingpermanentreducesinglesmallsystemsystems
SHARED TOKENS (14): "according", "air", "central", "designed", "development", "integrated", "internal", "operating", "permanent", "reduce", "single", "small", "system", "systems".
0.280
Cyberwarfare ↗ Q849340 KW CROSS HIGH
activeassociatedcapabilitiesdigitalevenforcesintendedoperationsphysicalrealscalesignificanttraditionalview
SHARED TOKENS (14): "active", "associated", "capabilities", "digital", "even", "forces", "intended", "operations", "physical", "real", "scale", "significant", "traditional", "view".
0.280
arounddecisionsdesignedeffectsenvironmentenvironmentalestablishedgovernmentimpactslawnationalpolicyresponsibilitysignificant
SHARED TOKENS (14): "around", "decisions", "designed", "effects", "environment", "environmental", "established", "government", "impacts", "law", "national", "policy", "responsibility", "significant".
0.280
Iraq War ↗ Q545449 KW CROSS HIGH
additionalaroundbroadereffectsestablishedforcesgovernmentlawmillionprimaryreportsecuritysupportsupporting
SHARED TOKENS (14): "additional", "around", "broader", "effects", "established", "forces", "government", "law", "million", "primary", "report", "security", "support", "supporting".
0.260
connectionsdatadependingdesignedelectricalenoughespeciallyhistoricallynetworksignalsspecializedstructuretraditional
SHARED TOKENS (13): "connections", "data", "depending", "designed", "electrical", "enough", "especially", "historically", "network", "signals", "specialized", "structure", "traditional".
0.260
Civil service ↗ KW CROSS HIGH
conditionsdistinctionestablishedgovernmentinternallocalnationalorganizationspublicpurposeratherrelatedsystem
SHARED TOKENS (13): "conditions", "distinction", "established", "government", "internal", "local", "national", "organizations", "public", "purpose", "rather", "related", "system".
0.260
airbasefacilities
SHARED TOKENS (3): "air", "base", "facilities". | EXACT TITLE in military: "Joint-use airport".
0.260
Tax holiday ↗ Q3504234 KW CROSS HIGH
businessbusinessescreateexistinggrowthinvestmentlawlocalnationalprivatepurposereduceresources
SHARED TOKENS (13): "business", "businesses", "create", "existing", "growth", "investment", "law", "local", "national", "private", "purpose", "reduce", "resources".
0.260
articleinformationnational
SHARED TOKENS (3): "article", "information", "national". | EXACT TITLE in military: "Search and rescue".
0.260
airestablishednational
SHARED TOKENS (3): "air", "established", "national". | EXACT TITLE in military: "National Guard Bureau".
0.260
buildingscapacityconnectedconnectionsconnectsdifferentenvironmentinformationlargeneedsnetworknetworksproviding
SHARED TOKENS (13): "buildings", "capacity", "connected", "connections", "connects", "different", "environment", "information", "large", "needs", "network", "networks", "providing".
0.260
regionwestwestern
SHARED TOKENS (3): "region", "west", "western". | EXACT TITLE in data_center: "Intermountain West".
0.260
Combined arms ↗ Q1418029 KW CROSS HIGH
accordingairanotherdifferenteffectsenvironmentforceslandspacestructuresupportsupportingsupports
SHARED TOKENS (13): "according", "air", "another", "different", "effects", "environment", "forces", "land", "space", "structure", "support", "supporting", "supports".
0.240
airarticlecurrentdifferentforcesformerlawnationalrelatedseparatespacesystems
SHARED TOKENS (12): "air", "article", "current", "different", "forces", "former", "law", "national", "related", "separate", "space", "systems".
0.240
associatedcontextdedicatededucationhistoryinstitutionsnationalregionregionalrelatedservetechnology
SHARED TOKENS (12): "associated", "context", "dedicated", "education", "history", "institutions", "national", "region", "regional", "related", "serve", "technology".
0.240
accessdesigneddistinctforcesimportantlandlimitedpublicservespecificallytechnologytraining
SHARED TOKENS (12): "access", "designed", "distinct", "forces", "important", "land", "limited", "public", "serve", "specifically", "technology", "training".
0.240
accordingattachedcontroldevelopmentforcesindividualinformationmeaningphysicalresourcessystemtechnical
SHARED TOKENS (12): "according", "attached", "control", "development", "forces", "individual", "information", "meaning", "physical", "resources", "system", "technical".
0.240
Managed services ↗ KW CROSS HIGH
customerdemandenvironmentinformationinfrastructurelong-termmodelresponsibilitysystemstechnicaltechnologytraditional
SHARED TOKENS (12): "customer", "demand", "environment", "information", "infrastructure", "long-term", "model", "responsibility", "systems", "technical", "technology", "traditional".
0.240
businesschangesconditionsdeliverydisasterenvironmentenvironmentalintendedoperationsorganizationsplanningsystems
SHARED TOKENS (12): "business", "changes", "conditions", "delivery", "disaster", "environment", "environmental", "intended", "operations", "organizations", "planning", "systems".
0.240
activedesignedemergencyestablishedforceslargestnationaloperationsprovidingroletrainingwork
SHARED TOKENS (12): "active", "designed", "emergency", "established", "forces", "largest", "national", "operations", "providing", "role", "training", "work".
0.240
airforceslandlargestmainmajornationaloperatedprojectedsystemstrainingwestern
SHARED TOKENS (12): "air", "forces", "land", "largest", "main", "major", "national", "operated", "projected", "systems", "training", "western".
0.240
addressdescribeseffectsespeciallyindustrialindustrymeaningpolicypublicsignificantsupplythem
SHARED TOKENS (12): "address", "describes", "effects", "especially", "industrial", "industry", "meaning", "policy", "public", "significant", "supply", "them".
0.220
airapproximatelyindustrialresourceresourcesservesmallsourcesourcessouthsupply
SHARED TOKENS (11): "air", "approximately", "industrial", "resource", "resources", "serve", "small", "source", "sources", "south", "supply".
0.220
Shooting range ↗ Q521839 KW CROSS HIGH
airdesignedevenfacilitylawoperatedproviderelevantspecializedspecificallytraining
SHARED TOKENS (11): "air", "designed", "even", "facility", "law", "operated", "provide", "relevant", "specialized", "specifically", "training".
0.220
Taxiway ↗ Q910386 EXACT TITLE
facilitiesoperators
SHARED TOKENS (2): "facilities", "operators". | EXACT TITLE in military: "Taxiway".
0.220
Dark fibre ↗ Q1878571 KW CROSS HIGH
additionalcapacitycommunicationdatademandinfrastructurelatermarketnetworkprivatetraditional
SHARED TOKENS (11): "additional", "capacity", "communication", "data", "demand", "infrastructure", "later", "market", "network", "private", "traditional".
0.220
compliancemaintain
SHARED TOKENS (2): "compliance", "maintain". | EXACT TITLE in military: "Aircraft maintenance".
0.220
becomechangesfireforcesfuelimportantlandlocalpresencesourcewest
SHARED TOKENS (11): "become", "changes", "fire", "forces", "fuel", "important", "land", "local", "presence", "source", "west".
0.220
Runway ↗ Q184590 EXACT TITLE
builtdesigned
SHARED TOKENS (2): "built", "designed". | EXACT TITLE in military: "Runway".
0.220
lawmillionnationalneedsofficepolicyprogramprogramspublicresourcesthem
SHARED TOKENS (11): "law", "million", "national", "needs", "office", "policy", "program", "programs", "public", "resources", "them".
0.220
commercialdesigndesignedmodeloperationspublicregulatedspacestructuresystemstraining
SHARED TOKENS (11): "commercial", "design", "designed", "model", "operations", "public", "regulated", "space", "structure", "systems", "training".
0.220
accessdevelopmentglobalinfrastructurelaterplatformprofessionalprojectsoftwaresupportssystems
SHARED TOKENS (11): "access", "development", "global", "infrastructure", "later", "platform", "professional", "project", "software", "supports", "systems".
0.220
categorycenterdatadata-centerdescribesenergyfacilityglobalinfrastructurespecificallysupports
SHARED TOKENS (11): "category", "center", "data", "data-center", "describes", "energy", "facility", "global", "infrastructure", "specifically", "supports".
0.220
boiseidaho
SHARED TOKENS (2): "boise", "idaho". | EXACT TITLE in military: "Idaho State Veterans Cemetery".
0.220
HITRUST ↗ Q5629803 EXACT TITLE
complianceinformation
SHARED TOKENS (2): "compliance", "information". | EXACT TITLE in data_center: "HITRUST".
0.220
deliveryinformationprovideprovidersreportsecuresmallsupportssystemsystemstechnology
SHARED TOKENS (11): "delivery", "information", "provide", "providers", "report", "secure", "small", "supports", "system", "systems", "technology".
0.210
means
SHARED TOKENS (1): "means". | EXACT TITLE in data_center: "Liquid cooling".
0.200
businessdevelopmentlandmajormillionnationalofficeoperationsprivatesystem
SHARED TOKENS (10): "business", "development", "land", "major", "million", "national", "office", "operations", "private", "system".
0.200
aircapacityexpandedlawmakesnationaloriginalsecurityspaceupdated
SHARED TOKENS (10): "air", "capacity", "expanded", "law", "makes", "national", "original", "security", "space", "updated".
0.200
boisedatademandidahomajormarketsemiconductorsouthstoragetechnology
SHARED TOKENS (10): "boise", "data", "demand", "idaho", "major", "market", "semiconductor", "south", "storage", "technology".
0.200
EXACT TITLE in military: "Adjutant general".
0.200
Military base ↗ Q245016 KW CROSS HIGH
airbasecenterfacilityhelpoperateoperatedoperationsprovidetraining
SHARED TOKENS (10): "air", "base", "center", "facility", "help", "operate", "operated", "operations", "provide", "training".
0.200
becomecontrolcontrolledenvironmentalessentialexpandedfireinfrastructuremonitoringsystem
SHARED TOKENS (10): "become", "control", "controlled", "environmental", "essential", "expanded", "fire", "infrastructure", "monitoring", "system".
0.200
additionalconditionsdesigneddevelopmentdifferentfuellargesignificantsizework
SHARED TOKENS (10): "additional", "conditions", "designed", "development", "different", "fuel", "large", "significant", "size", "work".
0.200
airconditionscreatesenvironmentevenfirephysicalpublicsystemthem
SHARED TOKENS (10): "air", "conditions", "creates", "environment", "even", "fire", "physical", "public", "system", "them".
0.200
digitalestablishedfinancialfirmsindustryonlineplatformssystemstechnologytraditional
SHARED TOKENS (10): "digital", "established", "financial", "firms", "industry", "online", "platforms", "systems", "technology", "traditional".
0.180
accessallowingindividualinformationneedsorganizationsprivatesecuritythem
SHARED TOKENS (9): "access", "allowing", "individual", "information", "needs", "organizations", "private", "security", "them".
0.180
Machine learning ↗ Q2539 KW CROSS HIGH
analysisapproximatelydatadevelopmentframeworkintelligencenetworksrelatedtraditional
SHARED TOKENS (9): "analysis", "approximately", "data", "development", "framework", "intelligence", "networks", "related", "traditional".
0.180
adaboisegovernmentidahomainmunicipalnearlyseparatestreet
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "main", "municipal", "nearly", "separate", "street".
0.180
Air rights ↗ Q4698374 KW CROSS HIGH
airdevelopmentestateimportantlandlawrealrightsspace
SHARED TOKENS (9): "air", "development", "estate", "important", "land", "law", "real", "rights", "space".
0.180
451 Group ↗ Q55602817 KW CROSS HIGH
centerdatafirmglobalindustryinformationoperatingoperatorstechnology
SHARED TOKENS (9): "center", "data", "firm", "global", "industry", "information", "operating", "operators", "technology".
0.160
airanotheremergencyfacilityhospitallocalmeanstreatment
SHARED TOKENS (8): "air", "another", "emergency", "facility", "hospital", "local", "means", "treatment".
0.160
approximatelyboisedataevengovernmentidahosinglesouth
SHARED TOKENS (8): "approximately", "boise", "data", "even", "government", "idaho", "single", "south".
0.160
accordingannouncementdatainfrastructureplatformpublicstatedstorage
SHARED TOKENS (8): "according", "announcement", "data", "infrastructure", "platform", "public", "stated", "storage".
0.160
activeaddresscontrolcoordinationemergencynationalprovidingsystem
SHARED TOKENS (8): "active", "address", "control", "coordination", "emergency", "national", "providing", "system".
0.160
centralcreatedatahistorylargelargestoperatetraditional
SHARED TOKENS (8): "central", "create", "data", "history", "large", "largest", "operate", "traditional".
0.140
disciplinedistinctemergencyforceslawseparatesystems
SHARED TOKENS (7): "discipline", "distinct", "emergency", "forces", "law", "separate", "systems".
0.140
describesdocumentgovernmentprocurementsystemupdatedvalue
SHARED TOKENS (7): "describes", "document", "government", "procurement", "system", "updated", "value".
0.140
airbenefitsenergylargereducesystemstransition
SHARED TOKENS (7): "air", "benefits", "energy", "large", "reduce", "systems", "transition".
0.140
forcesgovernmentindividuallawnationalsecuritytherefore
SHARED TOKENS (7): "forces", "government", "individual", "law", "national", "security", "therefore".
0.140
anothercommunicationelectricalinformationlocalnetworkssignals
SHARED TOKENS (7): "another", "communication", "electrical", "information", "local", "networks", "signals".
0.140
decisionsdesignedinformationmakesnetworksystemsystems
SHARED TOKENS (7): "decisions", "designed", "information", "makes", "network", "system", "systems".
0.140
landlargestnationalprogramprogramsschoolstraining
SHARED TOKENS (7): "land", "largest", "national", "program", "programs", "schools", "training".
0.140
approximatelybenefitscategorycurrentformermillionrights
SHARED TOKENS (7): "approximately", "benefits", "category", "current", "former", "million", "rights".
0.140
additionalbenefitscannotcapabilitieseducationhelptraining
SHARED TOKENS (7): "additional", "benefits", "cannot", "capabilities", "education", "help", "training".
0.140
Memorial Day ↗ Q371781 KW CROSS HIGH
annualbecomeclaimedforceslocalnationalserving
SHARED TOKENS (7): "annual", "become", "claimed", "forces", "local", "national", "serving".
0.120
Land development ↗ KW CROSS HIGH
developmentestatehousinglandpurposereal
SHARED TOKENS (6): "development", "estate", "housing", "land", "purpose", "real".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahonearlypercent
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "nearly", "percent".
0.120
accessestablishedidahoofficeprogrampublic
SHARED TOKENS (6): "access", "established", "idaho", "office", "program", "public".
0.120
articlecurrentforcesgovernmentidahooffice
SHARED TOKENS (6): "article", "current", "forces", "government", "idaho", "office".
0.120
differentmeansmodelneedprofessionalsocial
SHARED TOKENS (6): "different", "means", "model", "need", "professional", "social".
0.120
annualcenterdataenergyproducingsite
SHARED TOKENS (6): "annual", "center", "data", "energy", "producing", "site".
0.120
associatedboisecenteridaholargestvalley
SHARED TOKENS (6): "associated", "boise", "center", "idaho", "largest", "valley".
0.120
benefitsforceshealthcareinsuranceseparatedsocial
SHARED TOKENS (6): "benefits", "forces", "healthcare", "insurance", "separated", "social".
0.100
airindividualprimarysystemtraining
SHARED TOKENS (5): "air", "individual", "primary", "system", "training".
0.100
Eco-tariff ↗ Q3039667 KW CROSS HIGH
environmentenvironmentalfootprintlargepurpose
SHARED TOKENS (5): "environment", "environmental", "footprint", "large", "purpose".
0.100
controlforcesgovernmentprofessionaltechnical
SHARED TOKENS (5): "control", "forces", "government", "professional", "technical".
0.100
datagovgovernmentprocurementsystem
SHARED TOKENS (5): "data", "gov", "government", "procurement", "system".
0.100
accessdemandnetworkphysicalresources
SHARED TOKENS (5): "access", "demand", "network", "physical", "resources".
0.100
centercontrolmonitoringnetworkoperations
SHARED TOKENS (5): "center", "control", "monitoring", "network", "operations".
0.100
airgovernmentnationalorganizedsecurity
SHARED TOKENS (5): "air", "government", "national", "organized", "security".
◈ Frequently Asked Questions
Data Center × Military — Treasure Valley
HAIKU · HIGH GATE
How do military installations in Ada County influence data center zoning decisions?
Military presence in Ada County and Canyon County affects land-use planning classifications that determine where data centers can locate, since sensitive defense operations require buffer zones and restricted development patterns. The Idaho Department of Commerce coordinates with military stakeholders during zoning reviews to ensure data center expansion in Boise, Nampa, and Meridian does not interfere with essential military communications and security systems.
What role does computer security play in data center development near military resources in the Treasure Valley?
Data centers serving military operations must meet federal computer security standards that exceed typical commercial requirements, which shapes how Ada County and Canyon County approve new facilities. Boise and Meridian planning departments evaluate whether proposed data centers can maintain the physical security and encrypted systems that military contracts demand.
How does the Idaho Department of Commerce balance data center growth with military land-use priorities?
The Idaho Department of Commerce integrates military resource protection into regional development strategy for the Treasure Valley, ensuring data center zoning in Boise, Nampa, and Meridian supports both economic growth and defense infrastructure continuity. Ada County and Canyon County land-use plans explicitly coordinate commercial data center sites with military operational boundaries to prevent conflicts.
Why do military considerations affect data center location planning in Treasure Valley cities?
Military installations across Ada County and Canyon County require protection of airspace, communications frequencies, and classified operations, which constrains where Boise, Nampa, and Meridian can approve data center development. The Idaho Department of Commerce ensures that data center zoning and land-use planning maintain geographic separation from military systems and resources essential to national defense.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Data Center × Military 10 QID bridges 198 edges 5,167 ext links 2026-07-17 20:19:37 UTC 50c70528b665e50d
Data Center corridor ↗ Military corridor ↗ Military × Data Center ↗ boisestandard.org/standard ↗
Parent Corridors
Data Center × All Other Verticals